A0A087WRC2_MOUSE Loading...

Predicted gene, 49416

AlphaFold DB , UniProt , Accession A0A087WRC2, Species MOUSE (Mus musculus, Mouse), Gene Gm49416, Length 99 aa.

						>A0A087WRC2_MOUSE|A0A087WRC2|Gm49416
MAPPGGKINRPRTELKKKLFKRRRVLSRDRRRKRQVVGAVIDEGLTTKHHLKKRASSARANITLSGKKRRKLLQQIRLAQKEKAAMEVLRSCPKKSRLF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	65.9	Low	65.3	Low	251 Å²	251	127.5 Å²	127.5	100%	1.236	75%	0.754	S	S	*	*				0	117.5	0	-80.6	-177.2	148.6	0	0	108.5
2	A	56.9	Low	65.9	Low	100 Å²	100	133.9 Å²	133.9	83%	0.826	76%	0.755	S	S	*	*			trans	-97	143.1	179.1	0	0	0	0	0	111.2
3	P	62.7	Low	67	Low	112 Å²	112	129.1 Å²	129.1	73%	0.727	73%	0.73	S	S	*	*			trans	-79.4	161.4	-164.3	32.8	-35.6	0	0	0	113.3	G5	P3-G5 PolarHBondContact O-N 2.78Å
4	P	63.9	Low	67.6	Low	139 Å²	139	127.8 Å²	127.8	90%	0.903	72%	0.715	S	S	*	*			trans	-78.5	79.4	-172.1	33.5	-34.5	0	0	0	111.4
5	G	59.2	Low	68	Low	76 Å²	76	123.9 Å²	123.9	78%	0.784	69%	0.692	S	S	*	*			trans	-105.7	34.8	174.3	0	0	0	0	0	113.4	P3	P3-G5 PolarHBondContact O-N 2.78Å
6	G	66.1	Low	68.6	Low	57 Å²	57	123 Å²	123	59%	0.588	68%	0.678	S	S	*	*			trans	-78.9	122.7	-170.8	0	0	0	0	0	114.1	I8	G6-I8 PolarHBondContact O-N 2.87Å
7	K	64.2	Low	69.5	Low	140 Å²	140	122.7 Å²	122.7	61%	0.609	67%	0.669	S	S	*	*			trans	56.9	42.6	139	-51.3	-176.9	-175	171.1	0	117.2	N9 R10	K7-N9 VanDerWaalsContact C-N 3.26Å; K7-N9 PolarHBondContact O-N 2.73Å; K7-R10 HydrophobicContact CB-CB 4.46Å; K7-R10 HydrophobicContact CB-CG 4.26Å
8	I	65.2	Low	70.4	Confident	137 Å²	137	122.7 Å²	122.7	70%	0.703	66%	0.661	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.7	-37.4	175.6	-59.8	174.9	0	0	0	111.3	G6	G6-I8 PolarHBondContact O-N 2.87Å
9	N	70.9	Confident	71.2	Confident	158 Å²	158	120.6 Å²	120.6	85%	0.845	65%	0.649	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.5	11.8	-170.4	-66.4	-30.1	0	0	0	116.6	K7	K7-N9 VanDerWaalsContact C-N 3.26Å; K7-N9 PolarHBondContact O-N 2.73Å
10	R	71.7	Confident	72	Confident	163 Å²	163	122.8 Å²	122.8	62%	0.615	65%	0.653	S	S	*	*	S	Bend	trans	-87.6	142.9	-177.3	-64.8	-174.3	-172.2	162.4	10	112.2	K7 R12	K7-R10 HydrophobicContact CB-CB 4.46Å; K7-R10 HydrophobicContact CB-CG 4.26Å; R10-R12 PolarHBondContact O-N 3.37Å
11	P	71.6	Confident	72.8	Confident	70 Å²	70	123 Å²	123	46%	0.455	65%	0.648	S	S	.	*			trans	-63.7	112.4	179.4	23.4	-31.4	0	0	0	110.9	T13 K16 K17	P11-T13 PolarHBondContact O-N 2.9Å; P11-K16 HydrophobicContact CB-CB 3.79Å; P11-K17 HydrophobicContact CB-CG 4.22Å; P11-K17 HydrophobicContact CG-CG 4.13Å
12	R	72.8	Confident	73.8	Confident	204 Å²	204	116.2 Å²	116.2	77%	0.77	61%	0.609	S	S	*	*			trans	-73.5	-19.5	-171.3	-61.6	-175	177	-176	-2.6	115.4	R10	R10-R12 PolarHBondContact O-N 3.37Å
13	T	79.8	Confident	75.4	Confident	71 Å²	71	118.9 Å²	118.9	44%	0.436	60%	0.597	S	S	.	*	S	Bend	trans	-128.9	153.9	-173.8	65	0	0	0	0	113.2	P11 L15 K16 K17	P11-T13 PolarHBondContact O-N 2.9Å; T13-L15 PolarHBondContact O-N 3.26Å; T13-L15 VanDerWaalsContact O-N 3.16Å; T13-K16 WeakPolarHBondContact O-CA 3.36Å; T13-K16 PolarHBondContact O-N 3.03Å; T13-K16 WeakPolarHBondContact OG1-CG 3.5Å; T13-K16 PolarHBondContact OG1-N 3.02Å; T13-K17 WeakPolarHBondContact O-CG 3.36Å; T13-K17 PolarHBondContact O-N 3.46Å
14	E	76.1	Confident	76.6	Confident	111 Å²	111	122.2 Å²	122.2	52%	0.519	60%	0.595	S	S	.	*	H	α-helix	trans	-54.1	-34.1	178.8	-68.6	-55.1	123.5	0	0	113.7	K17 K18	E14-K17 IonicContact OE1-NZ 2.74Å; E14-K17 PolarHBondContact OE1-NZ 2.86Å; E14-K18 PolarHBondContact O-N 3.46Å; E14-K18 VanDerWaalsContact O-N 3.11Å
15	L	74	Confident	77.8	Confident	70 Å²	70	117.4 Å²	117.4	37%	0.366	56%	0.564	S	S	.	*	H	α-helix	trans	-72.2	-38.9	173.7	-75.5	173.3	0	0	0	112.6	T13 K17 K18 K21 R22 V25	T13-L15 PolarHBondContact O-N 3.26Å; T13-L15 VanDerWaalsContact O-N 3.16Å; L15-K17 VanDerWaalsContact C-N 3.31Å; L15-K18 CarbonylContact O-C 3.14Å; L15-K18 PolarHBondContact O-N 3.5Å; L15-K21 HydrophobicContact CD2-CB 4.16Å; L15-K21 HydrophobicContact CD2-CD 4Å; L15-K21 HydrophobicContact CD2-CG 3.83Å; L15-R22 HydrophobicContact CB-CB 4.28Å; L15-R22 VanDerWaalsContact O-CB 3.25Å; L15-R22 WeakPolarHBondContact O-CB 3.47Å; L15-V25 HydrophobicContact CD2-CG2 4.4Å
16	K	77.6	Confident	79.1	Confident	109 Å²	109	116.9 Å²	116.9	47%	0.474	54%	0.542	S	S	.	.	H	α-helix	trans	-70.2	-31	177.3	-76	-177.6	176.8	-176.7	0	111.9	P11 T13	P11-K16 HydrophobicContact CB-CB 3.79Å; T13-K16 WeakPolarHBondContact O-CA 3.36Å; T13-K16 PolarHBondContact O-N 3.03Å; T13-K16 WeakPolarHBondContact OG1-CG 3.5Å; T13-K16 PolarHBondContact OG1-N 3.02Å
17	K	83.8	Confident	80	Confident	118 Å²	118	116.3 Å²	116.3	51%	0.513	53%	0.529	S	S	.	.	H	α-helix	trans	-64.9	-41.3	169.5	-64.7	175.8	-172.4	173.1	0	111.1	P11 T13 E14 L15 L19	P11-K17 HydrophobicContact CB-CG 4.22Å; P11-K17 HydrophobicContact CG-CG 4.13Å; T13-K17 WeakPolarHBondContact O-CG 3.36Å; T13-K17 PolarHBondContact O-N 3.46Å; E14-K17 IonicContact OE1-NZ 2.74Å; E14-K17 PolarHBondContact OE1-NZ 2.86Å; L15-K17 VanDerWaalsContact C-N 3.31Å; K17-L19 PolarHBondContact O-N 3.05Å
18	K	85.6	Confident	80.9	Confident	122 Å²	122	116.3 Å²	116.3	53%	0.53	53%	0.526	S	S	.	.	S	Bend	trans	-99	75.7	178.9	-61.8	179.1	-176.7	178.6	0	111.3	E14 L15 F20 K21 R22	E14-K18 PolarHBondContact O-N 3.46Å; E14-K18 VanDerWaalsContact O-N 3.11Å; L15-K18 CarbonylContact O-C 3.14Å; L15-K18 PolarHBondContact O-N 3.5Å; K18-F20 VanDerWaalsContact C-N 3.27Å; K18-F20 PolarHBondContact O-N 2.98Å; K18-F20 VanDerWaalsContact O-N 3.12Å; K18-K21 HydrophobicContact CB-CB 4.08Å; K18-K21 WeakPolarHBondContact O-CB 3.48Å; K18-K21 PolarHBondContact O-N 3.49Å; K18-R22 PolarHBondContact O-N 3Å; K18-R22 VanDerWaalsContact O-N 3.14Å
19	L	84.5	Confident	81.4	Confident	84 Å²	84	113.4 Å²	113.4	44%	0.44	51%	0.512	S	S	.	.	H	α-helix	trans	-49	-43.6	-171.9	-170.5	149.1	0	0	0	113.9	K17 R22 R23	K17-L19 PolarHBondContact O-N 3.05Å; L19-R22 PolarHBondContact O-N 3.5Å; L19-R23 HydrophobicContact CD2-CG 4.42Å; L19-R23 PolarHBondContact O-N 3.27Å
20	F	87.8	Confident	82	Confident	164 Å²	164	112.8 Å²	112.8	72%	0.719	50%	0.497	S	S	*	.	H	α-helix	trans	-66.6	-37.9	179.2	-64.4	-66.4	0	0	0	112.9	K18 R22 R23 R24	K18-F20 VanDerWaalsContact C-N 3.27Å; K18-F20 PolarHBondContact O-N 2.98Å; K18-F20 VanDerWaalsContact O-N 3.12Å; F20-R22 VanDerWaalsContact C-N 3.33Å; F20-R22 PolarHBondContact O-N 3.39Å; F20-R23 PolarHBondContact O-N 3.14Å; F20-R24 WeakPolarHBondContact O-CB 3.43Å; F20-R24 PolarHBondContact O-N 2.95Å
21	K	89.9	Confident	82	Confident	126 Å²	126	113.5 Å²	113.5	55%	0.548	50%	0.5	S	S	.	.	H	α-helix	trans	-67.4	-36.3	176	-162.4	177.2	-177.1	179.7	0	111.2	L15 K18 R24 V25	L15-K21 HydrophobicContact CD2-CB 4.16Å; L15-K21 HydrophobicContact CD2-CD 4Å; L15-K21 HydrophobicContact CD2-CG 3.83Å; K18-K21 HydrophobicContact CB-CB 4.08Å; K18-K21 WeakPolarHBondContact O-CB 3.48Å; K18-K21 PolarHBondContact O-N 3.49Å; K21-R24 PolarHBondContact O-N 3.47Å; K21-V25 WeakPolarHBondContact O-CG2 3.36Å; K21-V25 PolarHBondContact O-N 3.16Å
22	R	86.1	Confident	82	Confident	109 Å²	109	119.3 Å²	119.3	41%	0.411	51%	0.513	S	S	.	.	H	α-helix	trans	-64	-49.4	174.6	175.2	172.9	179.5	-99.2	-3.2	112.6	L15 K18 L19 F20 R24 V25 L26	L15-R22 HydrophobicContact CB-CB 4.28Å; L15-R22 VanDerWaalsContact O-CB 3.25Å; L15-R22 WeakPolarHBondContact O-CB 3.47Å; K18-R22 PolarHBondContact O-N 3Å; K18-R22 VanDerWaalsContact O-N 3.14Å; L19-R22 PolarHBondContact O-N 3.5Å; F20-R22 VanDerWaalsContact C-N 3.33Å; F20-R22 PolarHBondContact O-N 3.39Å; R22-R24 VanDerWaalsContact C-N 3.25Å; R22-R24 PolarHBondContact O-N 2.93Å; R22-V25 PolarHBondContact O-N 3.37Å; R22-L26 HydrophobicContact CG-CD1 3.78Å; R22-L26 HydrophobicContact CG-CG 4.47Å; R22-L26 WeakPolarHBondContact O-CB 3.48Å; R22-L26 VanDerWaalsContact O-CG 3.24Å; R22-L26 WeakPolarHBondContact O-CG 3.49Å; R22-L26 PolarHBondContact O-N 3.48Å
23	R	90.6	Very high	81.4	Confident	157 Å²	157	117.1 Å²	117.1	59%	0.592	51%	0.509	S	S	*	.	H	α-helix	trans	-59.1	-40.6	175.3	-72.6	-176.6	177.1	-178.3	1	111.3	L19 F20 L26 S27	L19-R23 HydrophobicContact CD2-CG 4.42Å; L19-R23 PolarHBondContact O-N 3.27Å; F20-R23 PolarHBondContact O-N 3.14Å; R23-L26 PolarHBondContact O-N 3.36Å; R23-S27 WeakPolarHBondContact O-CB 3.44Å; R23-S27 PolarHBondContact O-N 2.99Å; R23-S27 PolarHBondContact O-OG 3.32Å
24	R	86.9	Confident	81	Confident	181 Å²	181	122.5 Å²	122.5	68%	0.683	52%	0.521	S	S	*	.	H	α-helix	trans	-61.4	-44.9	178.3	-170.2	-177.5	-67.8	-175.8	-1.4	112.9	F20 K21 R22 R28	F20-R24 WeakPolarHBondContact O-CB 3.43Å; F20-R24 PolarHBondContact O-N 2.95Å; K21-R24 PolarHBondContact O-N 3.47Å; R22-R24 VanDerWaalsContact C-N 3.25Å; R22-R24 PolarHBondContact O-N 2.93Å; R24-R28 WeakPolarHBondContact O-CB 3.48Å; R24-R28 PolarHBondContact O-N 3.04Å; R24-R28 VanDerWaalsContact O-N 3.13Å
25	V	89.4	Confident	80.7	Confident	39 Å²	39	121.9 Å²	121.9	24%	0.236	52%	0.518	C	S	.	.	H	α-helix	trans	-65.5	-45.7	175.3	171.9	0	0	0	0	110.7	L15 K21 R22 S27 R28 D29	L15-V25 HydrophobicContact CD2-CG2 4.4Å; K21-V25 WeakPolarHBondContact O-CG2 3.36Å; K21-V25 PolarHBondContact O-N 3.16Å; R22-V25 PolarHBondContact O-N 3.37Å; V25-S27 VanDerWaalsContact C-N 3.34Å; V25-S27 PolarHBondContact O-N 3.08Å; V25-R28 PolarHBondContact O-N 3.41Å; V25-D29 PolarHBondContact O-N 3.1Å
26	L	86.7	Confident	80.3	Confident	65 Å²	65	121.1 Å²	121.1	34%	0.34	52%	0.517	S	S	.	.	H	α-helix	trans	-62	-39.7	-179	-72	169.7	0	0	0	112.8	R22 R23 R30	R22-L26 HydrophobicContact CG-CD1 3.78Å; R22-L26 HydrophobicContact CG-CG 4.47Å; R22-L26 WeakPolarHBondContact O-CB 3.48Å; R22-L26 VanDerWaalsContact O-CG 3.24Å; R22-L26 WeakPolarHBondContact O-CG 3.49Å; R22-L26 PolarHBondContact O-N 3.48Å; R23-L26 PolarHBondContact O-N 3.36Å; L26-R30 WeakPolarHBondContact O-CG 3.42Å; L26-R30 PolarHBondContact O-N 2.95Å
27	S	85.9	Confident	79.5	Confident	45 Å²	45	119.6 Å²	119.6	32%	0.315	52%	0.516	S	S	.	.	H	α-helix	trans	-74.6	-33.3	177.6	-68.1	0	0	0	0	112.8	R23 V25 R30 R31	R23-S27 WeakPolarHBondContact O-CB 3.44Å; R23-S27 PolarHBondContact O-N 2.99Å; R23-S27 PolarHBondContact O-OG 3.32Å; V25-S27 VanDerWaalsContact C-N 3.34Å; V25-S27 PolarHBondContact O-N 3.08Å; S27-R30 WeakPolarHBondContact O-CB 3.46Å; S27-R30 PolarHBondContact O-N 3.44Å; S27-R31 WeakPolarHBondContact O-CG 3.47Å; S27-R31 PolarHBondContact O-N 2.95Å
28	R	82.4	Confident	78.6	Confident	140 Å²	140	116.1 Å²	116.1	53%	0.528	51%	0.514	S	S	.	.	H	α-helix	trans	-67	-40.8	175.2	-157.7	-168.4	-29.6	158.2	12.9	111	R24 V25 R30 R31 R32	R24-R28 WeakPolarHBondContact O-CB 3.48Å; R24-R28 PolarHBondContact O-N 3.04Å; R24-R28 VanDerWaalsContact O-N 3.13Å; V25-R28 PolarHBondContact O-N 3.41Å; R28-R30 VanDerWaalsContact C-N 3.35Å; R28-R31 PolarHBondContact O-N 3.31Å; R28-R32 PolarHBondContact O-N 2.95Å
29	D	76.1	Confident	77.6	Confident	76 Å²	76	114.2 Å²	114.2	41%	0.406	52%	0.521	S	S	.	.	H	α-helix	trans	-62.3	-42	170.1	-73.4	-16.6	0	0	0	111.1	V25 R31 K33	V25-D29 PolarHBondContact O-N 3.1Å; D29-R31 VanDerWaalsContact C-N 3.28Å; D29-R31 PolarHBondContact O-N 3.29Å; D29-K33 VanDerWaalsContact O-CB 3.22Å; D29-K33 WeakPolarHBondContact O-CB 3.29Å; D29-K33 VanDerWaalsContact O-CD 3.25Å; D29-K33 WeakPolarHBondContact O-CD 3.26Å; D29-K33 WeakPolarHBondContact O-CG 3.31Å; D29-K33 PolarHBondContact O-N 3.48Å
30	R	82.6	Confident	76.8	Confident	145 Å²	145	111.4 Å²	111.4	55%	0.547	51%	0.507	S	S	.	.	H	α-helix	trans	-63.5	-30.3	175.8	-73.2	171.4	-154.7	-170.2	2.5	113.7	L26 S27 R28 R34	L26-R30 WeakPolarHBondContact O-CG 3.42Å; L26-R30 PolarHBondContact O-N 2.95Å; S27-R30 WeakPolarHBondContact O-CB 3.46Å; S27-R30 PolarHBondContact O-N 3.44Å; R28-R30 VanDerWaalsContact C-N 3.35Å; R30-R34 WeakPolarHBondContact O-CG 3.35Å
31	R	71.5	Confident	75.9	Confident	178 Å²	178	109.1 Å²	109.1	67%	0.672	50%	0.501	S	S	*	.	H	α-helix	trans	-88.2	-39.1	-179.2	-72.5	-177.8	-158.6	174.6	4.1	113.3	S27 R28 D29 K33 R34	S27-R31 WeakPolarHBondContact O-CG 3.47Å; S27-R31 PolarHBondContact O-N 2.95Å; R28-R31 PolarHBondContact O-N 3.31Å; D29-R31 VanDerWaalsContact C-N 3.28Å; D29-R31 PolarHBondContact O-N 3.29Å; R31-K33 PolarHBondContact O-N 3.24Å; R31-R34 PolarHBondContact O-N 3.49Å
32	R	71.6	Confident	75.2	Confident	192 Å²	192	103.5 Å²	103.5	73%	0.725	48%	0.477	S	S	*	.	H	α-helix	trans	-59	-27.7	166.2	-104.4	-179.6	177.7	177.8	-2.1	111.6	R28 R34	R28-R32 PolarHBondContact O-N 2.95Å; R32-R34 VanDerWaalsContact C-N 3.26Å; R32-R34 PolarHBondContact O-N 2.94Å
33	K	61.2	Low	74.4	Confident	157 Å²	157	105.3 Å²	105.3	68%	0.683	49%	0.49	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.2	-4.4	170.2	-74.7	171.1	-174.9	-170.4	0	115.4	D29 R31	D29-K33 VanDerWaalsContact O-CB 3.22Å; D29-K33 WeakPolarHBondContact O-CB 3.29Å; D29-K33 VanDerWaalsContact O-CD 3.25Å; D29-K33 WeakPolarHBondContact O-CD 3.26Å; D29-K33 WeakPolarHBondContact O-CG 3.31Å; D29-K33 PolarHBondContact O-N 3.48Å; R31-K33 PolarHBondContact O-N 3.24Å
34	R	70.9	Confident	73.8	Confident	185 Å²	185	101.6 Å²	101.6	70%	0.698	50%	0.501	S	S	*	.	T	Hydrogen-bonded Turn	trans	-125.4	13	-177.2	-68	179.9	-170.2	-179.7	0.4	114.3	R30 R31 R32 A55	R30-R34 WeakPolarHBondContact O-CG 3.35Å; R31-R34 PolarHBondContact O-N 3.49Å; R32-R34 VanDerWaalsContact C-N 3.26Å; R32-R34 PolarHBondContact O-N 2.94Å; R34-A55 CarbonylContact C-O 3.54Å; R34-A55 WeakPolarHBondContact CA-O 3.09Å
35	Q	69.4	Low	73.5	Confident	97 Å²	97	94.2 Å²	94.2	45%	0.453	48%	0.475	S	S	.	.			trans	-95.3	127.1	-170	-88.6	-179.5	-19.6	0	0	115.4	V37 R54 A55 S57 A58	Q35-V37 HydrophobicContact CB-CG2 3.97Å; Q35-R54 CarbonylContact C-O 3.17Å; Q35-A55 PolarHBondContact N-O 3.07Å; Q35-A55 VanDerWaalsContact N-O 3.12Å; Q35-S57 CarbonylContact O-C 3.09Å; Q35-A58 PolarHBondContact O-N 2.64Å
36	V	66.1	Low	73	Confident	55 Å²	55	93 Å²	93	33%	0.333	47%	0.468	S	S	.	.			trans	-74.2	113.3	155	171	0	0	0	0	108.7	L51 R54 A55	V36-L51 WeakPolarHBondContact CG2-O 3.49Å; V36-R54 WeakPolarHBondContact CA-O 3.37Å; V36-R54 HydrophobicContact CB-CB 3.77Å; V36-R54 HydrophobicContact CB-CG 3.89Å; V36-R54 HydrophobicContact CG1-CB 3.58Å; V36-R54 HydrophobicContact CG1-CG 3.61Å; V36-R54 HydrophobicContact CG2-CB 3.76Å; V36-R54 HydrophobicContact CG2-CG 4.43Å; V36-R54 PolarHBondContact N-O 3.06Å; V36-R54 VanDerWaalsContact N-O 3.09Å; V36-A55 VanDerWaalsContact CG2-CA 3.41Å; V36-A55 HydrophobicContact CG2-CB 3.79Å
37	V	60.1	Low	72.7	Confident	76 Å²	76	93.3 Å²	93.3	46%	0.461	47%	0.472	S	S	.	.			trans	-115.3	109.9	178.2	-171.5	0	0	0	0	113	Q35 R54 A58	Q35-V37 HydrophobicContact CB-CG2 3.97Å; V37-R54 PolarHBondContact O-NE 3.3Å; V37-R54 PolarHBondContact O-NH1 2.81Å; V37-A58 HydrophobicContact CB-CB 3.7Å; V37-A58 HydrophobicContact CG2-CB 3.46Å; V37-A58 VanDerWaalsContact CG2-CB 3.46Å
38	G	64.6	Low	72.4	Confident	45 Å²	45	100 Å²	100	46%	0.464	50%	0.495	S	S	.	.	S	Bend	trans	127.2	157.4	171.5	0	0	0	0	0	114.1	V40 R54 I62	G38-V40 PolarHBondContact O-N 3.27Å; G38-R54 PolarHBondContact O-NH1 3Å; G38-R54 VanDerWaalsContact O-NH1 3.08Å; G38-I62 VanDerWaalsContact O-CD1 3.25Å; G38-I62 WeakPolarHBondContact O-CD1 3.36Å
39	A	64.6	Low	72.2	Confident	83 Å²	83	98.2 Å²	98.2	69%	0.686	49%	0.493	S	S	*	.			trans	-62.1	126.2	-175.7	0	0	0	0	0	113.3	I41 I62	A39-I41 PolarHBondContact O-N 3.24Å; A39-I41 VanDerWaalsContact O-N 3.13Å; A39-I62 WeakPolarHBondContact O-CD1 3.45Å
40	V	67.6	Low	72.3	Confident	24 Å²	24	96 Å²	96	15%	0.145	48%	0.48	C	S	.	.			trans	-76.6	95.2	172.6	-172	0	0	0	0	107.2	G38 D42 E43 T46 L51 I62	G38-V40 PolarHBondContact O-N 3.27Å; V40-D42 PolarHBondContact O-N 3.41Å; V40-E43 HydrophobicContact CB-CG 4.02Å; V40-E43 HydrophobicContact CG1-CG 4.15Å; V40-E43 WeakPolarHBondContact O-CG 3.35Å; V40-T46 HydrophobicContact CG1-CG2 3.65Å; V40-T46 VanDerWaalsContact CG1-OG1 3.27Å; V40-T46 WeakPolarHBondContact CG1-OG1 3.47Å; V40-L51 HydrophobicContact CG1-CD2 4.31Å; V40-L51 HydrophobicContact CG2-CD2 3.69Å; V40-I62 HydrophobicContact CB-CD1 3.81Å; V40-I62 HydrophobicContact CG1-CD1 4.32Å; V40-I62 HydrophobicContact CG2-CD1 3.44Å; V40-I62 VanDerWaalsContact CG2-CD1 3.44Å
41	I	70	Confident	72	Confident	117 Å²	117	92.6 Å²	92.6	60%	0.6	47%	0.473	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.4	-30.9	-174.4	-58.4	-178.8	0	0	0	112.2	A39 T63	A39-I41 PolarHBondContact O-N 3.24Å; A39-I41 VanDerWaalsContact O-N 3.13Å; I41-T63 HydrophobicContact CB-CG2 4.03Å; I41-T63 HydrophobicContact CD1-CG2 3.6Å; I41-T63 HydrophobicContact CG1-CG2 3.77Å
42	D	74.6	Confident	72.3	Confident	8 Å²	8	91.3 Å²	91.3	4%	0.043	47%	0.472	C	S	.	.	T	Hydrogen-bonded Turn	trans	-113.7	48.2	-171.7	-60.9	-53.4	0	0	0	112.3	V40 G44 L45 T46 L64 R69	V40-D42 PolarHBondContact O-N 3.41Å; D42-G44 VanDerWaalsContact C-N 3.31Å; D42-G44 PolarHBondContact O-N 3.5Å; D42-G44 VanDerWaalsContact O-N 3.13Å; D42-L45 HydrophobicContact CB-CB 4.28Å; D42-L45 CarbonylContact O-C 3.53Å; D42-L45 WeakPolarHBondContact O-CA 3.25Å; D42-L45 PolarHBondContact O-N 3Å; D42-T46 HydrophobicContact CB-CG2 4.02Å; D42-T46 WeakPolarHBondContact O-CG2 3.21Å; D42-T46 PolarHBondContact O-N 3.03Å; D42-T46 PolarHBondContact O-OG1 3.08Å; D42-L64 HydrophobicContact CB-CD1 4.24Å; D42-L64 HydrophobicContact CB-CG 4.33Å; D42-L64 PolarHBondContact OD2-N 3.47Å; D42-R69 WeakPolarHBondContact OD1-CD 3.33Å; D42-R69 IonicContact OD1-CZ 3.11Å; D42-R69 IonicContact OD1-NE 3.07Å; D42-R69 PolarHBondContact OD1-NE 3.38Å; D42-R69 VanDerWaalsContact OD1-NE 3.07Å; D42-R69 IonicContact OD1-NH1 3.14Å; D42-R69 PolarHBondContact OD1-NH1 3.06Å; D42-R69 VanDerWaalsContact OD1-NH1 3.14Å; D42-R69 IonicContact OD1-NH2 3.87Å
43	E	70.7	Confident	72.6	Confident	146 Å²	146	87.7 Å²	87.7	68%	0.682	46%	0.461	S	S	*	.	T	Hydrogen-bonded Turn	trans	-49.8	-44.7	-169	-58	-166.1	155.2	0	0	114.5	V40 L45 T46	V40-E43 HydrophobicContact CB-CG 4.02Å; V40-E43 HydrophobicContact CG1-CG 4.15Å; V40-E43 WeakPolarHBondContact O-CG 3.35Å; E43-L45 PolarHBondContact O-N 3.13Å; E43-T46 WeakPolarHBondContact CA-OG1 3.27Å; E43-T46 PolarHBondContact O-OG1 3.14Å; E43-T46 VanDerWaalsContact O-OG1 3.06Å
44	G	77.4	Confident	73.1	Confident	79 Å²	79	81.7 Å²	81.7	81%	0.814	43%	0.434	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.9	-9	179.7	0	0	0	0	0	115.3	D42	D42-G44 VanDerWaalsContact C-N 3.31Å; D42-G44 PolarHBondContact O-N 3.5Å; D42-G44 VanDerWaalsContact O-N 3.13Å
45	L	80.6	Confident	73.2	Confident	26 Å²	26	74.5 Å²	74.5	14%	0.136	41%	0.414	C	S	.	.	T	Hydrogen-bonded Turn	trans	-115.7	-20.6	178.7	-58.4	171.4	0	0	0	111.9	D42 E43 T47 L64 R69 L72 L73 I76	D42-L45 HydrophobicContact CB-CB 4.28Å; D42-L45 CarbonylContact O-C 3.53Å; D42-L45 WeakPolarHBondContact O-CA 3.25Å; D42-L45 PolarHBondContact O-N 3Å; E43-L45 PolarHBondContact O-N 3.13Å; L45-T47 PolarHBondContact O-N 3.27Å; L45-L64 HydrophobicContact CB-CD1 3.45Å; L45-L64 VanDerWaalsContact CB-CD1 3.45Å; L45-L64 HydrophobicContact CD1-CD1 4.46Å; L45-R69 HydrophobicContact CD1-CG 3.69Å; L45-L72 HydrophobicContact CB-CD1 4.34Å; L45-L72 HydrophobicContact CD2-CB 3.91Å; L45-L73 HydrophobicContact CD1-CD1 4.29Å; L45-L73 HydrophobicContact CD1-CD2 4.01Å; L45-L73 HydrophobicContact CD1-CG 3.87Å; L45-L73 HydrophobicContact CD2-CD2 4.13Å; L45-L73 HydrophobicContact CD2-CG 4.38Å; L45-I76 HydrophobicContact CD2-CD1 3.63Å
46	T	78.4	Confident	73.3	Confident	15 Å²	15	74.5 Å²	74.5	9%	0.092	43%	0.425	C	S	.	.			trans	-73.8	122.1	177.1	49.4	0	0	0	0	110.6	V40 D42 E43 I62 L64	V40-T46 HydrophobicContact CG1-CG2 3.65Å; V40-T46 VanDerWaalsContact CG1-OG1 3.27Å; V40-T46 WeakPolarHBondContact CG1-OG1 3.47Å; D42-T46 HydrophobicContact CB-CG2 4.02Å; D42-T46 WeakPolarHBondContact O-CG2 3.21Å; D42-T46 PolarHBondContact O-N 3.03Å; D42-T46 PolarHBondContact O-OG1 3.08Å; E43-T46 WeakPolarHBondContact CA-OG1 3.27Å; E43-T46 PolarHBondContact O-OG1 3.14Å; E43-T46 VanDerWaalsContact O-OG1 3.06Å; T46-I62 WeakPolarHBondContact CG2-O 3.2Å; T46-L64 HydrophobicContact CG2-CG 4.31Å
47	T	79.9	Confident	73.6	Confident	70 Å²	70	74.5 Å²	74.5	43%	0.429	43%	0.428	S	S	.	.			trans	-77.8	160.1	-179.9	60.5	0	0	0	0	111.5	L45 H49 H50 L51	L45-T47 PolarHBondContact O-N 3.27Å; T47-H49 PolarHBondContact O-N 3.02Å; T47-H50 WeakPolarHBondContact O-CB 3.5Å; T47-H50 PolarHBondContact O-N 2.78Å; T47-H50 PolarHBondContact OG1-CD2 2.93Å; T47-L51 PolarHBondContact O-N 2.87Å
48	K	80.4	Confident	74.1	Confident	185 Å²	185	73.1 Å²	73.1	80%	0.804	42%	0.424	S	S	*	.	H	α-helix	trans	-46.6	-31.5	170.2	-175.2	177	-178	176.5	0	112.6	L51 K52	K48-L51 PolarHBondContact O-N 2.99Å; K48-K52 WeakPolarHBondContact O-CB 3.39Å; K48-K52 PolarHBondContact O-N 3.48Å
49	H	78.5	Confident	74.4	Confident	103 Å²	103	82.1 Å²	82.1	48%	0.477	44%	0.444	S	S	.	.	H	α-helix	trans	-67	-37.7	176.6	-179	-112	0	0	0	113.3	T47 K53	T47-H49 PolarHBondContact O-N 3.02Å; H49-K53 WeakPolarHBondContact CE1-CE 3.45Å; H49-K53 PolarHBondContact CE1-NZ 3.42Å; H49-K53 WeakPolarHBondContact NE2-CE 3.5Å; H49-K53 WeakPolarHBondContact O-CB 3.44Å; H49-K53 VanDerWaalsContact O-CG 3.32Å; H49-K53 WeakPolarHBondContact O-CG 3.43Å; H49-K53 PolarHBondContact O-N 3.46Å
50	H	78.1	Confident	75	Confident	30 Å²	30	79.3 Å²	79.3	14%	0.139	42%	0.421	C	S	.	.	H	α-helix	trans	-68.5	-37.9	175.1	-64.5	-38.3	0	0	0	111.9	T47 K53 R54 L64 K68	T47-H50 WeakPolarHBondContact O-CB 3.5Å; T47-H50 PolarHBondContact O-N 2.78Å; T47-H50 PolarHBondContact OG1-CD2 2.93Å; H50-K53 PolarHBondContact O-N 3.13Å; H50-R54 PolarHBondContact O-N 3.14Å; H50-L64 WeakPolarHBondContact NE2-CD2 3.45Å; H50-K68 PolarHBondContact NE2-NZ 3.49Å
51	L	75	Confident	75.2	Confident	74 Å²	74	83.9 Å²	83.9	39%	0.387	45%	0.445	S	S	.	.	H	α-helix	trans	-68.9	-43.1	175.7	-60.5	176.1	0	0	0	112	V36 V40 T47 K48 K53 R54 A55	V36-L51 WeakPolarHBondContact CG2-O 3.49Å; V40-L51 HydrophobicContact CG1-CD2 4.31Å; V40-L51 HydrophobicContact CG2-CD2 3.69Å; T47-L51 PolarHBondContact O-N 2.87Å; K48-L51 PolarHBondContact O-N 2.99Å; L51-K53 VanDerWaalsContact C-N 3.28Å; L51-K53 PolarHBondContact O-N 3.43Å; L51-R54 PolarHBondContact O-N 2.95Å; L51-A55 PolarHBondContact O-N 3.41Å
52	K	79.3	Confident	75.5	Confident	151 Å²	151	78.4 Å²	78.4	66%	0.657	42%	0.417	S	S	*	.	H	α-helix	trans	-62	-37.1	174.3	-168.1	176.1	-178.7	-177.9	0	111.7	K48 R54 A55 S56	K48-K52 WeakPolarHBondContact O-CB 3.39Å; K48-K52 PolarHBondContact O-N 3.48Å; K52-R54 VanDerWaalsContact C-N 3.34Å; K52-R54 PolarHBondContact O-N 3.48Å; K52-A55 PolarHBondContact O-N 3.06Å; K52-S56 PolarHBondContact O-N 3.34Å; K52-S56 PolarHBondContact O-OG 3.05Å
53	K	76.6	Confident	75.6	Confident	116 Å²	116	80.3 Å²	80.3	50%	0.504	43%	0.429	S	S	.	.	H	α-helix	trans	-63.4	-37.6	177.6	-85.5	-176.2	169	-173.9	0	113	H49 H50 L51 S57	H49-K53 WeakPolarHBondContact CE1-CE 3.45Å; H49-K53 PolarHBondContact CE1-NZ 3.42Å; H49-K53 WeakPolarHBondContact NE2-CE 3.5Å; H49-K53 WeakPolarHBondContact O-CB 3.44Å; H49-K53 VanDerWaalsContact O-CG 3.32Å; H49-K53 WeakPolarHBondContact O-CG 3.43Å; H49-K53 PolarHBondContact O-N 3.46Å; H50-K53 PolarHBondContact O-N 3.13Å; L51-K53 VanDerWaalsContact C-N 3.28Å; L51-K53 PolarHBondContact O-N 3.43Å; K53-S57 PolarHBondContact O-N 3.29Å
54	R	73.3	Confident	76	Confident	30 Å²	30	74 Å²	74	11%	0.113	40%	0.4	C	S	.	.	H	α-helix	trans	-82.8	-27.2	177.3	-151.9	-170.8	-126.2	-177.4	-4.5	111.6	Q35 V36 V37 G38 H50 L51 K52 S56 S57 A60 I62	Q35-R54 CarbonylContact C-O 3.17Å; V36-R54 WeakPolarHBondContact CA-O 3.37Å; V36-R54 HydrophobicContact CB-CB 3.77Å; V36-R54 HydrophobicContact CB-CG 3.89Å; V36-R54 HydrophobicContact CG1-CB 3.58Å; V36-R54 HydrophobicContact CG1-CG 3.61Å; V36-R54 HydrophobicContact CG2-CB 3.76Å; V36-R54 HydrophobicContact CG2-CG 4.43Å; V36-R54 PolarHBondContact N-O 3.06Å; V36-R54 VanDerWaalsContact N-O 3.09Å; V37-R54 PolarHBondContact O-NE 3.3Å; V37-R54 PolarHBondContact O-NH1 2.81Å; G38-R54 PolarHBondContact O-NH1 3Å; G38-R54 VanDerWaalsContact O-NH1 3.08Å; H50-R54 PolarHBondContact O-N 3.14Å; L51-R54 PolarHBondContact O-N 2.95Å; K52-R54 VanDerWaalsContact C-N 3.34Å; K52-R54 PolarHBondContact O-N 3.48Å; R54-S56 PolarHBondContact O-N 3.09Å; R54-S56 VanDerWaalsContact O-N 3.11Å; R54-S57 WeakPolarHBondContact CA-O 3.07Å; R54-S57 WeakPolarHBondContact CG-O 3.43Å; R54-S57 CarbonylContact O-C 2.69Å; R54-S57 PolarHBondContact O-N 2.77Å; R54-A60 HydrophobicContact CB-CB 4.39Å; R54-A60 HydrophobicContact CG-CB 4.22Å; R54-A60 PolarHBondContact NE-O 3.33Å; R54-A60 PolarHBondContact NH2-O 2.94Å; R54-I62 HydrophobicContact CB-CG2 3.38Å; R54-I62 HydrophobicContact CG-CG2 3.67Å; R54-I62 VanDerWaalsContact CZ-CG1 3.49Å
55	A	73.1	Confident	76.3	Confident	34 Å²	34	74.4 Å²	74.4	28%	0.281	39%	0.39	S	S	.	.	H	α-helix	trans	-60.3	-27.3	172.8	0	0	0	0	0	111.1	R34 Q35 V36 L51 K52	R34-A55 CarbonylContact C-O 3.54Å; R34-A55 WeakPolarHBondContact CA-O 3.09Å; Q35-A55 PolarHBondContact N-O 3.07Å; Q35-A55 VanDerWaalsContact N-O 3.12Å; V36-A55 VanDerWaalsContact CG2-CA 3.41Å; V36-A55 HydrophobicContact CG2-CB 3.79Å; L51-A55 PolarHBondContact O-N 3.41Å; K52-A55 PolarHBondContact O-N 3.06Å
56	S	70.6	Confident	76.6	Confident	98 Å²	98	75.4 Å²	75.4	69%	0.685	41%	0.406	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.2	-17.4	172.7	-55.7	0	0	0	0	114.1	K52 R54	K52-S56 PolarHBondContact O-N 3.34Å; K52-S56 PolarHBondContact O-OG 3.05Å; R54-S56 PolarHBondContact O-N 3.09Å; R54-S56 VanDerWaalsContact O-N 3.11Å
57	S	72.6	Confident	77.2	Confident	55 Å²	55	82.2 Å²	82.2	39%	0.385	44%	0.435	S	S	.	.			trans	-155.8	121.3	-174.9	177.4	0	0	0	0	113.7	Q35 K53 R54 R59 A60	Q35-S57 CarbonylContact O-C 3.09Å; K53-S57 PolarHBondContact O-N 3.29Å; R54-S57 WeakPolarHBondContact CA-O 3.07Å; R54-S57 WeakPolarHBondContact CG-O 3.43Å; R54-S57 CarbonylContact O-C 2.69Å; R54-S57 PolarHBondContact O-N 2.77Å; S57-R59 VanDerWaalsContact C-N 3.26Å; S57-R59 PolarHBondContact O-N 3.42Å; S57-A60 PolarHBondContact O-N 2.82Å
58	A	71.1	Confident	77.5	Confident	47 Å²	47	83.4 Å²	83.4	39%	0.388	43%	0.434	S	S	.	.	T	Hydrogen-bonded Turn	trans	-56.9	-33.8	176.5	0	0	0	0	0	113.8	Q35 V37	Q35-A58 PolarHBondContact O-N 2.64Å; V37-A58 HydrophobicContact CB-CB 3.7Å; V37-A58 HydrophobicContact CG2-CB 3.46Å; V37-A58 VanDerWaalsContact CG2-CB 3.46Å
59	R	71.3	Confident	77.8	Confident	233 Å²	233	79.9 Å²	79.9	88%	0.879	42%	0.416	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.9	-11.6	-174.9	-67	176.7	69.3	-172.3	2.9	114	S57 N61	S57-R59 VanDerWaalsContact C-N 3.26Å; S57-R59 PolarHBondContact O-N 3.42Å; R59-N61 PolarHBondContact O-N 3Å
60	A	75.1	Confident	78.4	Confident	25 Å²	25	84.2 Å²	84.2	21%	0.207	43%	0.428	C	S	.	.	S	Bend	trans	-59	135.3	-173.9	0	0	0	0	0	110.5	R54 S57 I62	R54-A60 HydrophobicContact CB-CB 4.39Å; R54-A60 HydrophobicContact CG-CB 4.22Å; R54-A60 PolarHBondContact NE-O 3.33Å; R54-A60 PolarHBondContact NH2-O 2.94Å; S57-A60 PolarHBondContact O-N 2.82Å; A60-I62 PolarHBondContact O-N 2.69Å
61	N	73.5	Confident	79.1	Confident	119 Å²	119	88.8 Å²	88.8	64%	0.636	45%	0.447	S	S	*	.			trans	-71.8	122.6	175.9	-169.1	-44.2	0	0	0	109.3	R59 T63	R59-N61 PolarHBondContact O-N 3Å; N61-T63 PolarHBondContact ND2-OG1 3.34Å; N61-T63 WeakPolarHBondContact OD1-CA 3.17Å; N61-T63 WeakPolarHBondContact OD1-CB 3.44Å; N61-T63 PolarHBondContact OD1-N 3.45Å; N61-T63 PolarHBondContact OD1-O 3.09Å; N61-T63 PolarHBondContact OD1-OG1 2.88Å
62	I	75	Confident	79.8	Confident	2 Å²	2	87.5 Å²	87.5	1%	0.01	44%	0.441	C	S	.	.			trans	-103	-11.7	176.9	53.8	176.5	0	0	0	113.6	G38 A39 V40 T46 R54 A60	G38-I62 VanDerWaalsContact O-CD1 3.25Å; G38-I62 WeakPolarHBondContact O-CD1 3.36Å; A39-I62 WeakPolarHBondContact O-CD1 3.45Å; V40-I62 HydrophobicContact CB-CD1 3.81Å; V40-I62 HydrophobicContact CG1-CD1 4.32Å; V40-I62 HydrophobicContact CG2-CD1 3.44Å; V40-I62 VanDerWaalsContact CG2-CD1 3.44Å; T46-I62 WeakPolarHBondContact CG2-O 3.2Å; R54-I62 HydrophobicContact CB-CG2 3.38Å; R54-I62 HydrophobicContact CG-CG2 3.67Å; R54-I62 VanDerWaalsContact CZ-CG1 3.49Å; A60-I62 PolarHBondContact O-N 2.69Å
63	T	77.9	Confident	80.3	Confident	49 Å²	49	83.4 Å²	83.4	30%	0.301	43%	0.426	S	S	.	.	S	Bend	trans	-77.1	143.5	178.4	64.2	0	0	0	0	108.8	I41 N61	I41-T63 HydrophobicContact CB-CG2 4.03Å; I41-T63 HydrophobicContact CD1-CG2 3.6Å; I41-T63 HydrophobicContact CG1-CG2 3.77Å; N61-T63 PolarHBondContact ND2-OG1 3.34Å; N61-T63 WeakPolarHBondContact OD1-CA 3.17Å; N61-T63 WeakPolarHBondContact OD1-CB 3.44Å; N61-T63 PolarHBondContact OD1-N 3.45Å; N61-T63 PolarHBondContact OD1-O 3.09Å; N61-T63 PolarHBondContact OD1-OG1 2.88Å
64	L	77.8	Confident	81.1	Confident	14 Å²	14	83.5 Å²	83.5	7%	0.073	43%	0.428	C	S	.	.	P	Polyproline II helix	trans	-80	141.6	174.2	-61.5	176.2	0	0	0	108.8	D42 L45 T46 H50 G66 K68 R69 L72	D42-L64 HydrophobicContact CB-CD1 4.24Å; D42-L64 HydrophobicContact CB-CG 4.33Å; D42-L64 PolarHBondContact OD2-N 3.47Å; L45-L64 HydrophobicContact CB-CD1 3.45Å; L45-L64 VanDerWaalsContact CB-CD1 3.45Å; L45-L64 HydrophobicContact CD1-CD1 4.46Å; T46-L64 HydrophobicContact CG2-CG 4.31Å; H50-L64 WeakPolarHBondContact NE2-CD2 3.45Å; L64-G66 PolarHBondContact O-N 2.97Å; L64-K68 HydrophobicContact CD2-CD 3.92Å; L64-K68 HydrophobicContact CD2-CG 4.48Å; L64-R69 HydrophobicContact CB-CB 4.25Å; L64-L72 HydrophobicContact CD1-CD1 3.8Å
65	S	84.9	Confident	82	Confident	86 Å²	86	87.9 Å²	87.9	60%	0.601	45%	0.45	S	S	*	.	P	Polyproline II helix	trans	-55.2	141.2	166	170.4	0	0	0	0	109.6	K67 K68 R69	S65-K67 PolarHBondContact O-N 3.09Å; S65-K67 VanDerWaalsContact O-N 3.09Å; S65-K68 WeakPolarHBondContact O-CA 3.46Å; S65-K68 WeakPolarHBondContact O-CB 3.34Å; S65-K68 PolarHBondContact O-N 3.08Å; S65-R69 PolarHBondContact O-N 2.91Å
66	G	86.9	Confident	82.9	Confident	47 Å²	47	89.8 Å²	89.8	49%	0.485	45%	0.454	S	S	.	.	H	α-helix	trans	-52.7	-36.8	-176.4	0	0	0	0	0	113.7	L64 R69 R70	L64-G66 PolarHBondContact O-N 2.97Å; G66-R69 PolarHBondContact O-N 3.28Å; G66-R70 WeakPolarHBondContact O-CB 3.46Å; G66-R70 PolarHBondContact O-N 3.41Å
67	K	90.6	Very high	84	Confident	158 Å²	158	93 Å²	93	69%	0.687	45%	0.451	S	S	*	.	H	α-helix	trans	-63.7	-43.2	175.3	-174.3	175.4	-178.1	175.9	0	112.1	S65 R70 K71	S65-K67 PolarHBondContact O-N 3.09Å; S65-K67 VanDerWaalsContact O-N 3.09Å; K67-R70 PolarHBondContact O-N 3.23Å; K67-K71 PolarHBondContact O-N 3.31Å; K67-K71 VanDerWaalsContact O-N 3.08Å
68	K	86.1	Confident	85.1	Confident	96 Å²	96	94.7 Å²	94.7	42%	0.417	46%	0.456	S	S	.	.	H	α-helix	trans	-68.4	-43.6	179	-175.4	173.6	175.3	-169.2	0	111	H50 L64 S65 R70 K71 L72	H50-K68 PolarHBondContact NE2-NZ 3.49Å; L64-K68 HydrophobicContact CD2-CD 3.92Å; L64-K68 HydrophobicContact CD2-CG 4.48Å; S65-K68 WeakPolarHBondContact O-CA 3.46Å; S65-K68 WeakPolarHBondContact O-CB 3.34Å; S65-K68 PolarHBondContact O-N 3.08Å; K68-R70 VanDerWaalsContact C-N 3.34Å; K68-R70 PolarHBondContact O-N 3.38Å; K68-K71 PolarHBondContact O-N 3.44Å; K68-L72 HydrophobicContact CG-CD1 4.18Å; K68-L72 WeakPolarHBondContact O-CG 3.41Å; K68-L72 PolarHBondContact O-N 3.38Å
69	R	86.5	Confident	86.2	Confident	111 Å²	111	95 Å²	95	42%	0.419	46%	0.458	S	S	.	.	H	α-helix	trans	-55.6	-49.3	173.8	-175.1	-179.7	176.2	172.6	-3.2	111.2	D42 L45 L64 S65 G66 K71 L72 L73	D42-R69 WeakPolarHBondContact OD1-CD 3.33Å; D42-R69 IonicContact OD1-CZ 3.11Å; D42-R69 IonicContact OD1-NE 3.07Å; D42-R69 PolarHBondContact OD1-NE 3.38Å; D42-R69 VanDerWaalsContact OD1-NE 3.07Å; D42-R69 IonicContact OD1-NH1 3.14Å; D42-R69 PolarHBondContact OD1-NH1 3.06Å; D42-R69 VanDerWaalsContact OD1-NH1 3.14Å; D42-R69 IonicContact OD1-NH2 3.87Å; L45-R69 HydrophobicContact CD1-CG 3.69Å; L64-R69 HydrophobicContact CB-CB 4.25Å; S65-R69 PolarHBondContact O-N 2.91Å; G66-R69 PolarHBondContact O-N 3.28Å; R69-K71 PolarHBondContact O-N 3.39Å; R69-L72 PolarHBondContact O-N 3.46Å; R69-L73 HydrophobicContact CG-CD1 4.09Å; R69-L73 WeakPolarHBondContact O-CG 3.36Å; R69-L73 PolarHBondContact O-N 3.24Å; R69-L73 VanDerWaalsContact O-N 3.09Å
70	R	91.4	Very high	87.2	Confident	194 Å²	194	89.8 Å²	89.8	73%	0.732	44%	0.444	S	S	*	.	H	α-helix	trans	-59.5	-46.7	178.6	-171.3	-175	-61	171.3	0.5	112.5	G66 K67 K68 L73 Q74	G66-R70 WeakPolarHBondContact O-CB 3.46Å; G66-R70 PolarHBondContact O-N 3.41Å; K67-R70 PolarHBondContact O-N 3.23Å; K68-R70 VanDerWaalsContact C-N 3.34Å; K68-R70 PolarHBondContact O-N 3.38Å; R70-L73 PolarHBondContact O-N 2.93Å; R70-Q74 WeakPolarHBondContact O-CB 3.36Å; R70-Q74 PolarHBondContact O-N 3.12Å
71	K	92.7	Very high	88.1	Confident	126 Å²	126	95.9 Å²	95.9	55%	0.548	47%	0.466	S	S	.	.	H	α-helix	trans	-63.7	-42.9	179.9	-77.1	-148.1	173.9	-165.5	0	112.8	K67 K68 R69 Q74 Q75	K67-K71 PolarHBondContact O-N 3.31Å; K67-K71 VanDerWaalsContact O-N 3.08Å; K68-K71 PolarHBondContact O-N 3.44Å; R69-K71 PolarHBondContact O-N 3.39Å; K71-Q74 WeakPolarHBondContact O-CB 3.25Å; K71-Q74 PolarHBondContact O-N 3.49Å; K71-Q75 WeakPolarHBondContact O-CG 3.46Å; K71-Q75 PolarHBondContact O-N 3Å
72	L	89.3	Confident	89	Confident	47 Å²	47	96.5 Å²	96.5	25%	0.246	47%	0.465	C	S	.	.	H	α-helix	trans	-64.8	-42.3	178.5	-70.1	170.5	0	0	0	111.6	L45 L64 K68 R69 Q74 Q75 I76	L45-L72 HydrophobicContact CB-CD1 4.34Å; L45-L72 HydrophobicContact CD2-CB 3.91Å; L64-L72 HydrophobicContact CD1-CD1 3.8Å; K68-L72 HydrophobicContact CG-CD1 4.18Å; K68-L72 WeakPolarHBondContact O-CG 3.41Å; K68-L72 PolarHBondContact O-N 3.38Å; R69-L72 PolarHBondContact O-N 3.46Å; L72-Q74 VanDerWaalsContact C-N 3.29Å; L72-Q74 PolarHBondContact O-N 3.14Å; L72-Q75 PolarHBondContact O-N 3.47Å; L72-I76 WeakPolarHBondContact O-CG1 3.39Å; L72-I76 PolarHBondContact O-N 3.05Å
73	L	90.4	Very high	89.8	Confident	65 Å²	65	103.5 Å²	103.5	34%	0.34	50%	0.495	S	S	.	.	H	α-helix	trans	-62.1	-38.1	174.6	-72.2	170.1	0	0	0	112.1	L45 R69 R70 I76 R77	L45-L73 HydrophobicContact CD1-CD1 4.29Å; L45-L73 HydrophobicContact CD1-CD2 4.01Å; L45-L73 HydrophobicContact CD1-CG 3.87Å; L45-L73 HydrophobicContact CD2-CD2 4.13Å; L45-L73 HydrophobicContact CD2-CG 4.38Å; R69-L73 HydrophobicContact CG-CD1 4.09Å; R69-L73 WeakPolarHBondContact O-CG 3.36Å; R69-L73 PolarHBondContact O-N 3.24Å; R69-L73 VanDerWaalsContact O-N 3.09Å; R70-L73 PolarHBondContact O-N 2.93Å; L73-I76 PolarHBondContact O-N 3.37Å; L73-R77 VanDerWaalsContact O-CG 3.31Å; L73-R77 WeakPolarHBondContact O-CG 3.22Å; L73-R77 PolarHBondContact O-N 3.13Å
74	Q	93.8	Very high	90.4	Very high	117 Å²	117	103.5 Å²	103.5	55%	0.547	50%	0.5	S	S	.	.	H	α-helix	trans	-64.2	-43.7	176	-172	178.4	22.6	0	0	111.7	R70 K71 L72 R77 L78	R70-Q74 WeakPolarHBondContact O-CB 3.36Å; R70-Q74 PolarHBondContact O-N 3.12Å; K71-Q74 WeakPolarHBondContact O-CB 3.25Å; K71-Q74 PolarHBondContact O-N 3.49Å; L72-Q74 VanDerWaalsContact C-N 3.29Å; L72-Q74 PolarHBondContact O-N 3.14Å; Q74-R77 PolarHBondContact O-N 3.34Å; Q74-L78 HydrophobicContact CG-CD1 4.49Å; Q74-L78 WeakPolarHBondContact O-CG 3.01Å; Q74-L78 PolarHBondContact O-N 3.34Å
75	Q	92.6	Very high	91	Very high	123 Å²	123	105.5 Å²	105.5	58%	0.575	52%	0.519	S	S	*	.	H	α-helix	trans	-62.5	-44.8	177.1	-73.5	176.2	-20.4	0	0	111.9	K71 L72 R77 L78 A79	K71-Q75 WeakPolarHBondContact O-CG 3.46Å; K71-Q75 PolarHBondContact O-N 3Å; L72-Q75 PolarHBondContact O-N 3.47Å; Q75-R77 VanDerWaalsContact C-N 3.31Å; Q75-R77 PolarHBondContact O-N 2.99Å; Q75-L78 PolarHBondContact O-N 3.34Å; Q75-A79 WeakPolarHBondContact O-CB 3.46Å; Q75-A79 PolarHBondContact O-N 3.34Å
76	I	91.9	Very high	90.8	Very high	74 Å²	74	108.3 Å²	108.3	38%	0.379	52%	0.524	S	S	.	.	H	α-helix	trans	-60	-43.4	176.8	-68.5	166.2	0	0	0	110.6	L45 L72 L73 L78 A79 Q80	L45-I76 HydrophobicContact CD2-CD1 3.63Å; L72-I76 WeakPolarHBondContact O-CG1 3.39Å; L72-I76 PolarHBondContact O-N 3.05Å; L73-I76 PolarHBondContact O-N 3.37Å; I76-L78 PolarHBondContact O-N 3.19Å; I76-A79 PolarHBondContact O-N 3.33Å; I76-Q80 HydrophobicContact CG2-CG 4.42Å; I76-Q80 WeakPolarHBondContact O-CB 3.21Å; I76-Q80 VanDerWaalsContact O-CG 3.26Å; I76-Q80 WeakPolarHBondContact O-CG 3.5Å; I76-Q80 PolarHBondContact O-N 3.05Å
77	R	93.7	Very high	90.5	Very high	164 Å²	164	112.1 Å²	112.1	62%	0.619	53%	0.529	S	S	*	.	H	α-helix	trans	-61.6	-42.8	176.8	-74.5	175.3	-171.4	175.2	1.2	112.7	L73 Q74 Q75 Q80 K81	L73-R77 VanDerWaalsContact O-CG 3.31Å; L73-R77 WeakPolarHBondContact O-CG 3.22Å; L73-R77 PolarHBondContact O-N 3.13Å; Q74-R77 PolarHBondContact O-N 3.34Å; Q75-R77 VanDerWaalsContact C-N 3.31Å; Q75-R77 PolarHBondContact O-N 2.99Å; R77-Q80 PolarHBondContact O-N 3.26Å; R77-K81 WeakPolarHBondContact O-CG 3.43Å; R77-K81 PolarHBondContact O-N 2.89Å; R77-K81 VanDerWaalsContact O-N 3.1Å
78	L	95.6	Very high	89.9	Confident	91 Å²	91	109.1 Å²	109.1	48%	0.476	52%	0.524	S	S	.	.	H	α-helix	trans	-64.7	-48.6	178	-71.1	172.5	0	0	0	111	Q74 Q75 I76 Q80 K81 E82	Q74-L78 HydrophobicContact CG-CD1 4.49Å; Q74-L78 WeakPolarHBondContact O-CG 3.01Å; Q74-L78 PolarHBondContact O-N 3.34Å; Q75-L78 PolarHBondContact O-N 3.34Å; I76-L78 PolarHBondContact O-N 3.19Å; L78-Q80 VanDerWaalsContact C-N 3.27Å; L78-Q80 PolarHBondContact O-N 2.88Å; L78-K81 WeakPolarHBondContact O-CB 3.44Å; L78-K81 PolarHBondContact O-N 3.35Å; L78-K81 VanDerWaalsContact O-N 3.08Å; L78-E82 WeakPolarHBondContact O-CG 3.41Å; L78-E82 PolarHBondContact O-N 2.92Å
79	A	93.3	Very high	89.2	Confident	54 Å²	54	111.1 Å²	111.1	45%	0.446	54%	0.539	S	S	.	.	H	α-helix	trans	-59.6	-36.9	177.7	0	0	0	0	0	112.7	Q75 I76 K83	Q75-A79 WeakPolarHBondContact O-CB 3.46Å; Q75-A79 PolarHBondContact O-N 3.34Å; I76-A79 PolarHBondContact O-N 3.33Å; A79-K83 VanDerWaalsContact O-CB 3.29Å; A79-K83 WeakPolarHBondContact O-CB 3.17Å; A79-K83 PolarHBondContact O-N 2.84Å
80	Q	93	Very high	88.3	Confident	123 Å²	123	116.9 Å²	116.9	58%	0.575	56%	0.56	S	S	*	*	H	α-helix	trans	-66.2	-41.7	174.7	-76.8	174.2	-15.3	0	0	112.4	I76 R77 L78 K83 A84	I76-Q80 HydrophobicContact CG2-CG 4.42Å; I76-Q80 WeakPolarHBondContact O-CB 3.21Å; I76-Q80 VanDerWaalsContact O-CG 3.26Å; I76-Q80 WeakPolarHBondContact O-CG 3.5Å; I76-Q80 PolarHBondContact O-N 3.05Å; R77-Q80 PolarHBondContact O-N 3.26Å; L78-Q80 VanDerWaalsContact C-N 3.27Å; L78-Q80 PolarHBondContact O-N 2.88Å; Q80-K83 PolarHBondContact O-N 3.23Å; Q80-A84 WeakPolarHBondContact O-CB 3.32Å; Q80-A84 PolarHBondContact O-N 3.38Å
81	K	93.6	Very high	87.1	Confident	154 Å²	154	111.9 Å²	111.9	67%	0.67	56%	0.555	S	S	*	*	H	α-helix	trans	-63.8	-44.9	175.9	-74.7	-177.8	176.3	-168.1	0	111.8	R77 L78 A84 A85	R77-K81 WeakPolarHBondContact O-CG 3.43Å; R77-K81 PolarHBondContact O-N 2.89Å; R77-K81 VanDerWaalsContact O-N 3.1Å; L78-K81 WeakPolarHBondContact O-CB 3.44Å; L78-K81 PolarHBondContact O-N 3.35Å; L78-K81 VanDerWaalsContact O-N 3.08Å; K81-A84 PolarHBondContact O-N 3.12Å; K81-A85 WeakPolarHBondContact O-CB 3.06Å; K81-A85 PolarHBondContact O-N 3.28Å
82	E	92.2	Very high	85.3	Confident	131 Å²	131	109.7 Å²	109.7	61%	0.612	56%	0.555	S	S	*	*	H	α-helix	trans	-61.7	-45.3	176.9	-71.5	171.2	-174	0	0	111.5	L78 A84 A85 M86	L78-E82 WeakPolarHBondContact O-CG 3.41Å; L78-E82 PolarHBondContact O-N 2.92Å; E82-A84 PolarHBondContact O-N 3.11Å; E82-A85 PolarHBondContact O-N 3.27Å; E82-M86 PolarHBondContact O-N 3.01Å
83	K	92.7	Very high	84	Confident	149 Å²	149	112.9 Å²	112.9	65%	0.648	58%	0.578	S	S	*	*	H	α-helix	trans	-60.4	-45.7	176.5	-172.5	-179.2	177.3	-172.8	0	111.7	A79 Q80 M86 E87	A79-K83 VanDerWaalsContact O-CB 3.29Å; A79-K83 WeakPolarHBondContact O-CB 3.17Å; A79-K83 PolarHBondContact O-N 2.84Å; Q80-K83 PolarHBondContact O-N 3.23Å; K83-M86 PolarHBondContact O-N 3.45Å; K83-E87 WeakPolarHBondContact O-CB 3.42Å; K83-E87 PolarHBondContact O-N 2.95Å
84	A	89.9	Confident	82.7	Confident	50 Å²	50	119.3 Å²	119.3	41%	0.413	60%	0.603	S	S	.	*	H	α-helix	trans	-63.7	-41.2	177.9	0	0	0	0	0	112.1	Q80 K81 E82 M86 E87 V88	Q80-A84 WeakPolarHBondContact O-CB 3.32Å; Q80-A84 PolarHBondContact O-N 3.38Å; K81-A84 PolarHBondContact O-N 3.12Å; E82-A84 PolarHBondContact O-N 3.11Å; A84-M86 PolarHBondContact O-N 3.06Å; A84-E87 PolarHBondContact O-N 3.23Å; A84-V88 WeakPolarHBondContact O-CG2 3.24Å; A84-V88 PolarHBondContact O-N 3.29Å
85	A	89.4	Confident	81.2	Confident	56 Å²	56	123.1 Å²	123.1	46%	0.463	62%	0.618	S	S	.	*	H	α-helix	trans	-63.1	-41.5	176.3	0	0	0	0	0	112.2	K81 E82 V88 L89	K81-A85 WeakPolarHBondContact O-CB 3.06Å; K81-A85 PolarHBondContact O-N 3.28Å; E82-A85 PolarHBondContact O-N 3.27Å; A85-V88 PolarHBondContact O-N 3.4Å; A85-L89 PolarHBondContact O-N 2.9Å; A85-L89 VanDerWaalsContact O-N 3.14Å
86	M	80.9	Confident	79.6	Confident	144 Å²	144	121.6 Å²	121.6	71%	0.709	62%	0.621	S	S	*	*	H	α-helix	trans	-65	-38.1	174.1	-90.6	-157.1	159.7	0	0	113	E82 K83 A84 L89 R90	E82-M86 PolarHBondContact O-N 3.01Å; K83-M86 PolarHBondContact O-N 3.45Å; A84-M86 PolarHBondContact O-N 3.06Å; M86-L89 PolarHBondContact O-N 3.01Å; M86-R90 WeakPolarHBondContact O-CB 3.42Å; M86-R90 PolarHBondContact O-N 3.24Å
87	E	81.9	Confident	78.1	Confident	127 Å²	127	130 Å²	130	59%	0.593	65%	0.648	S	S	*	*	H	α-helix	trans	-65.4	-41.5	178.5	-168.3	169	176	0	0	111.5	K83 A84 L89 R90 S91	K83-E87 WeakPolarHBondContact O-CB 3.42Å; K83-E87 PolarHBondContact O-N 2.95Å; A84-E87 PolarHBondContact O-N 3.23Å; E87-L89 PolarHBondContact O-N 3.36Å; E87-R90 WeakPolarHBondContact O-CB 3.43Å; E87-R90 PolarHBondContact O-N 3.11Å; E87-R90 VanDerWaalsContact O-N 3.16Å; E87-S91 WeakPolarHBondContact O-CB 3.45Å; E87-S91 PolarHBondContact O-N 2.94Å; E87-S91 PolarHBondContact O-OG 3.44Å
88	V	77.8	Confident	76.3	Confident	95 Å²	95	129.1 Å²	129.1	58%	0.576	66%	0.655	S	S	*	*	H	α-helix	trans	-63.5	-40.3	174.4	172.9	0	0	0	0	112.1	A84 A85 R90 S91 C92	A84-V88 WeakPolarHBondContact O-CG2 3.24Å; A84-V88 PolarHBondContact O-N 3.29Å; A85-V88 PolarHBondContact O-N 3.4Å; V88-R90 VanDerWaalsContact C-N 3.3Å; V88-R90 PolarHBondContact O-N 3.46Å; V88-S91 PolarHBondContact O-N 2.74Å; V88-S91 PolarHBondContact O-OG 3.42Å; V88-C92 WeakPolarHBondContact O-CB 3.25Å; V88-C92 PolarHBondContact O-N 2.91Å
89	L	69.8	Low	74	Confident	138 Å²	138	138 Å²	138	72%	0.723	69%	0.69	S	S	*	*	H	α-helix	trans	-65.1	-33.4	173.7	-83.5	159.7	0	0	0	112.7	A85 M86 E87	A85-L89 PolarHBondContact O-N 2.9Å; A85-L89 VanDerWaalsContact O-N 3.14Å; M86-L89 PolarHBondContact O-N 3.01Å; E87-L89 PolarHBondContact O-N 3.36Å
90	R	69.5	Low	73.1	Confident	232 Å²	232	142.2 Å²	142.2	88%	0.875	70%	0.702	S	S	*	*	H	α-helix	trans	-75.4	-36.4	176.4	-99.7	178.5	155.7	173.5	-5.6	113.1	M86 E87 V88	M86-R90 WeakPolarHBondContact O-CB 3.42Å; M86-R90 PolarHBondContact O-N 3.24Å; E87-R90 WeakPolarHBondContact O-CB 3.43Å; E87-R90 PolarHBondContact O-N 3.11Å; E87-R90 VanDerWaalsContact O-N 3.16Å; V88-R90 VanDerWaalsContact C-N 3.3Å; V88-R90 PolarHBondContact O-N 3.46Å
91	S	65.8	Low	72	Confident	90 Å²	90	143.2 Å²	143.2	63%	0.629	71%	0.709	S	S	*	*	H	α-helix	trans	-82.1	-16.7	179.8	71.8	0	0	0	0	112.9	E87 V88 P93	E87-S91 WeakPolarHBondContact O-CB 3.45Å; E87-S91 PolarHBondContact O-N 2.94Å; E87-S91 PolarHBondContact O-OG 3.44Å; V88-S91 PolarHBondContact O-N 2.74Å; V88-S91 PolarHBondContact O-OG 3.42Å; S91-P93 WeakPolarHBondContact O-CD 3.48Å
92	C	55	Low	70.8	Confident	80 Å²	80	142.6 Å²	142.6	54%	0.541	71%	0.711	S	S	.	*	S	Bend	trans	-61.7	118	171.9	-121.4	0	0	0	0	108.5	V88 K94	V88-C92 WeakPolarHBondContact O-CB 3.25Å; V88-C92 PolarHBondContact O-N 2.91Å; C92-K94 PolarHBondContact O-N 3.16Å
93	P	61.5	Low	69.6	Low	113 Å²	113	143.3 Å²	143.3	73%	0.734	72%	0.717	S	S	*	*			trans	-59.6	119.3	177.3	23.7	-30.9	0	0	0	107.1	S91 K95	S91-P93 WeakPolarHBondContact O-CD 3.48Å; P93-K95 PolarHBondContact O-N 3.32Å
94	K	62.6	Low	68.1	Low	200 Å²	200	142.9 Å²	142.9	87%	0.87	72%	0.721	S	S	*	*			trans	-56	109.9	167.8	-70.5	-171.6	179.8	-179.2	0	104.9	C92 S96	C92-K94 PolarHBondContact O-N 3.16Å; K94-S96 PolarHBondContact O-N 3.05Å
95	K	61.8	Low	66.7	Low	198 Å²	198	149.1 Å²	149.1	86%	0.861	74%	0.742	S	S	*	*			trans	-55.3	99.9	169.4	-76	-176.3	178.2	-177.1	0	105.1	P93 R97	P93-K95 PolarHBondContact O-N 3.32Å; K95-R97 VanDerWaalsContact C-N 3.3Å; K95-R97 PolarHBondContact O-N 2.89Å
96	S	59.6	Low	65.1	Low	91 Å²	91	155.8 Å²	155.8	64%	0.636	76%	0.762	S	S	*	*			trans	-58.5	106	166.5	47.6	0	0	0	0	103.7	K94 L98	K94-S96 PolarHBondContact O-N 3.05Å; S96-L98 PolarHBondContact O-N 3.18Å
97	R	60.8	Low	63.8	Low	251 Å²	251	156.7 Å²	156.7	95%	0.947	77%	0.766	S	S	*	*			trans	-62	90.8	162.6	-77.1	-175.9	-176.5	176.8	0.1	104.7	K95	K95-R97 VanDerWaalsContact C-N 3.3Å; K95-R97 PolarHBondContact O-N 2.89Å
98	L	56.3	Low	62.3	Low	144 Å²	144	159.2 Å²	159.2	75%	0.754	78%	0.78	S	S	*	*			trans	-70.6	120.8	159.8	-79.9	159.2	0	0	0	104.8	S96	S96-L98 PolarHBondContact O-N 3.18Å
99	F	47.7	Very low	60.9	Low	278 Å²	278	165 Å²	165	100%	1.219	80%	0.799	S	S	*	*			trans	7.6	0	170.4	-68.1	-86.4	0	0	0	117.6

Retrieved 99 of 99 residues in 229.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).