A0A087WR64_MOUSE Loading...

Keratinocyte differentiation associated protein

AlphaFold DB , UniProt , Accession A0A087WR64, Species MOUSE (Mus musculus, Mouse), Gene Krtdap, Length 57 aa.

						>A0A087WR64_MOUSE|A0A087WR64|Krtdap
MKIPILPVVALLSLLALHAVQGAALGHPTIYPEDSSYNNYPTATEVKGLRSAAPDSQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	69.7	Low	84.1	Confident	242 Å²	242	120.3 Å²	120.3	100%	1.192	65%	0.645	S	S	*	*				0	127.4	0	-68.7	168.4	133.9	0	0	107.9
2	K	79.3	Confident	84.5	Confident	207 Å²	207	119.3 Å²	119.3	90%	0.9	64%	0.639	S	S	*	*	P	Polyproline II helix	trans	-89.4	118.7	-177.6	-170.2	139.3	80.8	173	0	109.2
3	I	75.1	Confident	84.8	Confident	127 Å²	127	115.6 Å²	115.6	65%	0.651	63%	0.628	S	S	*	*	P	Polyproline II helix	trans	-77.9	126.2	177.2	-59.4	171.4	0	0	0	107.7	I5 V8	I3-I5 PolarHBondContact O-N 3.01Å; I3-V8 HydrophobicContact CG2-CG2 3.95Å
4	P	79.8	Confident	85	Confident	86 Å²	86	115.1 Å²	115.1	56%	0.558	62%	0.624	S	S	*	*	P	Polyproline II helix	trans	-63.8	127.5	173.7	24.4	-30.9	0	0	0	109.5	L6 P7	P4-L6 VanDerWaalsContact C-N 3.34Å; P4-P7 HydrophobicContact CB-CG 3.98Å; P4-P7 HydrophobicContact CG-CG 3.67Å; P4-P7 WeakPolarHBondContact O-CD 3.49Å; P4-P7 WeakPolarHBondContact O-CG 3.47Å
5	I	84.9	Confident	85	Confident	137 Å²	137	115.1 Å²	115.1	70%	0.703	62%	0.622	S	S	*	*	H	α-helix	trans	-70.8	-33.2	-174.9	-61.3	171.1	0	0	0	111.2	I3 V8 V9	I3-I5 PolarHBondContact O-N 3.01Å; I5-V8 WeakPolarHBondContact O-CB 3.32Å; I5-V8 PolarHBondContact O-N 3.4Å; I5-V8 VanDerWaalsContact O-N 3.17Å; I5-V9 HydrophobicContact CG2-CG2 4.14Å; I5-V9 WeakPolarHBondContact O-CG2 3.49Å; I5-V9 PolarHBondContact O-N 3.38Å; I5-V9 VanDerWaalsContact O-N 3.13Å
6	L	87.3	Confident	85	Confident	145 Å²	145	111.6 Å²	111.6	76%	0.759	61%	0.614	S	S	*	*	H	α-helix	trans	-55.8	-49.6	-177	-168.5	67.8	0	0	0	114.2	P4 V8 V9 A10	P4-L6 VanDerWaalsContact C-N 3.34Å; L6-V8 VanDerWaalsContact C-N 3.32Å; L6-V8 PolarHBondContact O-N 3.06Å; L6-V9 PolarHBondContact O-N 3.47Å; L6-A10 PolarHBondContact O-N 3.35Å; L6-A10 VanDerWaalsContact O-N 3.12Å
7	P	87.3	Confident	84.8	Confident	64 Å²	64	111.2 Å²	111.2	42%	0.416	61%	0.61	S	S	.	*	H	α-helix	trans	-66.1	-31.7	177.2	22.5	-33.2	0	0	0	113.4	P4 A10 L11	P4-P7 HydrophobicContact CB-CG 3.98Å; P4-P7 HydrophobicContact CG-CG 3.67Å; P4-P7 WeakPolarHBondContact O-CD 3.49Å; P4-P7 WeakPolarHBondContact O-CG 3.47Å; P7-A10 PolarHBondContact O-N 3.36Å; P7-L11 WeakPolarHBondContact O-CG 3.22Å; P7-L11 PolarHBondContact O-N 3.12Å
8	V	90	Very high	84.2	Confident	67 Å²	67	111.9 Å²	111.9	41%	0.406	61%	0.609	S	S	.	*	H	α-helix	trans	-64.5	-44.2	177.5	-179.7	0	0	0	0	110.2	I3 I5 L6 A10 L11 L12	I3-V8 HydrophobicContact CG2-CG2 3.95Å; I5-V8 WeakPolarHBondContact O-CB 3.32Å; I5-V8 PolarHBondContact O-N 3.4Å; I5-V8 VanDerWaalsContact O-N 3.17Å; L6-V8 VanDerWaalsContact C-N 3.32Å; L6-V8 PolarHBondContact O-N 3.06Å; V8-A10 VanDerWaalsContact C-N 3.34Å; V8-A10 PolarHBondContact O-N 3.5Å; V8-L11 PolarHBondContact O-N 3.37Å; V8-L12 HydrophobicContact CG1-CD1 4.17Å; V8-L12 VanDerWaalsContact O-N 3.08Å; V8-L12 WeakPolarHBondContact O-CG 3.18Å; V8-L12 PolarHBondContact O-N 3.13Å
9	V	90.8	Very high	83.6	Confident	78 Å²	78	110.3 Å²	110.3	47%	0.473	61%	0.612	S	S	.	*	H	α-helix	trans	-63	-41	176.1	176.9	0	0	0	0	111.2	I5 L6 L11 L12 S13	I5-V9 HydrophobicContact CG2-CG2 4.14Å; I5-V9 WeakPolarHBondContact O-CG2 3.49Å; I5-V9 PolarHBondContact O-N 3.38Å; I5-V9 VanDerWaalsContact O-N 3.13Å; L6-V9 PolarHBondContact O-N 3.47Å; V9-L11 PolarHBondContact O-N 3.08Å; V9-L12 PolarHBondContact O-N 3.42Å; V9-S13 PolarHBondContact O-N 3.25Å; V9-S13 PolarHBondContact O-OG 3.17Å; V9-S13 VanDerWaalsContact O-OG 3.06Å
10	A	90.8	Very high	82.8	Confident	50 Å²	50	110.9 Å²	110.9	41%	0.413	62%	0.618	S	S	.	*	H	α-helix	trans	-62.1	-44.1	177.6	0	0	0	0	0	112.5	L6 P7 V8 S13 L14	L6-A10 PolarHBondContact O-N 3.35Å; L6-A10 VanDerWaalsContact O-N 3.12Å; P7-A10 PolarHBondContact O-N 3.36Å; V8-A10 VanDerWaalsContact C-N 3.34Å; V8-A10 PolarHBondContact O-N 3.5Å; A10-S13 PolarHBondContact O-N 3.44Å; A10-L14 WeakPolarHBondContact O-CG 3.33Å; A10-L14 PolarHBondContact O-N 3.37Å
11	L	90.5	Very high	82.2	Confident	120 Å²	120	111.6 Å²	111.6	63%	0.628	62%	0.617	S	S	*	*	H	α-helix	trans	-65.3	-39.9	178.5	-68.8	173.5	0	0	0	112.2	P7 V8 V9 L14 L15	P7-L11 WeakPolarHBondContact O-CG 3.22Å; P7-L11 PolarHBondContact O-N 3.12Å; V8-L11 PolarHBondContact O-N 3.37Å; V9-L11 PolarHBondContact O-N 3.08Å; L11-L14 PolarHBondContact O-N 3.47Å; L11-L15 WeakPolarHBondContact O-CB 3.42Å; L11-L15 PolarHBondContact O-N 3.41Å
12	L	89.1	Confident	82	Confident	108 Å²	108	103 Å²	103	57%	0.565	59%	0.591	S	S	*	*	H	α-helix	trans	-65.1	-40.7	176	-69.5	172.6	0	0	0	111.9	V8 V9 L15 A16	V8-L12 HydrophobicContact CG1-CD1 4.17Å; V8-L12 VanDerWaalsContact O-N 3.08Å; V8-L12 WeakPolarHBondContact O-CG 3.18Å; V8-L12 PolarHBondContact O-N 3.13Å; V9-L12 PolarHBondContact O-N 3.42Å; L12-L15 PolarHBondContact O-N 3Å; L12-A16 WeakPolarHBondContact O-CB 3.4Å; L12-A16 PolarHBondContact O-N 3.42Å
13	S	88.5	Confident	81.3	Confident	72 Å²	72	97.5 Å²	97.5	50%	0.503	58%	0.584	S	S	.	*	H	α-helix	trans	-64.2	-42.5	175.2	-64	0	0	0	0	112.4	V9 A10 A16 L17	V9-S13 PolarHBondContact O-N 3.25Å; V9-S13 PolarHBondContact O-OG 3.17Å; V9-S13 VanDerWaalsContact O-OG 3.06Å; A10-S13 PolarHBondContact O-N 3.44Å; S13-A16 PolarHBondContact O-N 2.95Å; S13-L17 WeakPolarHBondContact O-CB 3.34Å; S13-L17 PolarHBondContact O-N 3.01Å
14	L	87.3	Confident	80.5	Confident	108 Å²	108	96.4 Å²	96.4	57%	0.565	59%	0.594	S	S	*	*	H	α-helix	trans	-64.8	-41.6	176.4	-73	171.9	0	0	0	111.9	A10 L11 L17 H18	A10-L14 WeakPolarHBondContact O-CG 3.33Å; A10-L14 PolarHBondContact O-N 3.37Å; L11-L14 PolarHBondContact O-N 3.47Å; L14-L17 PolarHBondContact O-N 3.31Å; L14-H18 PolarHBondContact O-N 2.9Å; L14-H18 WeakPolarHBondContact O-CB 3.36Å
15	L	85.2	Confident	79.4	Confident	115 Å²	115	99.8 Å²	99.8	60%	0.602	61%	0.606	S	S	*	*	H	α-helix	trans	-61.8	-43.6	176.3	-178.5	62.2	0	0	0	111.5	L11 L12 H18 A19	L11-L15 WeakPolarHBondContact O-CB 3.42Å; L11-L15 PolarHBondContact O-N 3.41Å; L12-L15 PolarHBondContact O-N 3Å; L15-H18 PolarHBondContact O-N 3.4Å; L15-A19 VanDerWaalsContact O-N 3.09Å; L15-A19 PolarHBondContact O-N 3.09Å
16	A	85.3	Confident	78	Confident	60 Å²	60	96.2 Å²	96.2	50%	0.496	60%	0.603	S	S	.	*	H	α-helix	trans	-64.6	-40.9	176	0	0	0	0	0	112.4	L12 S13 A19 V20	L12-A16 WeakPolarHBondContact O-CB 3.4Å; L12-A16 PolarHBondContact O-N 3.42Å; S13-A16 PolarHBondContact O-N 2.95Å; A16-A19 PolarHBondContact O-N 3.42Å; A16-V20 PolarHBondContact O-N 2.96Å
17	L	80.8	Confident	76.5	Confident	104 Å²	104	96.5 Å²	96.5	55%	0.545	60%	0.6	S	S	.	*	H	α-helix	trans	-67	-36.3	177	-177.6	60.4	0	0	0	112.3	S13 L14 V20 Q21	S13-L17 WeakPolarHBondContact O-CB 3.34Å; S13-L17 PolarHBondContact O-N 3.01Å; L14-L17 PolarHBondContact O-N 3.31Å; L17-V20 PolarHBondContact O-N 2.99Å; L17-Q21 PolarHBondContact O-NE2 3.48Å
18	H	74.6	Confident	75	Confident	125 Å²	125	98 Å²	98	58%	0.579	61%	0.61	S	S	*	*	H	α-helix	trans	-66.8	-38.6	175.4	-177.1	59.2	0	0	0	112.1	L14 L15 V20 Q21	L14-H18 PolarHBondContact O-N 2.9Å; L14-H18 WeakPolarHBondContact O-CB 3.36Å; L15-H18 PolarHBondContact O-N 3.4Å; H18-V20 PolarHBondContact O-N 3.03Å; H18-Q21 PolarHBondContact ND1-OE1 2.97Å; H18-Q21 WeakPolarHBondContact O-CB 3.39Å; H18-Q21 PolarHBondContact O-N 3.32Å
19	A	71.7	Confident	73.4	Confident	81 Å²	81	101.1 Å²	101.1	67%	0.669	63%	0.629	S	S	*	*	H	α-helix	trans	-62.7	-27.9	178	0	0	0	0	0	113.4	L15 A16 Q21	L15-A19 VanDerWaalsContact O-N 3.09Å; L15-A19 PolarHBondContact O-N 3.09Å; A16-A19 PolarHBondContact O-N 3.42Å; A19-Q21 VanDerWaalsContact C-N 3.29Å
20	V	68.9	Low	71.9	Confident	122 Å²	122	103.3 Å²	103.3	74%	0.739	64%	0.637	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.7	-15.3	175.8	163.7	0	0	0	0	112.9	A16 L17 H18 G22	A16-V20 PolarHBondContact O-N 2.96Å; L17-V20 PolarHBondContact O-N 2.99Å; H18-V20 PolarHBondContact O-N 3.03Å; V20-G22 PolarHBondContact O-N 3.36Å; V20-G22 VanDerWaalsContact O-N 3.09Å
21	Q	70.1	Confident	70.3	Confident	125 Å²	125	109.9 Å²	109.9	58%	0.584	65%	0.652	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.5	15.3	178.3	-62.4	162.2	12.2	0	0	112.9	L17 H18 A19 A23	L17-Q21 PolarHBondContact O-NE2 3.48Å; H18-Q21 PolarHBondContact ND1-OE1 2.97Å; H18-Q21 WeakPolarHBondContact O-CB 3.39Å; H18-Q21 PolarHBondContact O-N 3.32Å; A19-Q21 VanDerWaalsContact C-N 3.29Å; Q21-A23 PolarHBondContact O-N 3.09Å
22	G	65.9	Low	68.5	Low	63 Å²	63	107.9 Å²	107.9	65%	0.649	65%	0.647	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.4	106.4	173.6	0	0	0	0	0	112.1	V20	V20-G22 PolarHBondContact O-N 3.36Å; V20-G22 VanDerWaalsContact O-N 3.09Å
23	A	63.3	Low	67	Low	91 Å²	91	109.5 Å²	109.5	75%	0.752	65%	0.652	S	S	*	*	T	Hydrogen-bonded Turn	trans	61.5	52.8	152.1	0	0	0	0	0	117.9	Q21 L25	Q21-A23 PolarHBondContact O-N 3.09Å; A23-L25 VanDerWaalsContact C-N 3.25Å
24	A	58.6	Low	65.4	Low	104 Å²	104	113.1 Å²	113.1	86%	0.86	67%	0.665	S	S	*	*			trans	-89.4	12.2	154	0	0	0	0	0	112.8	G26	A24-G26 PolarHBondContact O-N 3.04Å
25	L	57.8	Low	63.9	Low	156 Å²	156	112.2 Å²	112.2	82%	0.817	67%	0.668	S	S	*	*	S	Bend	trans	-80.1	85.6	154.4	-68.2	174.3	0	0	0	105.4	A23 H27	A23-L25 VanDerWaalsContact C-N 3.25Å; L25-H27 PolarHBondContact O-N 3.17Å
26	G	55.1	Low	62.5	Low	62 Å²	62	111 Å²	111	64%	0.639	67%	0.669	S	S	*	*			trans	-45.5	122.7	165.2	0	0	0	0	0	106.7	A24 P28	A24-G26 PolarHBondContact O-N 3.04Å; G26-P28 WeakPolarHBondContact O-CD 3.21Å
27	H	55.2	Low	61.1	Low	151 Å²	151	119.2 Å²	119.2	70%	0.699	69%	0.689	S	S	*	*			trans	-48.7	122.2	165.2	-103	70.8	0	0	0	105.2	L25 T29	L25-H27 PolarHBondContact O-N 3.17Å; H27-T29 PolarHBondContact O-N 3.15Å
28	P	56.4	Low	60	Low	97 Å²	97	119.5 Å²	119.5	63%	0.63	69%	0.691	S	S	*	*			trans	-59.1	104.1	155.9	-9.6	25.1	0	0	0	103.4	G26 I30	G26-P28 WeakPolarHBondContact O-CD 3.21Å; P28-I30 PolarHBondContact O-N 2.82Å
29	T	56.4	Low	59.5	Low	132 Å²	132	120.7 Å²	120.7	81%	0.81	70%	0.701	S	S	*	*	S	Bend	trans	-69.9	46.8	164.5	-37.1	0	0	0	0	108.5	H27	H27-T29 PolarHBondContact O-N 3.15Å
30	I	59.4	Low	58.6	Low	124 Å²	124	126 Å²	126	64%	0.636	71%	0.706	S	S	*	*			trans	-143.5	74.7	175.8	-48.3	-72.9	0	0	0	102.5	P28 P32	P28-I30 PolarHBondContact O-N 2.82Å; I30-P32 WeakPolarHBondContact O-CD 3.27Å; I30-P32 VanDerWaalsContact O-CD 3.27Å; I30-P32 HydrophobicContact CG2-CB 4.21Å; I30-P32 HydrophobicContact CG2-CG 3.99Å
31	Y	55.5	Low	57.9	Low	187 Å²	187	125.6 Å²	125.6	73%	0.733	71%	0.705	S	S	*	*			trans	-71.8	110.2	134.2	-72.8	-81.9	0	0	0	103.9	E33	Y31-E33 WeakPolarHBondContact CB-OE2 3.19Å; Y31-E33 PolarHBondContact O-N 2.99Å
32	P	52.5	Low	57.4	Low	78 Å²	78	125.8 Å²	125.8	51%	0.506	72%	0.715	S	S	.	*			trans	-83.2	80.5	155.8	30.3	-14.7	0	0	0	104.5	I30 D34	I30-P32 WeakPolarHBondContact O-CD 3.27Å; I30-P32 VanDerWaalsContact O-CD 3.27Å; I30-P32 HydrophobicContact CG2-CB 4.21Å; I30-P32 HydrophobicContact CG2-CG 3.99Å; P32-D34 PolarHBondContact O-N 2.92Å
33	E	57.7	Low	56.9	Low	143 Å²	143	126.7 Å²	126.7	67%	0.668	72%	0.716	S	S	*	*	S	Bend	trans	-60.2	109.7	134.1	64.4	-82.5	-174.7	0	0	104.6	Y31	Y31-E33 WeakPolarHBondContact CB-OE2 3.19Å; Y31-E33 PolarHBondContact O-N 2.99Å
34	D	56.4	Low	56.6	Low	148 Å²	148	128 Å²	128	79%	0.791	72%	0.715	S	S	*	*	S	Bend	trans	68.7	75.7	174.1	-44	-36.9	0	0	0	115.7	P32	P32-D34 PolarHBondContact O-N 2.92Å
35	S	55.8	Low	56.5	Low	89 Å²	89	131.6 Å²	131.6	62%	0.622	71%	0.714	S	S	*	*				-174.3	118.3	127.6	30.7	0	0	0	0	111.9
36	S	55.3	Low	56.1	Low	88 Å²	88	130.1 Å²	130.1	62%	0.615	71%	0.711	S	S	*	*			trans	27.3	109.7	142	-169.8	0	0	0	0	115.7	N38	S36-N38 PolarHBondContact O-N 2.88Å; S36-N38 PolarHBondContact O-ND2 3.26Å; S36-N38 PolarHBondContact O-OD1 3.1Å; S36-N38 PolarHBondContact OG-OD1 2.78Å
37	Y	55.7	Low	56	Low	233 Å²	233	137 Å²	137	91%	0.914	72%	0.724	S	S	*	*			trans	-38.5	75.3	160.2	-153.2	-92.7	0	0	0	112.4	N39	Y37-N39 PolarHBondContact O-N 2.99Å
38	N	56.8	Low	56	Low	110 Å²	110	132.4 Å²	132.4	59%	0.588	72%	0.717	S	S	*	*			trans	-87.9	97.6	-178.2	-74.4	-25.3	0	0	0	107.6	S36 Y40	S36-N38 PolarHBondContact O-N 2.88Å; S36-N38 PolarHBondContact O-ND2 3.26Å; S36-N38 PolarHBondContact O-OD1 3.1Å; S36-N38 PolarHBondContact OG-OD1 2.78Å; N38-Y40 WeakPolarHBondContact O-CD2 3.42Å; N38-Y40 PolarHBondContact O-N 2.85Å
39	N	65.6	Low	56	Low	151 Å²	151	136.1 Å²	136.1	81%	0.807	73%	0.73	S	S	*	*			trans	-57.3	94.5	166.2	-176.9	17.5	0	0	0	109.4	Y37 P41	Y37-N39 PolarHBondContact O-N 2.99Å; N39-P41 WeakPolarHBondContact O-CD 3.44Å
40	Y	52.7	Low	55.9	Low	193 Å²	193	141.2 Å²	141.2	76%	0.757	74%	0.735	S	S	*	*			trans	-73.8	130.3	178	-89.9	-88.5	0	0	0	111.3	N38	N38-Y40 WeakPolarHBondContact O-CD2 3.42Å; N38-Y40 PolarHBondContact O-N 2.85Å
41	P	53.1	Low	55.8	Low	113 Å²	113	140.7 Å²	140.7	73%	0.734	74%	0.742	S	S	*	*			trans	-84.9	121.1	139.3	30.2	-20.7	0	0	0	108.1	N39 A43	N39-P41 WeakPolarHBondContact O-CD 3.44Å; P41-A43 VanDerWaalsContact C-N 3.33Å; P41-A43 PolarHBondContact O-N 3.18Å
42	T	60.4	Low	55.6	Low	128 Å²	128	136.2 Å²	136.2	79%	0.785	74%	0.744	S	S	*	*			trans	-63.9	90.4	175.8	-48.9	0	0	0	0	109.7	T44	T42-T44 PolarHBondContact O-N 3.48Å; T42-T44 VanDerWaalsContact O-N 3.1Å
43	A	56.2	Low	55.9	Low	82 Å²	82	137.1 Å²	137.1	68%	0.678	76%	0.758	S	S	*	*			trans	-74.7	98.9	170.8	0	0	0	0	0	108.2	P41 E45	P41-A43 VanDerWaalsContact C-N 3.33Å; P41-A43 PolarHBondContact O-N 3.18Å; A43-E45 VanDerWaalsContact C-N 3.32Å; A43-E45 PolarHBondContact O-N 3.18Å
44	T	56.5	Low	55.6	Low	118 Å²	118	136 Å²	136	72%	0.724	76%	0.763	S	S	*	*			trans	-58.2	98.5	162.6	-56.1	0	0	0	0	107.9	T42 V46	T42-T44 PolarHBondContact O-N 3.48Å; T42-T44 VanDerWaalsContact O-N 3.1Å; T44-V46 VanDerWaalsContact C-N 3.28Å; T44-V46 HydrophobicContact CG2-CG2 3.95Å; T44-V46 PolarHBondContact O-N 2.64Å
45	E	56.9	Low	55.4	Low	181 Å²	181	136.3 Å²	136.3	85%	0.846	77%	0.765	S	S	*	*			trans	-68.8	83.9	174.2	-52.5	-174.6	160.7	0	0	109.4	A43 K47	A43-E45 VanDerWaalsContact C-N 3.32Å; A43-E45 PolarHBondContact O-N 3.18Å; E45-K47 PolarHBondContact O-N 3.47Å
46	V	48	Very low	55.3	Low	124 Å²	124	136.7 Å²	136.7	75%	0.752	77%	0.767	S	S	*	*			trans	-78.5	88.2	164.3	-174.7	0	0	0	0	108.1	T44 G48	T44-V46 VanDerWaalsContact C-N 3.28Å; T44-V46 HydrophobicContact CG2-CG2 3.95Å; T44-V46 PolarHBondContact O-N 2.64Å; V46-G48 PolarHBondContact O-N 3.21Å; V46-G48 VanDerWaalsContact O-N 3.15Å
47	K	52.8	Low	54.9	Low	208 Å²	208	144.9 Å²	144.9	90%	0.904	80%	0.796	S	S	*	*			trans	-53.1	103	160.3	-179.2	-176.1	-173.7	-170.8	0	110.3	E45	E45-K47 PolarHBondContact O-N 3.47Å
48	G	56.5	Low	54.9	Low	54 Å²	54	140.5 Å²	140.5	56%	0.557	79%	0.79	S	S	*	*			trans	159.8	107	164.5	0	0	0	0	0	113.6	V46	V46-G48 PolarHBondContact O-N 3.21Å; V46-G48 VanDerWaalsContact O-N 3.15Å
49	L	55.7	Low	54.8	Low	174 Å²	174	142.1 Å²	142.1	91%	0.911	80%	0.801	S	S	*	*			trans	143.2	58.4	161.6	-76.8	152	0	0	0	107.3
50	R	55.3	Low	54.2	Low	240 Å²	240	141.6 Å²	141.6	91%	0.906	80%	0.8	S	S	*	*				38.4	104.4	99.4	-96.3	-172.8	175.2	-161.4	-1.5	113.9
51	S	56.3	Low	54.2	Low	113 Å²	113	138.6 Å²	138.6	79%	0.79	80%	0.803	S	S	*	*			trans	60.4	103.8	133.7	51.6	0	0	0	0	119.1
52	A	52	Low	54.3	Low	92 Å²	92	140.2 Å²	140.2	76%	0.76	81%	0.807	S	S	*	*				-164.5	102.5	123.1	0	0	0	0	0	109.2
53	A	57.3	Low	53.9	Low	98 Å²	98	141 Å²	141	81%	0.81	81%	0.809	S	S	*	*			trans	-66.2	143.4	152.3	0	0	0	0	0	107.8
54	P	53.2	Low	53.8	Low	119 Å²	119	145.2 Å²	145.2	77%	0.773	82%	0.818	S	S	*	*				-124.6	112.6	125	33.1	-24.8	0	0	0	107.4
55	D	52.2	Low	53.5	Low	155 Å²	155	147.3 Å²	147.3	83%	0.829	83%	0.825	S	S	*	*				80.7	136.3	85.5	-151.4	13.8	0	0	0	111.9
56	S	52.9	Low	53.3	Low	96 Å²	96	144.5 Å²	144.5	67%	0.671	82%	0.824	S	S	*	*			trans	-48.3	139.5	-169.5	-173.2	0	0	0	0	114.8
57	Q	46.9	Very low	53.7	Low	261 Å²	261	146.4 Å²	146.4	100%	1.22	83%	0.83	S	S	*	*				-169.6	0	117.4	-82.6	-112.4	-41.4	0	0	109.7

Retrieved 57 of 57 residues in 13.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).