A0A087WR41_MOUSE Loading...

Serine protease 39

AlphaFold DB , UniProt , Accession A0A087WR41, Species MOUSE (Mus musculus, Mouse), Gene Prss39, Length 114 aa.

						>A0A087WR41_MOUSE|A0A087WR41|Prss39
MWGSRAQQSGPDRGGACLLAAFLLCFSLLHAQDYTPSQTPPPTSNTSLKPRGRVQKELCGKTKFQGKIYGGQIAKAERWPWQASLIFRGRHICGAVLIDKTWLLSAAHCFQRSS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	33.5	Very low	49.4	Very low	243 Å²	243	148.5 Å²	148.5	100%	1.197	83%	0.825	S	S	*	*				0	117.2	0	-70.1	160	94.8	0	0	106.8
2	W	42.7	Very low	49.9	Very low	238 Å²	238	149.1 Å²	149.1	90%	0.902	83%	0.826	S	S	*	*			trans	34.6	115.7	168.5	-121	-88.2	0	0	0	117.5
3	G	43.2	Very low	50.4	Low	64 Å²	64	155.8 Å²	155.8	66%	0.66	83%	0.831	S	S	*	*				67.1	119.4	67.6	0	0	0	0	0	109.1
4	S	44.7	Very low	50.5	Low	106 Å²	106	148.6 Å²	148.6	74%	0.741	81%	0.812	S	S	*	*				-159.8	128.5	83.9	-73.3	0	0	0	0	111.4
5	R	54.7	Low	50.9	Low	226 Å²	226	141.6 Å²	141.6	85%	0.853	79%	0.788	S	S	*	*			trans	-56.2	125.4	158.4	-177.8	-174.1	-64	-115.8	-0.1	108.7
6	A	52.4	Low	51.3	Low	85 Å²	85	137.1 Å²	137.1	70%	0.702	78%	0.775	S	S	*	*			trans	-109.2	108	159.3	0	0	0	0	0	107.6	Q8	A6-Q8 PolarHBondContact O-N 2.86Å
7	Q	58.8	Low	51.8	Low	178 Å²	178	134.4 Å²	134.4	83%	0.832	77%	0.765	S	S	*	*			trans	-66.9	120.1	160.4	-79.4	166.7	-91.2	0	0	107.3
8	Q	49.9	Very low	52.6	Low	183 Å²	183	133.3 Å²	133.3	86%	0.855	76%	0.756	S	S	*	*			trans	-107.7	109.7	162	-79.5	171.8	6.5	0	0	107.8	A6 G10	A6-Q8 PolarHBondContact O-N 2.86Å; Q8-G10 PolarHBondContact O-N 2.88Å
9	S	55.1	Low	53.6	Low	119 Å²	119	132.5 Å²	132.5	83%	0.832	75%	0.749	S	S	*	*	P	Polyproline II helix	trans	-52.2	125.5	168.5	44.9	0	0	0	0	110.2
10	G	57.3	Low	54.7	Low	69 Å²	69	128.4 Å²	128.4	71%	0.711	73%	0.732	S	S	*	*	P	Polyproline II helix	trans	-67	143.1	178.2	0	0	0	0	0	112.2	Q8	Q8-G10 PolarHBondContact O-N 2.88Å
11	P	51.4	Low	55.7	Low	122 Å²	122	124.9 Å²	124.9	79%	0.792	72%	0.719	S	S	*	*	P	Polyproline II helix	trans	-75.7	135.7	171	28.8	-31	0	0	0	111	R13	P11-R13 PolarHBondContact O-N 3.28Å
12	D	54.7	Low	57.7	Low	156 Å²	156	120 Å²	120	83%	0.834	69%	0.691	S	S	*	*	P	Polyproline II helix	trans	-50.8	120.2	178.4	-85.1	-48	0	0	0	112.7	G14	D12-G14 PolarHBondContact O-N 2.95Å
13	R	57	Low	59.2	Low	237 Å²	237	114.5 Å²	114.5	89%	0.894	68%	0.678	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.4	1.2	-176.3	-87.5	179.6	174.7	-136.4	-0.5	115.4	P11	P11-R13 PolarHBondContact O-N 3.28Å
14	G	52	Low	60.8	Low	55 Å²	55	117 Å²	117	57%	0.567	68%	0.676	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.6	-32.3	-174.1	0	0	0	0	0	115.8	D12	D12-G14 PolarHBondContact O-N 2.95Å
15	G	55.4	Low	62	Low	43 Å²	43	115.1 Å²	115.1	44%	0.443	66%	0.662	S	S	.	*	T	Hydrogen-bonded Turn	trans	-93.1	-29.3	-171.3	0	0	0	0	0	115.2	L19	G15-L19 PolarHBondContact O-N 3.45Å
16	A	58.3	Low	62.7	Low	70 Å²	70	110.5 Å²	110.5	58%	0.579	65%	0.649	S	S	*	*	H	α-helix	trans	-72.2	-33.1	-174.9	0	0	0	0	0	113.3	A20	A16-A20 WeakPolarHBondContact O-CB 3.23Å; A16-A20 PolarHBondContact O-N 2.84Å
17	C	59	Low	63.3	Low	91 Å²	91	110.6 Å²	110.6	62%	0.615	64%	0.644	S	S	*	*	H	α-helix	trans	-69.2	-35.5	178.7	-76.6	0	0	0	0	112.8	A21	C17-A21 WeakPolarHBondContact O-CB 3.44Å; C17-A21 PolarHBondContact O-N 2.9Å
18	L	65.9	Low	63.5	Low	114 Å²	114	108.5 Å²	108.5	60%	0.597	64%	0.638	S	S	*	*	H	α-helix	trans	-70.3	-43.7	179.3	-68	173.8	0	0	0	111	A21 F22	L18-A21 PolarHBondContact O-N 3.01Å; L18-F22 WeakPolarHBondContact O-CD2 3.39Å; L18-F22 PolarHBondContact O-N 3.32Å
19	L	72.2	Confident	63.9	Low	119 Å²	119	105.6 Å²	105.6	62%	0.623	63%	0.628	S	S	*	*	H	α-helix	trans	-63.9	-40.6	174.9	-69.1	172.5	0	0	0	112.2	G15 F22 L23	G15-L19 PolarHBondContact O-N 3.45Å; L19-F22 PolarHBondContact O-N 3.24Å; L19-L23 WeakPolarHBondContact O-CG 3.48Å; L19-L23 PolarHBondContact O-N 3.03Å
20	A	74.9	Confident	64	Low	49 Å²	49	106.6 Å²	106.6	41%	0.405	62%	0.619	S	S	.	*	H	α-helix	trans	-63.1	-41.5	174.5	0	0	0	0	0	112.2	A16 L23 L24	A16-A20 WeakPolarHBondContact O-CB 3.23Å; A16-A20 PolarHBondContact O-N 2.84Å; A20-L23 PolarHBondContact O-N 3.02Å; A20-L24 WeakPolarHBondContact O-CB 3.46Å; A20-L24 VanDerWaalsContact O-CG 3.3Å; A20-L24 WeakPolarHBondContact O-CG 3.43Å; A20-L24 PolarHBondContact O-N 3.14Å
21	A	75.7	Confident	63.8	Low	55 Å²	55	107.1 Å²	107.1	46%	0.455	62%	0.617	S	S	.	*	H	α-helix	trans	-65.1	-40.3	176.1	0	0	0	0	0	112.3	C17 L18 C25	C17-A21 WeakPolarHBondContact O-CB 3.44Å; C17-A21 PolarHBondContact O-N 2.9Å; L18-A21 PolarHBondContact O-N 3.01Å; A21-C25 VanDerWaalsContact O-CB 3.23Å; A21-C25 WeakPolarHBondContact O-CB 3.34Å; A21-C25 PolarHBondContact O-N 3.48Å
22	F	76.9	Confident	63.6	Low	141 Å²	141	109.3 Å²	109.3	62%	0.618	62%	0.616	S	S	*	*	H	α-helix	trans	-64.5	-43.5	175.7	-94	-78.5	0	0	0	112.7	L18 L19 C25 F26	L18-F22 WeakPolarHBondContact O-CD2 3.39Å; L18-F22 PolarHBondContact O-N 3.32Å; L19-F22 PolarHBondContact O-N 3.24Å; F22-C25 PolarHBondContact O-N 3.06Å; F22-F26 WeakPolarHBondContact O-CB 3.1Å; F22-F26 PolarHBondContact O-N 2.96Å
23	L	74.4	Confident	63.6	Low	122 Å²	122	108.5 Å²	108.5	64%	0.639	61%	0.612	S	S	*	*	H	α-helix	trans	-67.7	-37.9	178.4	-69.8	173.1	0	0	0	112.7	L19 A20 S27	L19-L23 WeakPolarHBondContact O-CG 3.48Å; L19-L23 PolarHBondContact O-N 3.03Å; A20-L23 PolarHBondContact O-N 3.02Å; L23-S27 WeakPolarHBondContact O-CB 3.46Å; L23-S27 PolarHBondContact O-N 3.29Å; L23-S27 PolarHBondContact O-OG 3.45Å
24	L	74.9	Confident	63.4	Low	116 Å²	116	107.3 Å²	107.3	61%	0.607	61%	0.609	S	S	*	*	H	α-helix	trans	-67.1	-39.8	173.8	-72.1	172.2	0	0	0	111.6	A20 S27 L28	A20-L24 WeakPolarHBondContact O-CB 3.46Å; A20-L24 VanDerWaalsContact O-CG 3.3Å; A20-L24 WeakPolarHBondContact O-CG 3.43Å; A20-L24 PolarHBondContact O-N 3.14Å; L24-S27 PolarHBondContact O-N 2.61Å; L24-L28 WeakPolarHBondContact O-CD1 3.32Å; L24-L28 WeakPolarHBondContact O-CG 3.35Å; L24-L28 PolarHBondContact O-N 3.24Å; L24-L28 VanDerWaalsContact O-N 3.11Å
25	C	71.8	Confident	63.4	Low	67 Å²	67	109.9 Å²	109.9	45%	0.453	61%	0.614	S	S	.	*	H	α-helix	trans	-66.5	-42.3	176.1	-163.5	0	0	0	0	112	A21 F22 S27 L28 L29	A21-C25 VanDerWaalsContact O-CB 3.23Å; A21-C25 WeakPolarHBondContact O-CB 3.34Å; A21-C25 PolarHBondContact O-N 3.48Å; F22-C25 PolarHBondContact O-N 3.06Å; C25-S27 VanDerWaalsContact C-N 3.31Å; C25-S27 PolarHBondContact O-N 2.97Å; C25-L28 PolarHBondContact O-N 2.99Å; C25-L29 PolarHBondContact O-N 3.33Å
26	F	68.3	Low	63.3	Low	129 Å²	129	112.2 Å²	112.2	57%	0.566	62%	0.621	S	S	*	*	H	α-helix	trans	-62.8	-35.5	174.7	-105.3	-93	0	0	0	112.8	F22 H30	F22-F26 WeakPolarHBondContact O-CB 3.1Å; F22-F26 PolarHBondContact O-N 2.96Å; F26-H30 AromaticContact CD1-CE1 3.92Å; F26-H30 PolarHBondContact O-N 3.35Å; F26-H30 PolarHBondContact O-ND1 3.16Å
27	S	65.1	Low	63	Low	87 Å²	87	114.1 Å²	114.1	61%	0.608	63%	0.63	S	S	*	*	H	α-helix	trans	-69.7	-34.4	176.3	-55.9	0	0	0	0	112.2	L23 L24 C25	L23-S27 WeakPolarHBondContact O-CB 3.46Å; L23-S27 PolarHBondContact O-N 3.29Å; L23-S27 PolarHBondContact O-OG 3.45Å; L24-S27 PolarHBondContact O-N 2.61Å; C25-S27 VanDerWaalsContact C-N 3.31Å; C25-S27 PolarHBondContact O-N 2.97Å
28	L	62.1	Low	62.3	Low	134 Å²	134	118.6 Å²	118.6	70%	0.702	64%	0.642	S	S	*	*	H	α-helix	trans	-77.7	-29.2	176.3	-72.5	160.7	0	0	0	112.6	L24 C25 H30 A31	L24-L28 WeakPolarHBondContact O-CD1 3.32Å; L24-L28 WeakPolarHBondContact O-CG 3.35Å; L24-L28 PolarHBondContact O-N 3.24Å; L24-L28 VanDerWaalsContact O-N 3.11Å; C25-L28 PolarHBondContact O-N 2.99Å; L28-H30 VanDerWaalsContact C-N 3.34Å; L28-A31 PolarHBondContact O-N 3.25Å
29	L	58.7	Low	61.8	Low	123 Å²	123	119 Å²	119	64%	0.644	65%	0.65	S	S	*	*	H	α-helix	trans	-73.6	-20.3	176.2	-108.8	72.2	0	0	0	114.1	C25 A31	C25-L29 PolarHBondContact O-N 3.33Å; L29-A31 VanDerWaalsContact C-N 3.33Å
30	H	57.8	Low	61.2	Low	139 Å²	139	118.4 Å²	118.4	64%	0.644	65%	0.653	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.5	1.5	175	-74.4	86.5	0	0	0	113.8	F26 L28 Q32	F26-H30 AromaticContact CD1-CE1 3.92Å; F26-H30 PolarHBondContact O-N 3.35Å; F26-H30 PolarHBondContact O-ND1 3.16Å; L28-H30 VanDerWaalsContact C-N 3.34Å; H30-Q32 PolarHBondContact O-N 2.89Å
31	A	52.7	Low	60.6	Low	81 Å²	81	121.3 Å²	121.3	67%	0.669	67%	0.668	S	S	*	*			trans	-76.2	51.4	163.7	0	0	0	0	0	110	L28 L29 D33	L28-A31 PolarHBondContact O-N 3.25Å; L29-A31 VanDerWaalsContact C-N 3.33Å; A31-D33 PolarHBondContact O-N 2.96Å
32	Q	47.7	Very low	59.8	Low	167 Å²	167	124.3 Å²	124.3	78%	0.78	68%	0.682	S	S	*	*			trans	-75.5	120.5	161.7	-79.5	-178.3	-38.9	0	0	106.7	H30 Y34	H30-Q32 PolarHBondContact O-N 2.89Å; Q32-Y34 PolarHBondContact O-N 2.89Å
33	D	53.7	Low	58.9	Low	139 Å²	139	124 Å²	124	74%	0.743	69%	0.692	S	S	*	*			trans	-32.4	103.7	172.5	-66	-77.9	0	0	0	112.1	A31 T35	A31-D33 PolarHBondContact O-N 2.96Å; D33-T35 HydrophobicContact CB-CG2 4.44Å; D33-T35 PolarHBondContact O-N 2.82Å; D33-T35 PolarHBondContact O-OG1 3.37Å
34	Y	52.8	Low	58.5	Low	213 Å²	213	122.3 Å²	122.3	84%	0.835	69%	0.691	S	S	*	*			trans	-69.3	76.7	154.9	-176.5	-99.9	0	0	0	106.4	Q32 P36	Q32-Y34 PolarHBondContact O-N 2.89Å; Y34-P36 HydrophobicContact CE1-CB 4.29Å; Y34-P36 WeakPolarHBondContact O-CD 3.35Å
35	T	53.7	Low	58.3	Low	109 Å²	109	124.4 Å²	124.4	67%	0.669	70%	0.702	S	S	*	*			trans	-72.6	108.7	164	19	0	0	0	0	105.3	D33 S37	D33-T35 HydrophobicContact CB-CG2 4.44Å; D33-T35 PolarHBondContact O-N 2.82Å; D33-T35 PolarHBondContact O-OG1 3.37Å; T35-S37 PolarHBondContact O-N 2.84Å
36	P	52.7	Low	57.8	Low	92 Å²	92	126.2 Å²	126.2	60%	0.597	71%	0.712	S	S	*	*			trans	-61.5	112.4	173.2	25.1	-31.1	0	0	0	107.3	Y34 Q38	Y34-P36 HydrophobicContact CE1-CB 4.29Å; Y34-P36 WeakPolarHBondContact O-CD 3.35Å; P36-Q38 PolarHBondContact O-N 3.09Å; P36-Q38 VanDerWaalsContact O-N 3.11Å
37	S	51.7	Low	57.7	Low	110 Å²	110	126 Å²	126	77%	0.769	73%	0.727	S	S	*	*			trans	-47.8	117.6	174.7	-174.9	0	0	0	0	109.1	T35 T39	T35-S37 PolarHBondContact O-N 2.84Å; S37-T39 PolarHBondContact O-N 3.27Å; S37-T39 VanDerWaalsContact O-N 3.09Å
38	Q	43.8	Very low	57.5	Low	184 Å²	184	127.1 Å²	127.1	86%	0.86	73%	0.725	S	S	*	*			trans	-64.9	108.4	171.1	-66.5	-175.4	7.5	0	0	107.9	P36	P36-Q38 PolarHBondContact O-N 3.09Å; P36-Q38 VanDerWaalsContact O-N 3.11Å
39	T	56.2	Low	57.5	Low	123 Å²	123	129.4 Å²	129.4	76%	0.755	73%	0.729	S	S	*	*	P	Polyproline II helix	trans	-54.2	129.7	161.9	-54.1	0	0	0	0	108.2	S37	S37-T39 PolarHBondContact O-N 3.27Å; S37-T39 VanDerWaalsContact O-N 3.09Å
40	P	60.4	Low	57.6	Low	106 Å²	106	128.8 Å²	128.8	69%	0.688	73%	0.733	S	S	*	*	P	Polyproline II helix	trans	-57.5	138	176.5	23	-32.3	0	0	0	109.8
41	P	60.6	Low	57.7	Low	111 Å²	111	130 Å²	130	72%	0.721	73%	0.732	S	S	*	*	P	Polyproline II helix	trans	-62.3	136.8	179.9	25	-33	0	0	0	110	T43	P41-T43 PolarHBondContact O-N 3.26Å
42	P	58.8	Low	57.9	Low	117 Å²	117	129.2 Å²	129.2	76%	0.76	73%	0.731	S	S	*	*			trans	-64.2	110.4	166.6	25.3	-30.3	0	0	0	108.6	S44	P42-S44 VanDerWaalsContact C-N 3.33Å; P42-S44 PolarHBondContact O-N 3.06Å
43	T	58.1	Low	58.4	Low	134 Å²	134	131.9 Å²	131.9	82%	0.822	73%	0.734	S	S	*	*			trans	-61.2	92.9	167.8	14.2	0	0	0	0	108.8	P41	P41-T43 PolarHBondContact O-N 3.26Å
44	S	67.6	Low	58.5	Low	88 Å²	88	130 Å²	130	62%	0.615	73%	0.728	S	S	*	*			trans	-113.8	94.5	162.5	51.2	0	0	0	0	107.5	P42 T46	P42-S44 VanDerWaalsContact C-N 3.33Å; P42-S44 PolarHBondContact O-N 3.06Å; S44-T46 VanDerWaalsContact C-N 3.26Å; S44-T46 PolarHBondContact O-N 3.37Å
45	N	69.1	Low	58.8	Low	159 Å²	159	126.1 Å²	126.1	85%	0.85	72%	0.717	S	S	*	*			trans	-65.4	92.1	167.9	-69.6	-13.9	0	0	0	107.7
46	T	61.2	Low	59.1	Low	105 Å²	105	128.7 Å²	128.7	64%	0.644	72%	0.719	S	S	*	*			trans	-145.2	118.4	166	-55.6	0	0	0	0	106.7	S44 L48	S44-T46 VanDerWaalsContact C-N 3.26Å; S44-T46 PolarHBondContact O-N 3.37Å; T46-L48 WeakPolarHBondContact O-CG 3.4Å; T46-L48 PolarHBondContact O-N 2.88Å
47	S	66.8	Low	59.9	Low	126 Å²	126	131.2 Å²	131.2	88%	0.881	72%	0.723	S	S	*	*			trans	-40	100.3	177.4	-174.4	0	0	0	0	111.7	K49	S47-K49 PolarHBondContact O-N 2.88Å
48	L	61.1	Low	61.5	Low	109 Å²	109	132.8 Å²	132.8	57%	0.571	72%	0.722	S	S	*	*			trans	-83.2	99.6	179	-67.4	178.2	0	0	0	108.4	T46 R51	T46-L48 WeakPolarHBondContact O-CG 3.4Å; T46-L48 PolarHBondContact O-N 2.88Å; L48-R51 VanDerWaalsContact CD1-NH2 3.35Å; L48-R51 VanDerWaalsContact CD2-CZ 3.42Å; L48-R51 VanDerWaalsContact CD2-NH2 3.31Å
49	K	63.1	Low	63.8	Low	182 Å²	182	127.8 Å²	127.8	79%	0.791	71%	0.706	S	S	*	*			trans	-45.5	135.2	150.6	-172.9	177	-175.4	-178.2	0	107.9	S47 R51	S47-K49 PolarHBondContact O-N 2.88Å; K49-R51 PolarHBondContact O-N 3.38Å
50	P	60.3	Low	65.5	Low	111 Å²	111	124.8 Å²	124.8	72%	0.721	70%	0.699	S	S	*	*			trans	-59.9	107.6	-174.2	-20	30.4	0	0	0	109.9	G52	P50-G52 PolarHBondContact O-N 2.76Å
51	R	60.1	Low	67	Low	165 Å²	165	125.6 Å²	125.6	62%	0.623	69%	0.692	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64	0.9	178.2	-75.4	-170.7	-82.5	-144	-1.3	113.5	L48 K49 R53	L48-R51 VanDerWaalsContact CD1-NH2 3.35Å; L48-R51 VanDerWaalsContact CD2-CZ 3.42Å; L48-R51 VanDerWaalsContact CD2-NH2 3.31Å; K49-R51 PolarHBondContact O-N 3.38Å; R51-R53 PolarHBondContact O-N 3.29Å
52	G	56.6	Low	68.4	Low	64 Å²	64	122.6 Å²	122.6	66%	0.66	67%	0.672	S	S	*	*	H	α-helix	trans	-69.4	-25.7	-177.7	0	0	0	0	0	114.9	P50	P50-G52 PolarHBondContact O-N 2.76Å
53	R	57.7	Low	69.9	Low	222 Å²	222	125.5 Å²	125.5	84%	0.838	67%	0.673	S	S	*	*	H	α-helix	trans	-86	-27.1	-177.3	-164.1	177.7	-71.7	-161	-0.3	113.9	R51	R51-R53 PolarHBondContact O-N 3.29Å
54	V	57.2	Low	71.4	Confident	101 Å²	101	121.7 Å²	121.7	61%	0.612	65%	0.645	S	S	*	*	H	α-helix	trans	-83.5	-30.4	-174.8	-177.5	0	0	0	0	112.4
55	Q	58.7	Low	72.5	Confident	130 Å²	130	126.1 Å²	126.1	61%	0.607	66%	0.655	S	S	*	*	H	α-helix	trans	-71.1	-33.4	-175.7	-72.7	-88.2	-15.3	0	0	113.5	E57 L58	Q55-E57 PolarHBondContact O-N 2.86Å; Q55-L58 PolarHBondContact O-N 2.68Å
56	K	59.1	Low	73.6	Confident	163 Å²	163	121.7 Å²	121.7	71%	0.709	65%	0.648	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.4	-18.2	-176.4	-164.8	176.4	-178.2	179.5	0	113.9	K61	K56-K61 WeakPolarHBondContact O-CE 3.32Å
57	E	69.7	Low	75.1	Confident	146 Å²	146	124.3 Å²	124.3	68%	0.682	65%	0.65	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.3	-23.4	179.8	-69.5	-81.1	133	0	0	112.5	Q55	Q55-E57 PolarHBondContact O-N 2.86Å
58	L	85.8	Confident	76.2	Confident	142 Å²	142	123.3 Å²	123.3	74%	0.743	63%	0.634	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.3	-27.9	-164.9	-66	170.2	0	0	0	115.1	Q55	Q55-L58 PolarHBondContact O-N 2.68Å
59	C	91.6	Very high	77.8	Confident	80 Å²	80	126.6 Å²	126.6	54%	0.541	64%	0.64	S	S	.	*	S	Bend	trans	-118.9	163.4	-174	68.7	0	0	0	0	113	K61	C59-K61 PolarHBondContact O-N 3.11Å; C59-K61 VanDerWaalsContact O-N 3.16Å
60	G	91.5	Very high	79.3	Confident	59 Å²	59	122.1 Å²	122.1	61%	0.608	65%	0.645	S	S	*	*	S	Bend	trans	66.7	15.3	173.5	0	0	0	0	0	115.9	W81	G60-W81 VanDerWaalsContact C-CZ3 3.45Å
61	K	91.6	Very high	80.9	Confident	124 Å²	124	119.7 Å²	119.7	54%	0.539	64%	0.641	S	S	.	*			trans	-91.1	118.6	178.2	-58.3	-61.3	-174.7	173.3	0	111.5	K56 C59 W81	K56-K61 WeakPolarHBondContact O-CE 3.32Å; C59-K61 PolarHBondContact O-N 3.11Å; C59-K61 VanDerWaalsContact O-N 3.16Å; K61-W81 WeakPolarHBondContact O-CZ3 2.96Å
62	T	91.6	Very high	82.4	Confident	47 Å²	47	120 Å²	120	29%	0.288	65%	0.649	S	S	.	*			trans	-116	150.2	170.7	175	0	0	0	0	110.1	F64 R78 W79 W81	T62-F64 HydrophobicContact CG2-CB 4.07Å; T62-F64 PolarHBondContact O-N 2.93Å; T62-F64 WeakPolarHBondContact OG1-CB 3.34Å; T62-F64 PolarHBondContact OG1-N 3.29Å; T62-R78 WeakPolarHBondContact CB-O 3.34Å; T62-R78 PolarHBondContact OG1-O 3.29Å; T62-W79 HydrophobicContact CG2-CE3 4.48Å; T62-W79 HydrophobicContact CG2-CZ3 3.93Å; T62-W81 HydrophobicContact CG2-CH2 4.15Å
63	K	89.1	Confident	84.2	Confident	179 Å²	179	124.6 Å²	124.6	78%	0.778	66%	0.657	S	S	*	*	S	Bend	trans	-75.2	-6.3	168.4	-63.1	177.5	-177.8	169.4	0	112.2
64	F	91	Very high	85.9	Confident	54 Å²	54	116.3 Å²	116.3	24%	0.237	64%	0.636	C	S	.	*			trans	-76.6	136.3	176.4	-172.9	-113.7	0	0	0	111.5	T62 G66 I68 R78 W79	T62-F64 HydrophobicContact CG2-CB 4.07Å; T62-F64 PolarHBondContact O-N 2.93Å; T62-F64 WeakPolarHBondContact OG1-CB 3.34Å; T62-F64 PolarHBondContact OG1-N 3.29Å; F64-G66 WeakPolarHBondContact CE1-O 3.38Å; F64-I68 HydrophobicContact CE1-CD1 4.39Å; F64-I68 HydrophobicContact CE1-CG1 3.69Å; F64-I68 HydrophobicContact CZ-CG1 3.86Å; F64-R78 HydrophobicContact CB-CG 4.25Å; F64-R78 VanDerWaalsContact CD2-NH1 3.25Å; F64-W79 HydrophobicContact CB-CH2 4.14Å; F64-W79 HydrophobicContact CB-CZ2 4.31Å; F64-W79 AromaticContact CD1-CH2 3.67Å; F64-W79 HydrophobicContact CD1-CH2 3.67Å; F64-W79 AromaticContact CD1-CZ2 3.96Å; F64-W79 HydrophobicContact CD1-CZ2 3.96Å; F64-W79 HydrophobicContact CE1-CH2 4.45Å; F64-W79 HydrophobicContact CG-CH2 4.14Å; F64-W79 HydrophobicContact CG-CZ2 4.16Å
65	Q	90.4	Very high	87.6	Confident	180 Å²	180	119 Å²	119	84%	0.841	64%	0.639	S	S	*	*			trans	-126.1	138.9	171.9	-63.9	-179.2	-8.7	0	0	108.7
66	G	90.9	Very high	89.1	Confident	67 Å²	67	117.3 Å²	117.3	69%	0.691	65%	0.648	S	S	*	*	S	Bend	trans	106.3	-165.5	178	0	0	0	0	0	114.6	F64	F64-G66 WeakPolarHBondContact CE1-O 3.38Å
67	K	92.4	Very high	90.5	Very high	159 Å²	159	116.8 Å²	116.8	69%	0.691	65%	0.648	S	S	*	*			trans	-108.2	150.4	-179.5	-67.5	177.2	-179.7	178.7	0	110.1	Y69	K67-Y69 HydrophobicContact CB-CD2 4.32Å; K67-Y69 HydrophobicContact CB-CE2 3.53Å; K67-Y69 HydrophobicContact CD-CE2 4.49Å; K67-Y69 WeakPolarHBondContact CD-OH 3.45Å
68	I	90.8	Very high	91.7	Very high	105 Å²	105	112.5 Å²	112.5	54%	0.538	63%	0.625	S	S	.	*			trans	-96	127.1	178.1	-54.7	173.1	0	0	0	108.5	F64 W79	F64-I68 HydrophobicContact CE1-CD1 4.39Å; F64-I68 HydrophobicContact CE1-CG1 3.69Å; F64-I68 HydrophobicContact CZ-CG1 3.86Å; I68-W79 HydrophobicContact CD1-CH2 4.15Å; I68-W79 HydrophobicContact CD1-CZ2 3.69Å
69	Y	95.1	Very high	92.1	Very high	179 Å²	179	109.9 Å²	109.9	70%	0.702	61%	0.606	S	S	*	*			trans	-129.7	136.9	173.1	-58.6	-81.2	0	0	0	108.4	K67 G71	K67-Y69 HydrophobicContact CB-CD2 4.32Å; K67-Y69 HydrophobicContact CB-CE2 3.53Å; K67-Y69 HydrophobicContact CD-CE2 4.49Å; K67-Y69 WeakPolarHBondContact CD-OH 3.45Å; Y69-G71 PolarHBondContact O-N 2.04Å
70	G	95.1	Very high	92.2	Very high	87 Å²	87	109.7 Å²	109.7	90%	0.897	60%	0.603	S	S	*	*	S	Bend	trans	51.4	49.4	174.9	0	0	0	0	0	114.2
71	G	92.5	Very high	92.4	Very high	61 Å²	61	109.9 Å²	109.9	63%	0.629	59%	0.586	S	S	*	*			trans	-43.8	156.1	-160.3	0	0	0	0	0	118	Y69	Y69-G71 PolarHBondContact O-N 2.04Å
72	Q	92	Very high	92.7	Very high	172 Å²	172	110 Å²	110	80%	0.804	59%	0.588	S	S	*	*			trans	-128.9	169.2	-178.6	60.9	179.7	86.6	0	0	110.9	A74	Q72-A74 PolarHBondContact O-N 3.16Å
73	I	94.1	Very high	92.9	Very high	160 Å²	160	108.9 Å²	108.9	82%	0.821	58%	0.584	S	S	*	*	P	Polyproline II helix	trans	-57.3	126.7	172.7	-63.2	173.8	0	0	0	109.4
74	A	93.5	Very high	93.3	Very high	48 Å²	48	103.2 Å²	103.2	40%	0.397	57%	0.567	S	S	.	*	P	Polyproline II helix	trans	-73	141.7	177.4	0	0	0	0	0	110.6	Q72 R78	Q72-A74 PolarHBondContact O-N 3.16Å; A74-R78 HydrophobicContact CB-CB 4.21Å
75	K	92.6	Very high	93.6	Very high	156 Å²	156	102 Å²	102	68%	0.678	56%	0.562	S	S	*	*	P	Polyproline II helix	trans	-62	151.6	166.5	-68.2	-177	179.7	-177.4	0	109.3	E77 R78	K75-E77 PolarHBondContact O-N 2.99Å; K75-R78 VanDerWaalsContact O-CB 3.23Å; K75-R78 WeakPolarHBondContact O-CB 3.27Å; K75-R78 PolarHBondContact O-N 3.15Å; K75-R78 VanDerWaalsContact O-N 3.14Å
76	A	90.8	Very high	93.9	Very high	96 Å²	96	98.8 Å²	98.8	79%	0.793	55%	0.55	S	S	*	*	T	Hydrogen-bonded Turn	trans	-49.2	141.6	171.9	0	0	0	0	0	110.7	R78	A76-R78 PolarHBondContact O-N 3.03Å
77	E	88.7	Confident	94.1	Very high	151 Å²	151	99.9 Å²	99.9	71%	0.706	54%	0.536	S	S	*	.	T	Hydrogen-bonded Turn	trans	60.5	8.2	-179.8	-49.3	-175.7	142.9	0	0	116.2	K75 W79 P80	K75-E77 PolarHBondContact O-N 2.99Å; E77-W79 PolarHBondContact O-N 2.77Å; E77-P80 WeakPolarHBondContact O-CD 3.2Å; E77-P80 WeakPolarHBondContact O-CG 3.46Å
78	R	93.7	Very high	94.2	Very high	56 Å²	56	102.4 Å²	102.4	21%	0.211	54%	0.541	C	S	.	.	S	Bend	trans	-60	-36.2	175.1	-170	78	72.7	84	2.6	111.5	T62 F64 A74 K75 A76	T62-R78 WeakPolarHBondContact CB-O 3.34Å; T62-R78 PolarHBondContact OG1-O 3.29Å; F64-R78 HydrophobicContact CB-CG 4.25Å; F64-R78 VanDerWaalsContact CD2-NH1 3.25Å; A74-R78 HydrophobicContact CB-CB 4.21Å; K75-R78 VanDerWaalsContact O-CB 3.23Å; K75-R78 WeakPolarHBondContact O-CB 3.27Å; K75-R78 PolarHBondContact O-N 3.15Å; K75-R78 VanDerWaalsContact O-N 3.14Å; A76-R78 PolarHBondContact O-N 3.03Å
79	W	94.6	Very high	94.5	Very high	87 Å²	87	100.9 Å²	100.9	33%	0.33	55%	0.551	S	S	.	*	S	Bend	trans	-124.9	80.1	179.9	-53.5	109.7	0	0	0	108.1	T62 F64 I68 E77 W81 Q82	T62-W79 HydrophobicContact CG2-CE3 4.48Å; T62-W79 HydrophobicContact CG2-CZ3 3.93Å; F64-W79 HydrophobicContact CB-CH2 4.14Å; F64-W79 HydrophobicContact CB-CZ2 4.31Å; F64-W79 AromaticContact CD1-CH2 3.67Å; F64-W79 HydrophobicContact CD1-CH2 3.67Å; F64-W79 AromaticContact CD1-CZ2 3.96Å; F64-W79 HydrophobicContact CD1-CZ2 3.96Å; F64-W79 HydrophobicContact CE1-CH2 4.45Å; F64-W79 HydrophobicContact CG-CH2 4.14Å; F64-W79 HydrophobicContact CG-CZ2 4.16Å; I68-W79 HydrophobicContact CD1-CH2 4.15Å; I68-W79 HydrophobicContact CD1-CZ2 3.69Å; E77-W79 PolarHBondContact O-N 2.77Å; W79-W81 HydrophobicContact CE3-CH2 4.21Å; W79-W81 AromaticContact CE3-CZ2 3.57Å; W79-W81 HydrophobicContact CE3-CZ2 3.57Å; W79-W81 HydrophobicContact CZ3-CZ2 4.04Å; W79-W81 PolarHBondContact O-N 3.46Å; W79-Q82 HydrophobicContact CB-CB 4.11Å; W79-Q82 WeakPolarHBondContact O-CB 3.44Å; W79-Q82 PolarHBondContact O-N 3.03Å
80	P	93.9	Very high	94.6	Very high	76 Å²	76	101.5 Å²	101.5	49%	0.494	55%	0.553	S	S	.	*	T	Hydrogen-bonded Turn	trans	-60	-23.6	-168.8	-25.2	33.8	0	0	0	114.5	E77	E77-P80 WeakPolarHBondContact O-CD 3.2Å; E77-P80 WeakPolarHBondContact O-CG 3.46Å
81	W	96	Very high	94.6	Very high	64 Å²	64	103.1 Å²	103.1	24%	0.242	54%	0.537	C	S	.	.	T	Hydrogen-bonded Turn	trans	-85.2	-8.1	178.7	51.2	80.9	0	0	0	114	G60 K61 T62 W79 A83 V96 L97	G60-W81 VanDerWaalsContact C-CZ3 3.45Å; K61-W81 WeakPolarHBondContact O-CZ3 2.96Å; T62-W81 HydrophobicContact CG2-CH2 4.15Å; W79-W81 HydrophobicContact CE3-CH2 4.21Å; W79-W81 AromaticContact CE3-CZ2 3.57Å; W79-W81 HydrophobicContact CE3-CZ2 3.57Å; W79-W81 HydrophobicContact CZ3-CZ2 4.04Å; W79-W81 PolarHBondContact O-N 3.46Å; W81-A83 PolarHBondContact O-N 2.94Å; W81-V96 HydrophobicContact CB-CG1 4.03Å; W81-V96 HydrophobicContact CG-CG1 4.21Å; W81-V96 CarbonylContact O-C 3.48Å; W81-V96 VanDerWaalsContact O-CA 3.32Å; W81-V96 WeakPolarHBondContact O-CA 3.21Å; W81-L97 HydrophobicContact CB-CB 4.2Å; W81-L97 PolarHBondContact O-N 3.33Å
82	Q	97.1	Very high	94.8	Very high	126 Å²	126	104.1 Å²	104.1	59%	0.589	53%	0.526	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-71.7	122.9	-178.8	-176.8	67.6	3.9	0	0	110.6	W79	W79-Q82 HydrophobicContact CB-CB 4.11Å; W79-Q82 WeakPolarHBondContact O-CB 3.44Å; W79-Q82 PolarHBondContact O-N 3.03Å
83	A	97.1	Very high	95.1	Very high	24 Å²	24	96.9 Å²	96.9	20%	0.198	50%	0.495	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.9	155.4	178.8	0	0	0	0	0	112	W81 A95 L103	W81-A83 PolarHBondContact O-N 2.94Å; A83-A95 HydrophobicContact CB-CB 4.08Å; A83-A95 PolarHBondContact N-O 3.06Å; A83-A95 PolarHBondContact O-N 3.32Å; A83-L103 HydrophobicContact CB-CD1 4.39Å; A83-L103 HydrophobicContact CB-CD2 3.59Å
84	S	96.8	Very high	95.3	Very high	59 Å²	59	91 Å²	91	41%	0.413	47%	0.473	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.1	122.8	176.1	175.5	0	0	0	0	109.1	H91	S84-H91 PolarHBondContact OG-ND1 3.11Å
85	L	97.1	Very high	95.5	Very high	28 Å²	28	88.8 Å²	88.8	15%	0.147	46%	0.455	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.3	122.5	167.9	-62.4	-176.3	0	0	0	108.6	H91 I92 C93 A95 S105 C109 F110	L85-H91 WeakPolarHBondContact O-CA 3.16Å; L85-I92 HydrophobicContact CB-CD1 4.41Å; L85-I92 HydrophobicContact CB-CG1 3.94Å; L85-I92 WeakPolarHBondContact O-CG1 3.5Å; L85-I92 PolarHBondContact O-N 2.9Å; L85-C93 HydrophobicContact CB-CB 4.24Å; L85-C93 WeakPolarHBondContact CB-O 2.99Å; L85-C93 HydrophobicContact CD1-CB 3.95Å; L85-C93 HydrophobicContact CG-CB 4.44Å; L85-C93 PolarHBondContact N-O 3.46Å; L85-A95 HydrophobicContact CD1-CB 4.42Å; L85-A95 HydrophobicContact CD2-CB 3.89Å; L85-A95 HydrophobicContact CG-CB 3.93Å; L85-S105 WeakPolarHBondContact CD1-OG 3.22Å; L85-C109 HydrophobicContact CD1-CB 4.32Å; L85-F110 HydrophobicContact CD1-CE1 4.08Å; L85-F110 HydrophobicContact CD1-CE2 4.47Å; L85-F110 HydrophobicContact CD1-CZ 3.69Å
86	I	96.8	Very high	95.8	Very high	114 Å²	114	84.1 Å²	84.1	59%	0.585	44%	0.44	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-116.8	123.6	-177.9	-60.3	176.8	0	0	0	108.6	R90	I86-R90 CarbonylContact C-O 3.56Å; I86-R90 VanDerWaalsContact CA-O 3.27Å; I86-R90 WeakPolarHBondContact CA-O 3.46Å
87	F	94.7	Very high	96.1	Very high	90 Å²	90	83.6 Å²	83.6	40%	0.395	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.1	127.6	174.1	-178	-101.7	0	0	0	109.4	G89 R90 I92	F87-G89 PolarHBondContact O-N 3.41Å; F87-R90 PolarHBondContact N-O 2.92Å; F87-R90 PolarHBondContact O-N 3.43Å; F87-I92 HydrophobicContact CB-CD1 3.7Å; F87-I92 HydrophobicContact CB-CG1 4.13Å; F87-I92 HydrophobicContact CB-CG2 3.89Å
88	R	95.6	Very high	96.4	Very high	211 Å²	211	81.2 Å²	81.2	80%	0.796	41%	0.414	S	S	*	.	T	Hydrogen-bonded Turn	trans	49.9	44.4	-175.2	-64	-179.9	173.7	-179.4	-4	112.8	R90	R88-R90 PolarHBondContact O-N 2.82Å
89	G	97.1	Very high	96.4	Very high	73 Å²	73	83 Å²	83	75%	0.753	43%	0.428	S	S	*	.	T	Hydrogen-bonded Turn	trans	74.2	3.8	178.6	0	0	0	0	0	115.5	F87	F87-G89 PolarHBondContact O-N 3.41Å
90	R	96.4	Very high	96.3	Very high	193 Å²	193	87.9 Å²	87.9	73%	0.728	45%	0.451	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-115.2	138.3	179.5	-62.6	-176.8	67.3	-178.8	-0.2	111.5	I86 F87 R88 I92	I86-R90 CarbonylContact C-O 3.56Å; I86-R90 VanDerWaalsContact CA-O 3.27Å; I86-R90 WeakPolarHBondContact CA-O 3.46Å; F87-R90 PolarHBondContact N-O 2.92Å; F87-R90 PolarHBondContact O-N 3.43Å; R88-R90 PolarHBondContact O-N 2.82Å; R90-I92 PolarHBondContact O-N 3.22Å
91	H	96.6	Very high	96.4	Very high	121 Å²	121	89.9 Å²	89.9	56%	0.56	46%	0.462	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-58.7	128.2	166.4	179.5	108	0	0	0	109.2	S84 L85 C93	S84-H91 PolarHBondContact OG-ND1 3.11Å; L85-H91 WeakPolarHBondContact O-CA 3.16Å; H91-C93 PolarHBondContact CE1-O 2.79Å; H91-C93 VanDerWaalsContact CE1-O 3.29Å; H91-C93 PolarHBondContact NE2-O 3.4Å
92	I	96.4	Very high	96.4	Very high	81 Å²	81	94.7 Å²	94.7	42%	0.415	48%	0.481	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.8	-30.9	177.8	56	160	0	0	0	113.2	L85 F87 R90	L85-I92 HydrophobicContact CB-CD1 4.41Å; L85-I92 HydrophobicContact CB-CG1 3.94Å; L85-I92 WeakPolarHBondContact O-CG1 3.5Å; L85-I92 PolarHBondContact O-N 2.9Å; F87-I92 HydrophobicContact CB-CD1 3.7Å; F87-I92 HydrophobicContact CB-CG1 4.13Å; F87-I92 HydrophobicContact CB-CG2 3.89Å; R90-I92 PolarHBondContact O-N 3.22Å
93	C	97.9	Very high	96.5	Very high	21 Å²	21	92.9 Å²	92.9	14%	0.142	47%	0.474	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-160.5	163.8	-177.1	-90.4	0	0	0	0	111.4	L85 H91 C109	L85-C93 HydrophobicContact CB-CB 4.24Å; L85-C93 WeakPolarHBondContact CB-O 2.99Å; L85-C93 HydrophobicContact CD1-CB 3.95Å; L85-C93 HydrophobicContact CG-CB 4.44Å; L85-C93 PolarHBondContact N-O 3.46Å; H91-C93 PolarHBondContact CE1-O 2.79Å; H91-C93 VanDerWaalsContact CE1-O 3.29Å; H91-C93 PolarHBondContact NE2-O 3.4Å; C93-C109 HydrophobicContact CB-CB 3.66Å; C93-C109 WeakPolarHBondContact CB-SG 3.33Å; C93-C109 WeakPolarHBondContact SG-CB 3.35Å; C93-C109 CovalentContact SG-SG 2.04Å; C93-C109 PolarHBondContact SG-SG 3.47Å
94	G	97.8	Very high	96.5	Very high	35 Å²	35	96.7 Å²	96.7	36%	0.361	49%	0.491	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.8	159.9	165.3	0	0	0	0	0	113	S105	G94-S105 PolarHBondContact O-OG 3.38Å
95	A	98.3	Very high	96.5	Very high	3 Å²	3	95.6 Å²	95.6	3%	0.025	48%	0.483	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.2	164.9	169.3	0	0	0	0	0	111	A83 L85 L103 L104	A83-A95 HydrophobicContact CB-CB 4.08Å; A83-A95 PolarHBondContact N-O 3.06Å; A83-A95 PolarHBondContact O-N 3.32Å; L85-A95 HydrophobicContact CD1-CB 4.42Å; L85-A95 HydrophobicContact CD2-CB 3.89Å; L85-A95 HydrophobicContact CG-CB 3.93Å; A95-L103 HydrophobicContact CB-CB 4.37Å; A95-L103 HydrophobicContact CB-CD2 4.31Å; A95-L104 CarbonylContact C-O 3.57Å; A95-L104 WeakPolarHBondContact CA-O 3.45Å; A95-L104 WeakPolarHBondContact CB-O 3.48Å
96	V	98	Very high	96.5	Very high	58 Å²	58	96.1 Å²	96.1	35%	0.352	49%	0.492	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.5	128.3	-179.9	-179.8	0	0	0	0	110.3	W81 I98 L103 L104	W81-V96 HydrophobicContact CB-CG1 4.03Å; W81-V96 HydrophobicContact CG-CG1 4.21Å; W81-V96 CarbonylContact O-C 3.48Å; W81-V96 VanDerWaalsContact O-CA 3.32Å; W81-V96 WeakPolarHBondContact O-CA 3.21Å; V96-I98 HydrophobicContact CG1-CG2 4.47Å; V96-I98 PolarHBondContact O-N 3.37Å; V96-L103 CarbonylContact O-C 3.54Å; V96-L103 WeakPolarHBondContact O-CA 3.3Å; V96-L104 PolarHBondContact N-O 2.88Å; V96-L104 PolarHBondContact O-N 3.38Å
97	L	96.6	Very high	96.4	Very high	85 Å²	85	93.7 Å²	93.7	45%	0.445	49%	0.489	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.2	117.2	172.9	-168.3	72.6	0	0	0	110.2	W81 D99 L103	W81-L97 HydrophobicContact CB-CB 4.2Å; W81-L97 PolarHBondContact O-N 3.33Å; L97-D99 WeakPolarHBondContact CD1-O 3.39Å; L97-D99 WeakPolarHBondContact CG-O 3.43Å; L97-L103 HydrophobicContact CB-CD2 4.06Å; L97-L103 HydrophobicContact CD1-CD2 3.98Å; L97-L103 HydrophobicContact CD1-CG 4.39Å
98	I	95.8	Very high	96.4	Very high	100 Å²	100	96 Å²	96	51%	0.513	50%	0.5	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.7	-20.8	-179.1	58.7	164.7	0	0	0	112.6	V96 W102 L104	V96-I98 HydrophobicContact CG1-CG2 4.47Å; V96-I98 PolarHBondContact O-N 3.37Å; I98-W102 HydrophobicContact CD1-CB 4.19Å; I98-W102 HydrophobicContact CG1-CB 3.85Å; I98-W102 WeakPolarHBondContact CG1-O 3.23Å; I98-W102 PolarHBondContact N-O 3.48Å; I98-L104 HydrophobicContact CD1-CB 4.26Å; I98-L104 HydrophobicContact CG2-CB 3.85Å; I98-L104 HydrophobicContact CG2-CD2 4.43Å
99	D	94	Very high	96.4	Very high	93 Å²	93	87 Å²	87	50%	0.497	47%	0.469	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-154	174.1	172.5	-157	-15.9	0	0	0	109.6	L97 T101 W102	L97-D99 WeakPolarHBondContact CD1-O 3.39Å; L97-D99 WeakPolarHBondContact CG-O 3.43Å; D99-T101 PolarHBondContact O-N 2.95Å; D99-W102 HydrophobicContact CB-CB 4.04Å; D99-W102 PolarHBondContact N-O 3.03Å; D99-W102 PolarHBondContact O-N 3.05Å
100	K	92.6	Very high	96	Very high	191 Å²	191	90.1 Å²	90.1	83%	0.83	46%	0.462	S	S	*	.	T	Hydrogen-bonded Turn	trans	-50.3	-31.3	-178.4	-64.6	179.7	-179.1	-179.7	0	114.1
101	T	95.9	Very high	95.6	Very high	118 Å²	118	87.6 Å²	87.6	72%	0.724	46%	0.459	S	S	*	.	T	Hydrogen-bonded Turn	trans	-131.1	12.3	-176.1	61.1	0	0	0	0	112.9	D99	D99-T101 PolarHBondContact O-N 2.95Å
102	W	96.6	Very high	94.2	Very high	165 Å²	165	90.9 Å²	90.9	63%	0.625	47%	0.466	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-127.2	127.2	-174.8	-69.2	102.4	0	0	0	111.9	I98 D99	I98-W102 HydrophobicContact CD1-CB 4.19Å; I98-W102 HydrophobicContact CG1-CB 3.85Å; I98-W102 WeakPolarHBondContact CG1-O 3.23Å; I98-W102 PolarHBondContact N-O 3.48Å; D99-W102 HydrophobicContact CB-CB 4.04Å; D99-W102 PolarHBondContact N-O 3.03Å; D99-W102 PolarHBondContact O-N 3.05Å
103	L	97.8	Very high	92.5	Very high	87 Å²	87	92.9 Å²	92.9	46%	0.455	49%	0.488	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.2	141.3	171.8	-73.9	168.5	0	0	0	109.6	A83 A95 V96 L97	A83-L103 HydrophobicContact CB-CD1 4.39Å; A83-L103 HydrophobicContact CB-CD2 3.59Å; A95-L103 HydrophobicContact CB-CB 4.37Å; A95-L103 HydrophobicContact CB-CD2 4.31Å; V96-L103 CarbonylContact O-C 3.54Å; V96-L103 WeakPolarHBondContact O-CA 3.3Å; L97-L103 HydrophobicContact CB-CD2 4.06Å; L97-L103 HydrophobicContact CD1-CD2 3.98Å; L97-L103 HydrophobicContact CD1-CG 4.39Å
104	L	97.4	Very high	90.4	Very high	105 Å²	105	100.9 Å²	100.9	55%	0.55	54%	0.544	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.9	137.9	171.1	-176.8	63.7	0	0	0	110.1	A95 V96 I98	A95-L104 CarbonylContact C-O 3.57Å; A95-L104 WeakPolarHBondContact CA-O 3.45Å; A95-L104 WeakPolarHBondContact CB-O 3.48Å; V96-L104 PolarHBondContact N-O 2.88Å; V96-L104 PolarHBondContact O-N 3.38Å; I98-L104 HydrophobicContact CD1-CB 4.26Å; I98-L104 HydrophobicContact CG2-CB 3.85Å; I98-L104 HydrophobicContact CG2-CD2 4.43Å
105	S	97.7	Very high	90.1	Very high	36 Å²	36	104.2 Å²	104.2	25%	0.252	55%	0.553	S	S	.	*			trans	-151.2	177.9	173.5	-169.9	0	0	0	0	110.2	L85 G94	L85-S105 WeakPolarHBondContact CD1-OG 3.22Å; G94-S105 PolarHBondContact O-OG 3.38Å
106	A	96.3	Very high	89.7	Confident	39 Å²	39	109.5 Å²	109.5	32%	0.322	58%	0.581	S	S	.	*			trans	-78.3	143.3	178.5	0	0	0	0	0	111.6	H108 C109	A106-H108 VanDerWaalsContact C-N 3.29Å; A106-H108 VanDerWaalsContact CB-CE1 3.46Å; A106-H108 WeakPolarHBondContact CB-CE1 3.45Å; A106-H108 PolarHBondContact O-N 3.3Å; A106-C109 VanDerWaalsContact O-CB 3.22Å; A106-C109 WeakPolarHBondContact O-CB 3.33Å; A106-C109 PolarHBondContact O-N 3.05Å
107	A	95.6	Very high	89.2	Confident	63 Å²	63	112.4 Å²	112.4	52%	0.521	59%	0.593	S	S	.	*	G	3₁₀ helix	trans	-58.7	-38.1	-179.8	0	0	0	0	0	113.3	C109 F110 Q111	A107-C109 PolarHBondContact O-N 2.95Å; A107-C109 VanDerWaalsContact O-N 3.15Å; A107-F110 PolarHBondContact O-N 3Å; A107-Q111 PolarHBondContact O-N 3.29Å; A107-Q111 VanDerWaalsContact O-N 3.16Å
108	H	94.1	Very high	88.7	Confident	139 Å²	139	114 Å²	114	64%	0.644	60%	0.602	S	S	*	*	G	3₁₀ helix	trans	-65.4	-15.4	178.3	70.9	-105.9	0	0	0	113.4	A106 F110	A106-H108 VanDerWaalsContact C-N 3.29Å; A106-H108 VanDerWaalsContact CB-CE1 3.46Å; A106-H108 WeakPolarHBondContact CB-CE1 3.45Å; A106-H108 PolarHBondContact O-N 3.3Å; H108-F110 PolarHBondContact O-N 2.95Å
109	C	94.8	Very high	88.3	Confident	21 Å²	21	114.9 Å²	114.9	14%	0.142	61%	0.608	C	S	.	*	G	3₁₀ helix	trans	-68.5	-18	172.2	-66.3	0	0	0	0	112.5	L85 C93 A106 A107	L85-C109 HydrophobicContact CD1-CB 4.32Å; C93-C109 HydrophobicContact CB-CB 3.66Å; C93-C109 WeakPolarHBondContact CB-SG 3.33Å; C93-C109 WeakPolarHBondContact SG-CB 3.35Å; C93-C109 CovalentContact SG-SG 2.04Å; C93-C109 PolarHBondContact SG-SG 3.47Å; A106-C109 VanDerWaalsContact O-CB 3.22Å; A106-C109 WeakPolarHBondContact O-CB 3.33Å; A106-C109 PolarHBondContact O-N 3.05Å; A107-C109 PolarHBondContact O-N 2.95Å; A107-C109 VanDerWaalsContact O-N 3.15Å
110	F	90.4	Very high	87.9	Confident	139 Å²	139	116.3 Å²	116.3	61%	0.61	62%	0.615	S	S	*	*	T	Hydrogen-bonded Turn	trans	-113.2	-22.9	-178.8	-54.1	-76.3	0	0	0	113	L85 A107 H108	L85-F110 HydrophobicContact CD1-CE1 4.08Å; L85-F110 HydrophobicContact CD1-CE2 4.47Å; L85-F110 HydrophobicContact CD1-CZ 3.69Å; A107-F110 PolarHBondContact O-N 3Å; H108-F110 PolarHBondContact O-N 2.95Å
111	Q	87	Confident	87.6	Confident	139 Å²	139	111 Å²	111	65%	0.65	60%	0.6	S	S	*	*			trans	-87.4	113.5	175.4	-61.8	175.6	21	0	0	109	A107 S113	A107-Q111 PolarHBondContact O-N 3.29Å; A107-Q111 VanDerWaalsContact O-N 3.16Å; Q111-S113 PolarHBondContact O-N 3.46Å
112	R	66.6	Low	87	Confident	191 Å²	191	110.5 Å²	110.5	72%	0.721	59%	0.59	S	S	*	*			trans	-74.6	121	162.1	-72.4	-175.9	169.5	138.1	5.8	107	S114	R112-S114 PolarHBondContact O-N 3.47Å
113	S	61.6	Low	86.2	Confident	123 Å²	123	105.9 Å²	105.9	86%	0.86	59%	0.587	S	S	*	*			trans	-56.7	110.8	164.8	53.4	0	0	0	0	108.1	Q111	Q111-S113 PolarHBondContact O-N 3.46Å
114	S	54.7	Low	85.1	Confident	189 Å²	189	107.6 Å²	107.6	100%	1.322	60%	0.599	S	S	*	*			trans	-70.9	0	166.1	55.9	0	0	0	0	110.4	R112	R112-S114 PolarHBondContact O-N 3.47Å

Retrieved 114 of 114 residues in 23.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).