A0A087WR57_MOUSE Loading...

Death-associated protein

AlphaFold DB , UniProt , Accession A0A087WR57, Species MOUSE (Mus musculus, Mouse), Gene Dap, Length 79 aa.

						>A0A087WR57_MOUSE|A0A087WR57|Dap
MRIVQKHPHTGDGKEERDKDDQEWESTSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHVSPRTQHIQQPRK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.7	Low	65.7	Low	224 Å²	224	149.3 Å²	149.3	100%	1.103	76%	0.764	S	S	*	*				0	125.9	0	-170.6	162.6	69.2	0	0	107.8
2	R	73.9	Confident	64.1	Low	235 Å²	235	147.6 Å²	147.6	89%	0.887	76%	0.758	S	S	*	*			trans	-93.2	119.5	-177.5	51.1	-174.8	152.5	101.3	0.5	109.5
3	I	71.3	Confident	63.1	Low	153 Å²	153	139.8 Å²	139.8	79%	0.785	74%	0.737	S	S	*	*			trans	-107.6	105.4	175.4	-31.9	-179.6	0	0	0	106.5
4	V	76.4	Confident	62.3	Low	96 Å²	96	141.5 Å²	141.5	58%	0.582	74%	0.735	S	S	*	*			trans	-98.5	103.4	171.4	-98.9	0	0	0	0	107.6	K6	V4-K6 PolarHBondContact O-N 3.3Å
5	Q	78.9	Confident	61.7	Low	168 Å²	168	141.9 Å²	141.9	79%	0.785	73%	0.732	S	S	*	*	P	Polyproline II helix	trans	-66	120.4	168.3	-171.7	172.1	17.2	0	0	108.4
6	K	76.4	Confident	61.3	Low	153 Å²	153	142 Å²	142	67%	0.665	73%	0.728	S	S	*	*	P	Polyproline II helix	trans	-101.3	131.5	165.9	-32.1	-63.6	179.3	171.9	0	105.3	V4 P8	V4-K6 PolarHBondContact O-N 3.3Å; K6-P8 WeakPolarHBondContact O-CD 3.15Å
7	H	68.8	Low	60.9	Low	144 Å²	144	143 Å²	143	67%	0.667	72%	0.72	S	S	*	*	P	Polyproline II helix	trans	-66.6	124.8	170.8	-63.4	101	0	0	0	108.2	H9	H7-H9 PolarHBondContact O-N 3.32Å; H7-H9 VanDerWaalsContact O-N 3.15Å
8	P	58.9	Low	60.8	Low	102 Å²	102	141.5 Å²	141.5	66%	0.662	72%	0.715	S	S	*	*			trans	-64.9	112.9	158.1	26.7	-27.4	0	0	0	106.2	K6 T10	K6-P8 WeakPolarHBondContact O-CD 3.15Å; P8-T10 HydrophobicContact CB-CG2 4.37Å; P8-T10 PolarHBondContact O-N 3.37Å
9	H	57.1	Low	60.6	Low	185 Å²	185	142.6 Å²	142.6	86%	0.856	72%	0.715	S	S	*	*			trans	-72.7	71.2	159.7	-67.7	-71.8	0	0	0	107	H7 G11	H7-H9 PolarHBondContact O-N 3.32Å; H7-H9 VanDerWaalsContact O-N 3.15Å; H9-G11 PolarHBondContact O-N 3.16Å
10	T	51.1	Low	60.5	Low	111 Å²	111	139.5 Å²	139.5	68%	0.681	70%	0.7	S	S	*	*			trans	-74.8	117.2	159.7	34.1	0	0	0	0	106.1	P8	P8-T10 HydrophobicContact CB-CG2 4.37Å; P8-T10 PolarHBondContact O-N 3.37Å
11	G	55.6	Low	60.5	Low	71 Å²	71	137.7 Å²	137.7	73%	0.732	69%	0.693	S	S	*	*			trans	-67	135.6	-159.7	0	0	0	0	0	114.5	H9	H9-G11 PolarHBondContact O-N 3.16Å
12	D	45.6	Very low	60.7	Low	129 Å²	129	134.1 Å²	134.1	69%	0.69	67%	0.673	S	S	*	*			trans	-119.6	87.3	157.7	-68.7	-55.9	0	0	0	106.5
13	G	51.4	Low	59.9	Low	47 Å²	47	130.7 Å²	130.7	49%	0.485	67%	0.667	S	S	.	*			trans	-118.7	15.4	177.7	0	0	0	0	0	112.9	R17	G13-R17 PolarHBondContact O-NE 2.83Å; G13-R17 PolarHBondContact O-NH2 3.15Å
14	K	51.7	Low	59.2	Low	163 Å²	163	132.8 Å²	132.8	71%	0.709	67%	0.665	S	S	*	*	S	Bend	trans	-124.1	-37	-174.4	-54.3	-157	-176.8	-176.4	0	112.8
15	E	53.3	Low	58.2	Low	148 Å²	148	135.5 Å²	135.5	69%	0.692	67%	0.672	S	S	*	*	H	α-helix	trans	-75.3	-28.4	-178.4	-57.9	-169.6	173.2	0	0	113.5
16	E	55.9	Low	57.2	Low	143 Å²	143	131.3 Å²	131.3	67%	0.668	66%	0.661	S	S	*	*	H	α-helix	trans	-70.3	-36.6	178.3	-159.1	179.8	-154.1	0	0	111.7	K19 D20	E16-K19 PolarHBondContact O-N 3.08Å; E16-D20 PolarHBondContact O-N 3.38Å
17	R	54.1	Low	56.6	Low	159 Å²	159	131.2 Å²	131.2	60%	0.6	67%	0.674	S	S	*	*	H	α-helix	trans	-64.6	-45.6	-179.1	-88.2	-166.3	-80.9	168.5	-6.5	113.6	G13 K19 D20 D21	G13-R17 PolarHBondContact O-NE 2.83Å; G13-R17 PolarHBondContact O-NH2 3.15Å; R17-K19 PolarHBondContact O-N 2.97Å; R17-D20 PolarHBondContact O-N 2.92Å; R17-D21 VanDerWaalsContact O-CG 3.32Å; R17-D21 PolarHBondContact O-N 3.13Å
18	D	59.3	Low	56.1	Low	116 Å²	116	127.5 Å²	127.5	62%	0.62	66%	0.664	S	S	*	*	H	α-helix	trans	-66.4	-28	-178.1	-70	-17.9	0	0	0	111.8	Q22	D18-Q22 PolarHBondContact O-N 3.23Å
19	K	56.7	Low	56.5	Low	163 Å²	163	127.4 Å²	127.4	71%	0.709	66%	0.663	S	S	*	*	H	α-helix	trans	-75.5	-40.1	-179.8	-136	171	-178.5	172.5	0	112.1	E16 R17 E23	E16-K19 PolarHBondContact O-N 3.08Å; R17-K19 PolarHBondContact O-N 2.97Å; K19-E23 PolarHBondContact O-N 2.85Å
20	D	59.4	Low	57.2	Low	79 Å²	79	124.7 Å²	124.7	42%	0.422	66%	0.662	S	S	.	*	H	α-helix	trans	-66.2	-45.3	172.2	-75.2	-21.9	0	0	0	110.8	E16 R17 Q22 E23 W24	E16-D20 PolarHBondContact O-N 3.38Å; R17-D20 PolarHBondContact O-N 2.92Å; D20-Q22 PolarHBondContact O-N 3.2Å; D20-E23 PolarHBondContact O-N 3.2Å; D20-W24 PolarHBondContact O-N 3.28Å; D20-W24 VanDerWaalsContact O-N 3.11Å
21	D	60.4	Low	58.1	Low	103 Å²	103	126.6 Å²	126.6	55%	0.551	66%	0.661	S	S	*	*	H	α-helix	trans	-57.5	-37.1	-179.5	-75.9	-23.5	0	0	0	112.2	R17 W24	R17-D21 VanDerWaalsContact O-CG 3.32Å; R17-D21 PolarHBondContact O-N 3.13Å; D21-W24 PolarHBondContact O-N 3.4Å
22	Q	57.7	Low	59.3	Low	149 Å²	149	128.4 Å²	128.4	70%	0.696	66%	0.66	S	S	*	*	H	α-helix	trans	-75.9	-25.7	178.5	-166.3	153	34	0	0	113.6	D18 D20	D18-Q22 PolarHBondContact O-N 3.23Å; D20-Q22 PolarHBondContact O-N 3.2Å
23	E	57.3	Low	61	Low	162 Å²	162	126.8 Å²	126.8	76%	0.757	66%	0.655	S	S	*	*	H	α-helix	trans	-77.3	-27.4	173.4	-171.5	170.5	176.8	0	0	112	K19 D20 E25	K19-E23 PolarHBondContact O-N 2.85Å; D20-E23 PolarHBondContact O-N 3.2Å; E23-E25 VanDerWaalsContact C-N 3.34Å
24	W	56.3	Low	62.8	Low	197 Å²	197	128.5 Å²	128.5	75%	0.746	66%	0.655	S	S	*	*	S	Bend	trans	-78.1	-12.1	176.9	-71	112.6	0	0	0	114.6	D20 D21 S26	D20-W24 PolarHBondContact O-N 3.28Å; D20-W24 VanDerWaalsContact O-N 3.11Å; D21-W24 PolarHBondContact O-N 3.4Å; W24-S26 PolarHBondContact O-N 3.5Å
25	E	56	Low	64.6	Low	153 Å²	153	127 Å²	127	72%	0.715	65%	0.649	S	S	*	*			trans	-72.7	69.7	171.6	-74.8	-170.1	153.2	0	0	111	E23 T27	E23-E25 VanDerWaalsContact C-N 3.34Å; E25-T27 PolarHBondContact O-N 3.15Å
26	S	58.6	Low	66.2	Low	80 Å²	80	124.1 Å²	124.1	56%	0.559	64%	0.638	S	S	*	*			trans	-63	121.3	175.6	-168.1	0	0	0	0	110.2	W24 S28	W24-S26 PolarHBondContact O-N 3.5Å; S26-S28 PolarHBondContact O-N 2.87Å
27	T	63.8	Low	67.7	Low	152 Å²	152	123.1 Å²	123.1	93%	0.933	65%	0.646	S	S	*	*			trans	-67	28.1	170.7	39.8	0	0	0	0	113.5	E25	E25-T27 PolarHBondContact O-N 3.15Å
28	S	58.5	Low	69.5	Low	65 Å²	65	118.8 Å²	118.8	46%	0.455	65%	0.651	S	S	.	*			trans	-68.2	148.4	-176.7	-166.9	0	0	0	0	111.2	S26	S26-S28 PolarHBondContact O-N 2.87Å
29	P	66.8	Low	70.9	Confident	100 Å²	100	117.9 Å²	117.9	65%	0.649	65%	0.65	S	S	*	*	S	Bend	trans	-47.5	154.8	169.1	-25.1	32.8	0	0	0	111.7	K31	P29-K31 PolarHBondContact O-N 3.22Å
30	P	71.3	Confident	72.5	Confident	129 Å²	129	114.6 Å²	114.6	84%	0.838	64%	0.639	S	S	*	*			trans	-48.5	112.6	-178.4	-25.2	32.4	0	0	0	110.5
31	K	70.7	Confident	73.9	Confident	150 Å²	150	111.9 Å²	111.9	65%	0.652	63%	0.628	S	S	*	*			trans	-58.1	131.4	-179.5	-68.5	175.7	-177.7	165.9	0	107.4	P29 T33	P29-K31 PolarHBondContact O-N 3.22Å; K31-T33 PolarHBondContact O-N 3.11Å
32	P	79.8	Confident	75.1	Confident	110 Å²	110	114.8 Å²	114.8	71%	0.714	63%	0.631	S	S	*	*			trans	-56.9	138.9	178.3	23.1	-32.5	0	0	0	109.8	V34	P32-V34 WeakPolarHBondContact O-CG2 3.37Å; P32-V34 PolarHBondContact O-N 3.48Å; P32-V34 VanDerWaalsContact O-N 3.08Å
33	T	82.4	Confident	76.4	Confident	95 Å²	95	109.5 Å²	109.5	58%	0.583	62%	0.616	S	S	*	*			trans	-58.4	114.7	179	-53.6	0	0	0	0	109.9	K31 F35 I40	K31-T33 PolarHBondContact O-N 3.11Å; T33-F35 HydrophobicContact CG2-CE2 3.92Å; T33-F35 HydrophobicContact CG2-CZ 4.2Å; T33-I40 HydrophobicContact CG2-CB 4.42Å; T33-I40 HydrophobicContact CG2-CG1 4.19Å; T33-I40 HydrophobicContact CG2-CG2 3.57Å
34	V	88.4	Confident	77.5	Confident	82 Å²	82	108.1 Å²	108.1	50%	0.497	61%	0.614	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-93	137.7	178.7	-179.8	0	0	0	0	109	P32 I36 A41	P32-V34 WeakPolarHBondContact O-CG2 3.37Å; P32-V34 PolarHBondContact O-N 3.48Å; P32-V34 VanDerWaalsContact O-N 3.08Å; V34-I36 HydrophobicContact CG1-CG1 4.31Å; V34-A41 HydrophobicContact CB-CB 4.18Å; V34-A41 HydrophobicContact CG1-CB 4.43Å; V34-A41 WeakPolarHBondContact O-CB 3.45Å; V34-A41 PolarHBondContact O-N 3.38Å
35	F	90.6	Very high	78.8	Confident	131 Å²	131	106.7 Å²	106.7	58%	0.575	61%	0.613	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-109.8	122.6	172.8	-69.3	-96.7	0	0	0	110.3	T33 V39 I40	T33-F35 HydrophobicContact CG2-CE2 3.92Å; T33-F35 HydrophobicContact CG2-CZ 4.2Å; F35-V39 CarbonylContact C-O 3.55Å; F35-V39 VanDerWaalsContact CA-O 3.27Å; F35-V39 WeakPolarHBondContact CA-O 3.4Å; F35-I40 HydrophobicContact CD1-CG1 3.93Å; F35-I40 HydrophobicContact CE1-CB 4.46Å; F35-I40 HydrophobicContact CE1-CD1 4.18Å; F35-I40 HydrophobicContact CE1-CG1 3.3Å; F35-I40 HydrophobicContact CZ-CD1 4.35Å; F35-I40 HydrophobicContact CZ-CG1 3.73Å
36	I	85.7	Confident	80.2	Confident	89 Å²	89	102 Å²	102	46%	0.456	59%	0.593	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-109.9	116.5	174.5	-57.3	173.2	0	0	0	107.2	V34 G38 V39 A41 F47	V34-I36 HydrophobicContact CG1-CG1 4.31Å; I36-G38 PolarHBondContact O-N 3.04Å; I36-V39 PolarHBondContact N-O 3.38Å; I36-V39 PolarHBondContact O-N 3.22Å; I36-A41 HydrophobicContact CD1-CB 3.77Å; I36-A41 HydrophobicContact CG1-CB 4.01Å; I36-F47 HydrophobicContact CD1-CZ 4.29Å
37	S	88.8	Confident	81.4	Confident	121 Å²	121	104.8 Å²	104.8	85%	0.846	60%	0.595	S	S	*	*	T	Hydrogen-bonded Turn	trans	48.8	35.7	-178.5	57	0	0	0	0	114.7
38	G	91.5	Very high	82.5	Confident	68 Å²	68	100.5 Å²	100.5	70%	0.701	57%	0.57	S	S	*	*	T	Hydrogen-bonded Turn	trans	90.1	-2.5	178.2	0	0	0	0	0	115.7	I36	I36-G38 PolarHBondContact O-N 3.04Å
39	V	89.3	Confident	83.6	Confident	98 Å²	98	102.1 Å²	102.1	59%	0.594	58%	0.579	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-104.5	140.6	177	-177.3	0	0	0	0	110.1	F35 I36 A41	F35-V39 CarbonylContact C-O 3.55Å; F35-V39 VanDerWaalsContact CA-O 3.27Å; F35-V39 WeakPolarHBondContact CA-O 3.4Å; I36-V39 PolarHBondContact N-O 3.38Å; I36-V39 PolarHBondContact O-N 3.22Å; V39-A41 PolarHBondContact O-N 3.08Å
40	I	90.1	Very high	84.3	Confident	93 Å²	93	100.2 Å²	100.2	48%	0.477	57%	0.572	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-67	119.8	173.6	-64.1	169.2	0	0	0	109.1	T33 F35	T33-I40 HydrophobicContact CG2-CB 4.42Å; T33-I40 HydrophobicContact CG2-CG1 4.19Å; T33-I40 HydrophobicContact CG2-CG2 3.57Å; F35-I40 HydrophobicContact CD1-CG1 3.93Å; F35-I40 HydrophobicContact CE1-CB 4.46Å; F35-I40 HydrophobicContact CE1-CD1 4.18Å; F35-I40 HydrophobicContact CE1-CG1 3.3Å; F35-I40 HydrophobicContact CZ-CD1 4.35Å; F35-I40 HydrophobicContact CZ-CG1 3.73Å
41	A	87.7	Confident	84.8	Confident	23 Å²	23	96.3 Å²	96.3	19%	0.19	55%	0.55	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-80.6	125.7	174.4	0	0	0	0	0	110.4	V34 I36 V39	V34-A41 HydrophobicContact CB-CB 4.18Å; V34-A41 HydrophobicContact CG1-CB 4.43Å; V34-A41 WeakPolarHBondContact O-CB 3.45Å; V34-A41 PolarHBondContact O-N 3.38Å; I36-A41 HydrophobicContact CD1-CB 3.77Å; I36-A41 HydrophobicContact CG1-CB 4.01Å; V39-A41 PolarHBondContact O-N 3.08Å
42	R	85.9	Confident	85.3	Confident	163 Å²	163	91.8 Å²	91.8	62%	0.615	54%	0.541	S	S	*	.			trans	-98.8	19.5	179.1	-58.5	-178	-62.7	169.9	3.4	112.5	K45 D46	R42-K45 HydrophobicContact CB-CB 4.2Å; R42-D46 WeakPolarHBondContact CB-OD2 3.46Å; R42-D46 IonicContact CZ-OD1 3.33Å; R42-D46 PolarHBondContact N-OD2 3.46Å; R42-D46 IonicContact NE-OD1 2.93Å; R42-D46 PolarHBondContact NE-OD1 3.41Å; R42-D46 IonicContact NE-OD2 3.99Å; R42-D46 IonicContact NH2-OD1 2.83Å; R42-D46 PolarHBondContact NH2-OD1 2.82Å
43	G	84.6	Confident	85.4	Confident	38 Å²	38	92.9 Å²	92.9	39%	0.392	54%	0.537	S	S	.	.	G	3₁₀ helix	trans	64.5	-133.9	-177.1	0	0	0	0	0	111.5	K45 D46 F47	G43-K45 PolarHBondContact O-N 3.03Å; G43-D46 PolarHBondContact O-N 3.05Å; G43-F47 WeakPolarHBondContact O-CD2 3.48Å
44	D	81.8	Confident	85.1	Confident	133 Å²	133	93.2 Å²	93.2	71%	0.711	54%	0.539	S	S	*	.	G	3₁₀ helix	trans	-59.9	-24.4	-171	-50.6	-37	0	0	0	113.5	D46 F47	D44-D46 PolarHBondContact O-N 3.25Å; D44-F47 CarbonylContact O-C 3.46Å; D44-F47 PolarHBondContact O-N 3.4Å; D44-F47 VanDerWaalsContact O-N 3.09Å
45	K	83	Confident	84.5	Confident	167 Å²	167	93.4 Å²	93.4	73%	0.726	55%	0.549	S	S	*	.	G	3₁₀ helix	trans	-63.2	-24.1	175.6	-69.1	-176.1	178.2	176.1	0	113.8	R42 G43	R42-K45 HydrophobicContact CB-CB 4.2Å; G43-K45 PolarHBondContact O-N 3.03Å
46	D	84.4	Confident	84	Confident	54 Å²	54	94.9 Å²	94.9	29%	0.289	56%	0.557	S	S	.	*	G	3₁₀ helix	trans	-93.1	-8	177.5	-63.7	-26.1	0	0	0	112.6	R42 G43 D44 P48	R42-D46 WeakPolarHBondContact CB-OD2 3.46Å; R42-D46 IonicContact CZ-OD1 3.33Å; R42-D46 PolarHBondContact N-OD2 3.46Å; R42-D46 IonicContact NE-OD1 2.93Å; R42-D46 PolarHBondContact NE-OD1 3.41Å; R42-D46 IonicContact NE-OD2 3.99Å; R42-D46 IonicContact NH2-OD1 2.83Å; R42-D46 PolarHBondContact NH2-OD1 2.82Å; G43-D46 PolarHBondContact O-N 3.05Å; D44-D46 PolarHBondContact O-N 3.25Å; D46-P48 VanDerWaalsContact C-CD 3.42Å
47	F	83.3	Confident	83.7	Confident	139 Å²	139	98.1 Å²	98.1	61%	0.61	57%	0.57	S	S	*	*	S	Bend	trans	-126.9	57.9	-178.7	-59.2	-82.8	0	0	0	112.7	I36 G43 D44	I36-F47 HydrophobicContact CD1-CZ 4.29Å; G43-F47 WeakPolarHBondContact O-CD2 3.48Å; D44-F47 CarbonylContact O-C 3.46Å; D44-F47 PolarHBondContact O-N 3.4Å; D44-F47 VanDerWaalsContact O-N 3.09Å
48	P	87.5	Confident	83.3	Confident	62 Å²	62	101.6 Å²	101.6	40%	0.403	57%	0.57	S	S	.	*			trans	-64.4	158.2	176.9	28.9	-35.6	0	0	0	111.7	D46 A50 A51 A52	D46-P48 VanDerWaalsContact C-CD 3.42Å; P48-A50 PolarHBondContact O-N 3.25Å; P48-A51 HydrophobicContact CG-CB 4.16Å; P48-A51 WeakPolarHBondContact O-CA 3.49Å; P48-A51 VanDerWaalsContact O-CB 3.31Å; P48-A51 WeakPolarHBondContact O-CB 3.31Å; P48-A51 PolarHBondContact O-N 3.47Å; P48-A52 PolarHBondContact O-N 3.31Å
49	P	82.6	Confident	83	Confident	100 Å²	100	104.4 Å²	104.4	65%	0.649	58%	0.576	S	S	*	*	H	α-helix	trans	-53.3	-33.2	-179.8	-28.8	35	0	0	0	114.3	A51 A52 Q53	P49-A51 VanDerWaalsContact C-N 3.3Å; P49-A51 PolarHBondContact O-N 3.4Å; P49-A52 WeakPolarHBondContact O-CB 3.49Å; P49-A52 PolarHBondContact O-N 3.37Å; P49-Q53 WeakPolarHBondContact O-CG 3.48Å; P49-Q53 PolarHBondContact O-N 3.41Å
50	A	80.4	Confident	82.5	Confident	60 Å²	60	108.4 Å²	108.4	50%	0.496	59%	0.588	S	S	.	*	H	α-helix	trans	-61.5	-35.6	174.9	0	0	0	0	0	112.8	P48 Q53 V54	P48-A50 PolarHBondContact O-N 3.25Å; A50-Q53 WeakPolarHBondContact O-CB 3.5Å; A50-Q53 PolarHBondContact O-N 2.76Å; A50-V54 WeakPolarHBondContact O-CG2 3.27Å; A50-V54 PolarHBondContact O-N 3.36Å; A50-V54 VanDerWaalsContact O-N 3.11Å
51	A	81.9	Confident	82	Confident	46 Å²	46	107.5 Å²	107.5	38%	0.38	59%	0.594	S	S	.	*	H	α-helix	trans	-67.5	-40.2	176.2	0	0	0	0	0	111.4	P48 P49 Q53 V54 A55	P48-A51 HydrophobicContact CG-CB 4.16Å; P48-A51 WeakPolarHBondContact O-CA 3.49Å; P48-A51 VanDerWaalsContact O-CB 3.31Å; P48-A51 WeakPolarHBondContact O-CB 3.31Å; P48-A51 PolarHBondContact O-N 3.47Å; P49-A51 VanDerWaalsContact C-N 3.3Å; P49-A51 PolarHBondContact O-N 3.4Å; A51-Q53 VanDerWaalsContact C-N 3.27Å; A51-Q53 PolarHBondContact O-N 3.09Å; A51-V54 PolarHBondContact O-N 3.3Å; A51-A55 PolarHBondContact O-N 2.93Å
52	A	81.2	Confident	81.2	Confident	56 Å²	56	112.2 Å²	112.2	46%	0.463	63%	0.626	S	S	.	*	H	α-helix	trans	-61.6	-37.5	172.6	0	0	0	0	0	111.4	P48 P49 V54 A55 H56	P48-A52 PolarHBondContact O-N 3.31Å; P49-A52 WeakPolarHBondContact O-CB 3.49Å; P49-A52 PolarHBondContact O-N 3.37Å; A52-V54 PolarHBondContact O-N 3.03Å; A52-A55 WeakPolarHBondContact O-CB 3.5Å; A52-A55 PolarHBondContact O-N 3.24Å; A52-H56 PolarHBondContact O-CE1 3.48Å; A52-H56 PolarHBondContact O-ND1 2.72Å
53	Q	82.8	Confident	80.5	Confident	132 Å²	132	111.5 Å²	111.5	62%	0.617	63%	0.631	S	S	*	*	H	α-helix	trans	-64.8	-36.6	176	-68.2	173.6	18.6	0	0	112.8	P49 A50 A51 A55 H56	P49-Q53 WeakPolarHBondContact O-CG 3.48Å; P49-Q53 PolarHBondContact O-N 3.41Å; A50-Q53 WeakPolarHBondContact O-CB 3.5Å; A50-Q53 PolarHBondContact O-N 2.76Å; A51-Q53 VanDerWaalsContact C-N 3.27Å; A51-Q53 PolarHBondContact O-N 3.09Å; Q53-A55 VanDerWaalsContact C-N 3.27Å; Q53-A55 PolarHBondContact O-N 2.98Å; Q53-H56 WeakPolarHBondContact O-CB 3.44Å; Q53-H56 PolarHBondContact O-N 3.04Å; Q53-H56 VanDerWaalsContact O-N 3.08Å
54	V	75.8	Confident	79.6	Confident	103 Å²	103	116.4 Å²	116.4	62%	0.624	65%	0.649	S	S	*	*	H	α-helix	trans	-61.7	-36.1	176.7	173.6	0	0	0	0	111.5	A50 A51 A52 H56 Q57	A50-V54 WeakPolarHBondContact O-CG2 3.27Å; A50-V54 PolarHBondContact O-N 3.36Å; A50-V54 VanDerWaalsContact O-N 3.11Å; A51-V54 PolarHBondContact O-N 3.3Å; A52-V54 PolarHBondContact O-N 3.03Å; V54-H56 PolarHBondContact O-N 3.38Å; V54-Q57 PolarHBondContact O-N 2.83Å
55	A	75.1	Confident	78.8	Confident	86 Å²	86	119.2 Å²	119.2	71%	0.711	66%	0.655	S	S	*	*	H	α-helix	trans	-63.7	-23	176.5	0	0	0	0	0	113.7	A51 A52 Q53	A51-A55 PolarHBondContact O-N 2.93Å; A52-A55 WeakPolarHBondContact O-CB 3.5Å; A52-A55 PolarHBondContact O-N 3.24Å; Q53-A55 VanDerWaalsContact C-N 3.27Å; Q53-A55 PolarHBondContact O-N 2.98Å
56	H	79.7	Confident	77.9	Confident	161 Å²	161	119.1 Å²	119.1	75%	0.745	66%	0.656	S	S	*	*	H	α-helix	trans	-83.2	-16.6	175.9	-63.1	85.4	0	0	0	112.6	A52 Q53 V54 K58	A52-H56 PolarHBondContact O-CE1 3.48Å; A52-H56 PolarHBondContact O-ND1 2.72Å; Q53-H56 WeakPolarHBondContact O-CB 3.44Å; Q53-H56 PolarHBondContact O-N 3.04Å; Q53-H56 VanDerWaalsContact O-N 3.08Å; V54-H56 PolarHBondContact O-N 3.38Å; H56-K58 PolarHBondContact O-N 3.38Å
57	Q	80.1	Confident	76.9	Confident	158 Å²	158	123.1 Å²	123.1	74%	0.738	68%	0.682	S	S	*	*	S	Bend	trans	-86.1	102.4	171.8	-73.7	-139.4	74.4	0	0	110	V54	V54-Q57 PolarHBondContact O-N 2.83Å
58	K	80.9	Confident	76.1	Confident	193 Å²	193	121.5 Å²	121.5	84%	0.839	69%	0.689	S	S	*	*	P	Polyproline II helix	trans	-59.6	128.9	171.6	-68.1	-175.7	-179.2	179.4	0	108.9	H56 H60	H56-K58 PolarHBondContact O-N 3.38Å; K58-H60 PolarHBondContact O-N 3.27Å
59	P	84.3	Confident	75.1	Confident	128 Å²	128	123.7 Å²	123.7	83%	0.831	70%	0.702	S	S	*	*	P	Polyproline II helix	trans	-58.9	126.9	176.2	21.2	-29.4	0	0	0	109.2
60	H	80.2	Confident	74.3	Confident	181 Å²	181	128.7 Å²	128.7	84%	0.838	71%	0.709	S	S	*	*	P	Polyproline II helix	trans	-70	131.7	171.2	-166.8	-84.6	0	0	0	108.1	K58 S62	K58-H60 PolarHBondContact O-N 3.27Å; H60-S62 PolarHBondContact O-N 3.05Å
61	A	77.8	Confident	73.6	Confident	74 Å²	74	131 Å²	131	61%	0.612	72%	0.717	S	S	*	*	P	Polyproline II helix	trans	-57.9	126.1	175.3	0	0	0	0	0	109.1	M63	A61-M63 VanDerWaalsContact C-N 3.25Å
62	S	72.7	Confident	72.8	Confident	122 Å²	122	137 Å²	137	85%	0.853	74%	0.737	S	S	*	*			trans	-79	-11.3	178.9	62.1	0	0	0	0	113	H60 D64	H60-S62 PolarHBondContact O-N 3.05Å; S62-D64 PolarHBondContact O-N 3.22Å
63	M	69.6	Low	72.4	Confident	148 Å²	148	141.1 Å²	141.1	73%	0.729	75%	0.746	S	S	*	*	S	Bend	trans	-85.8	107	179.5	-52.3	-155.9	75.3	0	0	108.9	A61 K65	A61-M63 VanDerWaalsContact C-N 3.25Å; M63-K65 PolarHBondContact O-N 3.11Å
64	D	65.6	Low	72.1	Confident	142 Å²	142	141.2 Å²	141.2	76%	0.759	75%	0.749	S	S	*	*			trans	-59.8	124.5	166.1	-165.5	21	0	0	0	107.8	S62 H66	S62-D64 PolarHBondContact O-N 3.22Å; D64-H66 PolarHBondContact O-N 2.91Å
65	K	66.5	Low	72.3	Confident	192 Å²	192	145.4 Å²	145.4	84%	0.835	76%	0.762	S	S	*	*			trans	-65.7	101.4	-178.9	-68.9	173.5	-177.9	174.7	0	106.4	M63 V67	M63-K65 PolarHBondContact O-N 3.11Å; K65-V67 PolarHBondContact O-N 3.23Å; K65-V67 VanDerWaalsContact O-N 3.08Å
66	H	62.9	Low	72.8	Confident	164 Å²	164	147.9 Å²	147.9	76%	0.759	76%	0.759	S	S	*	*			trans	-46	122.4	176.6	-65.3	-66.9	0	0	0	109.7	D64 S68	D64-H66 PolarHBondContact O-N 2.91Å; H66-S68 PolarHBondContact O-N 3.32Å
67	V	64.4	Low	73.1	Confident	138 Å²	138	145.9 Å²	145.9	84%	0.836	76%	0.761	S	S	*	*			trans	-59.3	110.1	168.3	-169.9	0	0	0	0	105.7	K65 P69	K65-V67 PolarHBondContact O-N 3.23Å; K65-V67 VanDerWaalsContact O-N 3.08Å; V67-P69 WeakPolarHBondContact O-CD 3.42Å
68	S	66.9	Low	73.1	Confident	106 Å²	106	150 Å²	150	74%	0.741	77%	0.769	S	S	*	*			trans	-47.4	111.2	-177.1	178.7	0	0	0	0	110.6	H66 R70	H66-S68 PolarHBondContact O-N 3.32Å; S68-R70 PolarHBondContact O-N 3.01Å
69	P	65.8	Low	72.8	Confident	107 Å²	107	154.4 Å²	154.4	70%	0.695	79%	0.788	S	S	*	*			trans	-90.6	104.9	178.6	26.9	-15.6	0	0	0	108.9	V67	V67-P69 WeakPolarHBondContact O-CD 3.42Å
70	R	64.9	Low	72.3	Confident	206 Å²	206	155.7 Å²	155.7	78%	0.777	79%	0.786	S	S	*	*			trans	70.4	137.6	159.7	-70.3	-178.1	-171.1	-128.7	-0.8	118.3	S68 Q72	S68-R70 PolarHBondContact O-N 3.01Å; R70-Q72 PolarHBondContact O-N 3.06Å; R70-Q72 VanDerWaalsContact O-N 3.16Å
71	T	65.8	Low	71.8	Confident	109 Å²	109	154.4 Å²	154.4	67%	0.669	78%	0.783	S	S	*	*			trans	-52.7	115.1	155.8	41.1	0	0	0	0	109.3	H73	T71-H73 VanDerWaalsContact C-N 3.26Å; T71-H73 PolarHBondContact O-CE1 3.43Å; T71-H73 VanDerWaalsContact O-CE1 3.3Å; T71-H73 PolarHBondContact O-N 2.79Å; T71-H73 PolarHBondContact O-ND1 2.79Å
72	Q	66.5	Low	71.5	Confident	170 Å²	170	158.8 Å²	158.8	79%	0.794	79%	0.793	S	S	*	*			trans	-67.9	89.9	166	-66.4	-79.6	-12.4	0	0	106.4	R70 I74	R70-Q72 PolarHBondContact O-N 3.06Å; R70-Q72 VanDerWaalsContact O-N 3.16Å; Q72-I74 VanDerWaalsContact C-N 3.29Å; Q72-I74 PolarHBondContact O-N 3.08Å
73	H	71.9	Confident	71.5	Confident	144 Å²	144	161 Å²	161	67%	0.667	79%	0.789	S	S	*	*			trans	-65.6	93.8	175.2	-5.9	-98	0	0	0	107.7	T71 Q75	T71-H73 VanDerWaalsContact C-N 3.26Å; T71-H73 PolarHBondContact O-CE1 3.43Å; T71-H73 VanDerWaalsContact O-CE1 3.3Å; T71-H73 PolarHBondContact O-N 2.79Å; T71-H73 PolarHBondContact O-ND1 2.79Å; H73-Q75 PolarHBondContact O-N 2.82Å; H73-Q75 VanDerWaalsContact O-N 3.13Å
74	I	76.9	Confident	71.6	Confident	133 Å²	133	161.8 Å²	161.8	68%	0.682	79%	0.793	S	S	*	*			trans	-65.9	113.7	176.1	-55.3	173.2	0	0	0	106.9	Q72 Q76	Q72-I74 VanDerWaalsContact C-N 3.29Å; Q72-I74 PolarHBondContact O-N 3.08Å; I74-Q76 PolarHBondContact O-N 3.27Å; I74-Q76 VanDerWaalsContact O-N 3.15Å
75	Q	80.3	Confident	72	Confident	191 Å²	191	163.1 Å²	163.1	89%	0.893	80%	0.795	S	S	*	*			trans	-76.1	105.8	179.5	-155.2	162.4	94.7	0	0	108.6	H73	H73-Q75 PolarHBondContact O-N 2.82Å; H73-Q75 VanDerWaalsContact O-N 3.13Å
76	Q	85.3	Confident	72.4	Confident	138 Å²	138	161.1 Å²	161.1	65%	0.645	79%	0.793	S	S	*	*	P	Polyproline II helix	trans	-76.3	141.1	175.3	-63.8	-65.7	-43	0	0	109.6	I74 R78	I74-Q76 PolarHBondContact O-N 3.27Å; I74-Q76 VanDerWaalsContact O-N 3.15Å; Q76-R78 PolarHBondContact O-N 2.9Å
77	P	85.3	Confident	73.1	Confident	120 Å²	120	160.8 Å²	160.8	78%	0.779	80%	0.795	S	S	*	*	P	Polyproline II helix	trans	-61.6	123	174.8	24.6	-31	0	0	0	109.5
78	R	81.1	Confident	73.8	Confident	245 Å²	245	162.8 Å²	162.8	93%	0.925	79%	0.792	S	S	*	*	P	Polyproline II helix	trans	-79.9	138.6	169.7	-74.6	-179.1	171.7	159.3	-2.5	108.8	Q76	Q76-R78 PolarHBondContact O-N 2.9Å
79	K	75.1	Confident	74.4	Confident	284 Å²	284	167.9 Å²	167.9	100%	1.235	80%	0.796	S	S	*	*			trans	-63.4	0	177.2	-69.9	-173	177.7	-175.1	0	111.9

Retrieved 79 of 79 residues in 34.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).