A0A087WRE0_MOUSE Loading...

Aminoacylase 1

AlphaFold DB , UniProt , Accession A0A087WRE0, Species MOUSE (Mus musculus, Mouse), Gene Acy1, Length 50 aa.

>A0A087WRE0_MOUSE|A0A087WRE0|Acy1
MTTKDPESEHPSVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQ
Structure Viewer
Loading PAE data...
(Predicted Aligned Error values between residue pairs)
Error loading PAE data: please refresh the page.

Site Residue pLDDT pLDDT confidence pLDDT10 pLDDT10 confidence SASA SASA [Ų] SASA10 SASA10 [Ų] RSA RSA unformatted RSA10 RSA10 unformatted Surface Surface10 (not used) Disorder (not used) Disorder Sec. str. Secondary structure Isomer Phi (φ) Psi (ψ) Omega (ω) Chi 1 (χ1) Chi 2 (χ2) Chi 3 (χ3) Chi 4 (χ4) Chi 5 (χ5) Tau (τ) Contacts (colored by PAE) Contact details
1M36.9Very low65.9Low240 Ų240138.2 Ų138.2100%1.18275%0.745SS**  0107.20-60.6-161.1-169.200106.8T3M1-T3 PolarHBondContact O-N 2.84Å
2T43.5Very low68.3Low141 Ų141132.9 Ų132.987%0.86573%0.727SS**  trans-75.8110.5179.4-68.30000107.9K4T2-K4 PolarHBondContact O-N 3.5Å
3T47.5Very low70.4Confident123 Ų123127.8 Ų127.876%0.75570%0.702SS**  trans-64.8102.4173.248.10000107.9M1 D5M1-T3 PolarHBondContact O-N 2.84Å; T3-D5 PolarHBondContact O-N 3.41Å
4K55.4Low72.2Confident195 Ų195122.1 Ų122.185%0.84867%0.673SS**  trans-84.993.3168.6-163.5179.4-175.5-176.70105.1T2 P6T2-K4 PolarHBondContact O-N 3.5Å; K4-P6 VanDerWaalsContact O-CD 3.26Å; K4-P6 WeakPolarHBondContact O-CD 3.41Å
5D60.8Low73.8Confident132 Ų132117.2 Ų117.271%0.70665%0.645SS**  trans-54.9119.5163.8-72.6-78.2000107.3T3T3-D5 PolarHBondContact O-N 3.41Å
6P61.5Low75.3Confident104 Ų104117.6 Ų117.668%0.67564%0.639SS**SBendtrans-70.2140.6162.531-28.6000107K4K4-P6 VanDerWaalsContact O-CD 3.26Å; K4-P6 WeakPolarHBondContact O-CD 3.41Å
7E64Low76.6Confident186 Ų186117.4 Ų117.487%0.86963%0.626SS**SBendtrans89.817.8165.2-44.9-56.4106.200120.7
8S77.5Confident77.7Confident112 Ų112116.2 Ų116.278%0.78362%0.617SS**  trans-99.8115.1160.5-164.60000110.3H10S8-H10 PolarHBondContact O-N 3Å
9E89.5Confident78.8Confident72 Ų72114.7 Ų114.734%0.33660%0.602SS.*  trans-60.6131.7177.6-176.1174.6-112.300110.1V13 T14 R17E9-V13 HydrophobicContact CG-CB 3.84Å; E9-V13 HydrophobicContact CG-CG1 3.84Å; E9-T14 WeakPolarHBondContact CG-OG1 3.3Å; E9-T14 WeakPolarHBondContact OE2-CA 3.42Å; E9-T14 VanDerWaalsContact OE2-CB 3.26Å; E9-T14 WeakPolarHBondContact OE2-CB 3.3Å; E9-T14 PolarHBondContact OE2-N 3.41Å; E9-T14 PolarHBondContact OE2-OG1 2.98Å; E9-R17 WeakPolarHBondContact OE1-CD 3.47Å; E9-R17 IonicContact OE1-CZ 3.6Å; E9-R17 IonicContact OE1-NE 3.71Å; E9-R17 IonicContact OE1-NH1 2.73Å; E9-R17 PolarHBondContact OE1-NH1 3.17Å; E9-R17 IonicContact OE2-NH1 3.7Å
10H95.1Very high79.7Confident117 Ų117114.4 Ų114.454%0.54260%0.6SS.*  trans-58.9133.7176.4-174-82.4000109.8S8 S12 V13 T14S8-H10 PolarHBondContact O-N 3Å; H10-S12 PolarHBondContact CE1-OG 3.43Å; H10-S12 WeakPolarHBondContact ND1-CB 3.41Å; H10-S12 PolarHBondContact ND1-N 2.8Å; H10-S12 VanDerWaalsContact ND1-N 3.17Å; H10-S12 PolarHBondContact ND1-OG 2.92Å; H10-S12 PolarHBondContact O-N 3.01Å; H10-S12 VanDerWaalsContact O-N 3.07Å; H10-V13 HydrophobicContact CB-CB 4.47Å; H10-V13 HydrophobicContact CB-CG2 4.04Å; H10-V13 WeakPolarHBondContact O-CA 3.25Å; H10-V13 WeakPolarHBondContact O-CB 3.28Å; H10-V13 PolarHBondContact O-N 3.21Å; H10-T14 PolarHBondContact O-N 3.26Å; H10-T14 VanDerWaalsContact O-N 3.11Å
11P93.2Very high80.6Confident98 Ų98116 Ų11664%0.63660%0.599SS**Hα-helixtrans-53.9-36.5-174.8-29.535.1000114.5V13 T14 L15P11-V13 VanDerWaalsContact C-N 3.3Å; P11-V13 PolarHBondContact O-N 2.84Å; P11-T14 WeakPolarHBondContact O-CB 3.39Å; P11-T14 PolarHBondContact O-N 3.41Å; P11-L15 PolarHBondContact O-N 3.34Å
12S95Very high83.5Confident75 Ų75105.8 Ų105.852%0.52455%0.548SS..Hα-helixtrans-63.8-33.1174.3-48.90000113.4H10 F16H10-S12 PolarHBondContact CE1-OG 3.43Å; H10-S12 WeakPolarHBondContact ND1-CB 3.41Å; H10-S12 PolarHBondContact ND1-N 2.8Å; H10-S12 VanDerWaalsContact ND1-N 3.17Å; H10-S12 PolarHBondContact ND1-OG 2.92Å; H10-S12 PolarHBondContact O-N 3.01Å; H10-S12 VanDerWaalsContact O-N 3.07Å; S12-F16 VanDerWaalsContact O-CB 3.31Å; S12-F16 WeakPolarHBondContact O-CB 3.23Å; S12-F16 PolarHBondContact O-N 3.15Å
13V95.4Very high86Confident67 Ų67103.1 Ų103.141%0.40654%0.535SS..Hα-helixtrans-73.1-40.9176.4179.10000109.9E9 H10 P11 L15 F16 R17E9-V13 HydrophobicContact CG-CB 3.84Å; E9-V13 HydrophobicContact CG-CG1 3.84Å; H10-V13 HydrophobicContact CB-CB 4.47Å; H10-V13 HydrophobicContact CB-CG2 4.04Å; H10-V13 WeakPolarHBondContact O-CA 3.25Å; H10-V13 WeakPolarHBondContact O-CB 3.28Å; H10-V13 PolarHBondContact O-N 3.21Å; P11-V13 VanDerWaalsContact C-N 3.3Å; P11-V13 PolarHBondContact O-N 2.84Å; V13-L15 VanDerWaalsContact C-N 3.33Å; V13-L15 PolarHBondContact O-N 3.37Å; V13-F16 PolarHBondContact O-N 3.32Å; V13-R17 HydrophobicContact CG1-CG 4.4Å; V13-R17 WeakPolarHBondContact O-CB 3.35Å; V13-R17 WeakPolarHBondContact O-CG 3.39Å; V13-R17 PolarHBondContact O-N 2.85Å
14T95.3Very high88.4Confident48 Ų48100 Ų10029%0.29452%0.515SS..Hα-helixtrans-56.9-48.3172.3-52.90000111.4E9 H10 P11 F16 R17 Q18E9-T14 WeakPolarHBondContact CG-OG1 3.3Å; E9-T14 WeakPolarHBondContact OE2-CA 3.42Å; E9-T14 VanDerWaalsContact OE2-CB 3.26Å; E9-T14 WeakPolarHBondContact OE2-CB 3.3Å; E9-T14 PolarHBondContact OE2-N 3.41Å; E9-T14 PolarHBondContact OE2-OG1 2.98Å; H10-T14 PolarHBondContact O-N 3.26Å; H10-T14 VanDerWaalsContact O-N 3.11Å; P11-T14 WeakPolarHBondContact O-CB 3.39Å; P11-T14 PolarHBondContact O-N 3.41Å; T14-F16 PolarHBondContact O-N 3.31Å; T14-R17 PolarHBondContact O-N 3.23Å; T14-Q18 WeakPolarHBondContact O-CG 3.26Å; T14-Q18 PolarHBondContact O-N 3.02Å
15L97Very high90.3Very high48 Ų4895.8 Ų95.825%0.25151%0.506SS..Hα-helixtrans-59.3-47.7176.7-170.984.4000111.8P11 V13 R17 Q18 Y19 F37 R41P11-L15 PolarHBondContact O-N 3.34Å; V13-L15 VanDerWaalsContact C-N 3.33Å; V13-L15 PolarHBondContact O-N 3.37Å; L15-R17 VanDerWaalsContact C-N 3.34Å; L15-R17 PolarHBondContact O-N 2.65Å; L15-Q18 WeakPolarHBondContact O-CB 3.31Å; L15-Q18 PolarHBondContact O-N 3.25Å; L15-Q18 VanDerWaalsContact O-N 3.13Å; L15-Y19 PolarHBondContact O-N 3.13Å; L15-F37 HydrophobicContact CD1-CZ 3.93Å; L15-F37 HydrophobicContact CG-CZ 4.15Å; L15-R41 VanDerWaalsContact CD1-NE 3.35Å
16F97.4Very high92Very high124 Ų12495.8 Ų95.854%0.54450%0.501SS..Hα-helixtrans-61.1-44.3-179.4179.9-129.2000111.4S12 V13 T14 Q18 Y19 L20S12-F16 VanDerWaalsContact O-CB 3.31Å; S12-F16 WeakPolarHBondContact O-CB 3.23Å; S12-F16 PolarHBondContact O-N 3.15Å; V13-F16 PolarHBondContact O-N 3.32Å; T14-F16 PolarHBondContact O-N 3.31Å; F16-Q18 VanDerWaalsContact C-N 3.31Å; F16-Q18 PolarHBondContact O-N 3.39Å; F16-Y19 PolarHBondContact O-N 2.76Å; F16-L20 HydrophobicContact CD1-CD1 4.05Å; F16-L20 HydrophobicContact CD2-CD1 4.41Å; F16-L20 HydrophobicContact CD2-CG 4.22Å; F16-L20 HydrophobicContact CE1-CD1 3.63Å; F16-L20 HydrophobicContact CE1-CG 4.39Å; F16-L20 HydrophobicContact CE2-CD1 4.02Å; F16-L20 HydrophobicContact CE2-CD2 3.97Å; F16-L20 HydrophobicContact CE2-CG 3.88Å; F16-L20 HydrophobicContact CG-CD1 4.43Å; F16-L20 HydrophobicContact CZ-CD1 3.61Å; F16-L20 HydrophobicContact CZ-CD2 4.07Å; F16-L20 HydrophobicContact CZ-CG 3.98Å; F16-L20 WeakPolarHBondContact O-CG 3.39Å; F16-L20 PolarHBondContact O-N 2.78Å
17R97.1Very high93.7Very high113 Ų11395.8 Ų95.843%0.42650%0.501SS..Hα-helixtrans-65.3-31.9175.1-69.1176.973.7-161.23.9112.7E9 V13 T14 L15 R21E9-R17 WeakPolarHBondContact OE1-CD 3.47Å; E9-R17 IonicContact OE1-CZ 3.6Å; E9-R17 IonicContact OE1-NE 3.71Å; E9-R17 IonicContact OE1-NH1 2.73Å; E9-R17 PolarHBondContact OE1-NH1 3.17Å; E9-R17 IonicContact OE2-NH1 3.7Å; V13-R17 HydrophobicContact CG1-CG 4.4Å; V13-R17 WeakPolarHBondContact O-CB 3.35Å; V13-R17 WeakPolarHBondContact O-CG 3.39Å; V13-R17 PolarHBondContact O-N 2.85Å; T14-R17 PolarHBondContact O-N 3.23Å; L15-R17 VanDerWaalsContact C-N 3.34Å; L15-R17 PolarHBondContact O-N 2.65Å; R17-R21 WeakPolarHBondContact O-CG 3.49Å; R17-R21 PolarHBondContact O-N 3.07Å; R17-R21 PolarHBondContact O-NH1 3.01Å
18Q97.2Very high95.2Very high97 Ų9793.9 Ų93.945%0.45350%0.497SS..Hα-helixtrans-64.7-47.3173-75.5173.2-24.900110.7T14 L15 F16 L20 R21 F37T14-Q18 WeakPolarHBondContact O-CG 3.26Å; T14-Q18 PolarHBondContact O-N 3.02Å; L15-Q18 WeakPolarHBondContact O-CB 3.31Å; L15-Q18 PolarHBondContact O-N 3.25Å; L15-Q18 VanDerWaalsContact O-N 3.13Å; F16-Q18 VanDerWaalsContact C-N 3.31Å; F16-Q18 PolarHBondContact O-N 3.39Å; Q18-L20 PolarHBondContact O-N 3.17Å; Q18-R21 PolarHBondContact O-N 3.06Å; Q18-F37 HydrophobicContact CB-CE2 4.13Å
19Y97.6Very high96.2Very high87 Ų8789.9 Ų89.934%0.34147%0.469SS..Hα-helixtrans-62.7-43.6178.2-176-107.2000112.7L15 F16 R21 I22 F37L15-Y19 PolarHBondContact O-N 3.13Å; F16-Y19 PolarHBondContact O-N 2.76Å; Y19-R21 PolarHBondContact O-N 3.42Å; Y19-R21 VanDerWaalsContact O-N 3.13Å; Y19-I22 HydrophobicContact CD2-CD1 3.87Å; Y19-I22 HydrophobicContact CE2-CD1 4.37Å; Y19-I22 WeakPolarHBondContact O-CB 3.38Å; Y19-I22 WeakPolarHBondContact O-CG1 3.45Å; Y19-I22 PolarHBondContact O-N 3.32Å; Y19-F37 AromaticContact CD2-CD1 3.62Å; Y19-F37 HydrophobicContact CD2-CD1 3.62Å; Y19-F37 AromaticContact CD2-CE1 3.66Å; Y19-F37 HydrophobicContact CD2-CE1 3.66Å; Y19-F37 HydrophobicContact CD2-CG 4.38Å; Y19-F37 HydrophobicContact CD2-CZ 4.44Å; Y19-F37 HydrophobicContact CE2-CD1 4.31Å; Y19-F37 HydrophobicContact CG-CE1 4.21Å
20L97.6Very high96.5Very high109 Ų10990 Ų9057%0.57147%0.472SS*.Hα-helixtrans-61.6-20.9178.5-73.4178.7000114.3F16 Q18 I22F16-L20 HydrophobicContact CD1-CD1 4.05Å; F16-L20 HydrophobicContact CD2-CD1 4.41Å; F16-L20 HydrophobicContact CD2-CG 4.22Å; F16-L20 HydrophobicContact CE1-CD1 3.63Å; F16-L20 HydrophobicContact CE1-CG 4.39Å; F16-L20 HydrophobicContact CE2-CD1 4.02Å; F16-L20 HydrophobicContact CE2-CD2 3.97Å; F16-L20 HydrophobicContact CE2-CG 3.88Å; F16-L20 HydrophobicContact CG-CD1 4.43Å; F16-L20 HydrophobicContact CZ-CD1 3.61Å; F16-L20 HydrophobicContact CZ-CD2 4.07Å; F16-L20 HydrophobicContact CZ-CG 3.98Å; F16-L20 WeakPolarHBondContact O-CG 3.39Å; F16-L20 PolarHBondContact O-N 2.78Å; Q18-L20 PolarHBondContact O-N 3.17Å; L20-I22 VanDerWaalsContact C-N 3.3Å
21R97.6Very high96.6Very high149 Ų14991 Ų9156%0.56247%0.471SS*.THydrogen-bonded Turntrans-81.5-10.3176.7-71.4176.5-170.9108.6-10.6113R17 Q18 Y19 C23R17-R21 WeakPolarHBondContact O-CG 3.49Å; R17-R21 PolarHBondContact O-N 3.07Å; R17-R21 PolarHBondContact O-NH1 3.01Å; Q18-R21 PolarHBondContact O-N 3.06Å; Y19-R21 PolarHBondContact O-N 3.42Å; Y19-R21 VanDerWaalsContact O-N 3.13Å; R21-C23 PolarHBondContact O-N 3.11Å
22I97.8Very high96.8Very high24 Ų2488.3 Ų88.312%0.12346%0.462CS..SBendtrans-75.5118.5173.5-52.9173.9000107.5Y19 L20 T24 A34 F37Y19-I22 HydrophobicContact CD2-CD1 3.87Å; Y19-I22 HydrophobicContact CE2-CD1 4.37Å; Y19-I22 WeakPolarHBondContact O-CB 3.38Å; Y19-I22 WeakPolarHBondContact O-CG1 3.45Å; Y19-I22 PolarHBondContact O-N 3.32Å; L20-I22 VanDerWaalsContact C-N 3.3Å; I22-T24 HydrophobicContact CG2-CG2 3.93Å; I22-T24 PolarHBondContact O-N 3.42Å; I22-A34 HydrophobicContact CG2-CB 4.14Å; I22-F37 HydrophobicContact CD1-CB 3.56Å; I22-F37 HydrophobicContact CD1-CD1 4.31Å; I22-F37 HydrophobicContact CD1-CD2 4.06Å; I22-F37 HydrophobicContact CD1-CG 3.73Å
23C96.3Very high96.9Very high86 Ų8685.8 Ų85.858%0.58145%0.448SS*.  trans-73.667.3-173.8-72.50000112.5R21 V25 D30R21-C23 PolarHBondContact O-N 3.11Å; C23-V25 PolarHBondContact O-N 3.36Å; C23-D30 WeakPolarHBondContact O-CB 3.41Å; C23-D30 PolarHBondContact O-N 3.02Å
24T97.2Very high97Very high56 Ų5683 Ų8334%0.34443%0.432SS..  trans-84.219.717752.70000113.4I22 A34I22-T24 HydrophobicContact CG2-CG2 3.93Å; I22-T24 PolarHBondContact O-N 3.42Å; T24-A34 HydrophobicContact CG2-CB 3.71Å
25V97.3Very high97.1Very high108 Ų10885 Ų8566%0.65544%0.44SS*.  trans-82.5144.6-178.970.80000111.4C23 N28 P29C23-V25 PolarHBondContact O-N 3.36Å; V25-N28 CarbonylContact O-C 3.53Å; V25-P29 WeakPolarHBondContact O-CA 3.42Å
26Q94.9Very high97.2Very high131 Ų13187 Ų8761%0.61245%0.454SS*.SBendtrans-66.1153.6173.9-68.7-69.15.500111.7
27P96.8Very high97.2Very high104 Ų10483 Ų8368%0.67544%0.436SS*.SBendcis-88.8-11.34.534.6-36.1000115P29P27-P29 WeakPolarHBondContact O-CD 3.38Å
28N96.8Very high97.2Very high146 Ų14682 Ų8278%0.78144%0.439SS*.SBendtrans-119.972-174.4-64.9-36.7000110.1V25V25-N28 CarbonylContact O-C 3.53Å
29P97.3Very high97.2Very high28 Ų2882 Ų8218%0.18244%0.439CS..  trans-69.9138.6-177.529-36.3000112.1V25 P27 Y31V25-P29 WeakPolarHBondContact O-CA 3.42Å; P27-P29 WeakPolarHBondContact O-CD 3.38Å; P29-Y31 VanDerWaalsContact C-N 3.28Å; P29-Y31 HydrophobicContact CB-CD1 4.31Å; P29-Y31 HydrophobicContact CB-CD2 4.25Å; P29-Y31 HydrophobicContact CB-CE1 3.95Å; P29-Y31 HydrophobicContact CB-CE2 3.92Å; P29-Y31 HydrophobicContact CB-CG 4.44Å; P29-Y31 HydrophobicContact CG-CD2 3.75Å; P29-Y31 HydrophobicContact CG-CE1 4.08Å; P29-Y31 HydrophobicContact CG-CE2 3.17Å; P29-Y31 HydrophobicContact CG-CG 4.41Å; P29-Y31 PolarHBondContact O-N 2.82Å
30D97.6Very high97.2Very high75 Ų7581.2 Ų81.240%0.40144%0.439SS..  trans-80.173.4170.4-175.813.1000111.3C23 G32 G33 A34C23-D30 WeakPolarHBondContact O-CB 3.41Å; C23-D30 PolarHBondContact O-N 3.02Å; D30-G32 VanDerWaalsContact C-N 3.27Å; D30-G32 PolarHBondContact OD1-N 3.29Å; D30-G33 PolarHBondContact OD1-N 3.04Å; D30-A34 PolarHBondContact O-N 3.49Å
31Y96.8Very high97.1Very high137 Ų13779.7 Ų79.754%0.53743%0.425SS..Hα-helixtrans-67.6-28.7173.9-66.7-50.8000112.5P29 A34 I35P29-Y31 VanDerWaalsContact C-N 3.28Å; P29-Y31 HydrophobicContact CB-CD1 4.31Å; P29-Y31 HydrophobicContact CB-CD2 4.25Å; P29-Y31 HydrophobicContact CB-CE1 3.95Å; P29-Y31 HydrophobicContact CB-CE2 3.92Å; P29-Y31 HydrophobicContact CB-CG 4.44Å; P29-Y31 HydrophobicContact CG-CD2 3.75Å; P29-Y31 HydrophobicContact CG-CE1 4.08Å; P29-Y31 HydrophobicContact CG-CE2 3.17Å; P29-Y31 HydrophobicContact CG-CG 4.41Å; P29-Y31 PolarHBondContact O-N 2.82Å; Y31-A34 PolarHBondContact O-N 3.44Å; Y31-I35 WeakPolarHBondContact O-CB 3.33Å; Y31-I35 WeakPolarHBondContact O-CD1 3.11Å; Y31-I35 VanDerWaalsContact O-CG1 3.23Å; Y31-I35 WeakPolarHBondContact O-CG1 3.48Å; Y31-I35 PolarHBondContact O-N 2.86Å
32G97.5Very high97.1Very high42 Ų4273.2 Ų73.243%0.43340%0.404SS..Hα-helixtrans-62.5-47.1177.500000111.9D30 A34 I35 T36D30-G32 VanDerWaalsContact C-N 3.27Å; D30-G32 PolarHBondContact OD1-N 3.29Å; G32-A34 VanDerWaalsContact C-N 3.34Å; G32-A34 PolarHBondContact O-N 3.29Å; G32-I35 PolarHBondContact O-N 2.86Å; G32-T36 WeakPolarHBondContact O-CB 3.34Å; G32-T36 PolarHBondContact O-N 3.5Å; G32-T36 PolarHBondContact O-OG1 2.95Å
33G97Very high97.1Very high23 Ų2380 Ų8024%0.23743%0.428CS..Hα-helixtrans-62.1-39.7174.100000112.7D30 F37D30-G33 PolarHBondContact OD1-N 3.04Å; G33-F37 WeakPolarHBondContact O-CB 3.49Å; G33-F37 PolarHBondContact O-N 3.49Å
34A97.6Very high97.1Very high7 Ų780.6 Ų80.66%0.05842%0.422CS..Hα-helixtrans-67.5-44.3178.300000112.8I22 T24 D30 Y31 G32 F37 L38I22-A34 HydrophobicContact CG2-CB 4.14Å; T24-A34 HydrophobicContact CG2-CB 3.71Å; D30-A34 PolarHBondContact O-N 3.49Å; Y31-A34 PolarHBondContact O-N 3.44Å; G32-A34 VanDerWaalsContact C-N 3.34Å; G32-A34 PolarHBondContact O-N 3.29Å; A34-F37 PolarHBondContact O-N 3.05Å; A34-L38 VanDerWaalsContact O-CG 3.3Å; A34-L38 WeakPolarHBondContact O-CG 3.26Å; A34-L38 PolarHBondContact O-N 3.25Å
35I97.6Very high97.1Very high92 Ų9283.3 Ų83.347%0.47243%0.434SS..Hα-helixtrans-61.8-51.3177.3-70.8164.2000109.8Y31 G32 F37 L38 E39Y31-I35 WeakPolarHBondContact O-CB 3.33Å; Y31-I35 WeakPolarHBondContact O-CD1 3.11Å; Y31-I35 VanDerWaalsContact O-CG1 3.23Å; Y31-I35 WeakPolarHBondContact O-CG1 3.48Å; Y31-I35 PolarHBondContact O-N 2.86Å; G32-I35 PolarHBondContact O-N 2.86Å; I35-F37 VanDerWaalsContact C-N 3.25Å; I35-F37 PolarHBondContact O-N 3.13Å; I35-L38 PolarHBondContact O-N 3Å; I35-E39 HydrophobicContact CG2-CG 4.11Å; I35-E39 WeakPolarHBondContact O-CG 3.45Å; I35-E39 PolarHBondContact O-N 3.41Å
36T97.6Very high97.1Very high88 Ų8881.5 Ų81.554%0.5444%0.437SS..Hα-helixtrans-56.3-42.1179.2-54.60000111.5G32 E40G32-T36 WeakPolarHBondContact O-CB 3.34Å; G32-T36 PolarHBondContact O-N 3.5Å; G32-T36 PolarHBondContact O-OG1 2.95Å; T36-E40 WeakPolarHBondContact O-CB 3.5Å; T36-E40 PolarHBondContact O-N 2.94Å; T36-E40 VanDerWaalsContact O-N 3.13Å
37F97.6Very high97.2Very high41 Ų4180.5 Ų80.518%0.1844%0.435CS..Hα-helixtrans-61.7-46.5175.8178.1-89.5000111.8L15 Q18 Y19 I22 G33 A34 I35 R41L15-F37 HydrophobicContact CD1-CZ 3.93Å; L15-F37 HydrophobicContact CG-CZ 4.15Å; Q18-F37 HydrophobicContact CB-CE2 4.13Å; Y19-F37 AromaticContact CD2-CD1 3.62Å; Y19-F37 HydrophobicContact CD2-CD1 3.62Å; Y19-F37 AromaticContact CD2-CE1 3.66Å; Y19-F37 HydrophobicContact CD2-CE1 3.66Å; Y19-F37 HydrophobicContact CD2-CG 4.38Å; Y19-F37 HydrophobicContact CD2-CZ 4.44Å; Y19-F37 HydrophobicContact CE2-CD1 4.31Å; Y19-F37 HydrophobicContact CG-CE1 4.21Å; I22-F37 HydrophobicContact CD1-CB 3.56Å; I22-F37 HydrophobicContact CD1-CD1 4.31Å; I22-F37 HydrophobicContact CD1-CD2 4.06Å; I22-F37 HydrophobicContact CD1-CG 3.73Å; G33-F37 WeakPolarHBondContact O-CB 3.49Å; G33-F37 PolarHBondContact O-N 3.49Å; A34-F37 PolarHBondContact O-N 3.05Å; I35-F37 VanDerWaalsContact C-N 3.25Å; I35-F37 PolarHBondContact O-N 3.13Å; F37-R41 HydrophobicContact CD1-CG 4.25Å; F37-R41 HydrophobicContact CE1-CG 3.91Å; F37-R41 HydrophobicContact CZ-CG 4.14Å; F37-R41 VanDerWaalsContact O-CG 3.3Å; F37-R41 WeakPolarHBondContact O-CG 2.99Å; F37-R41 PolarHBondContact O-N 3.26Å
38L97.3Very high97Very high93 Ų9381.1 Ų81.149%0.48744%0.442SS..Hα-helixtrans-69.4-39.7-177.9-69171.3000112.7A34 I35 R41 A42A34-L38 VanDerWaalsContact O-CG 3.3Å; A34-L38 WeakPolarHBondContact O-CG 3.26Å; A34-L38 PolarHBondContact O-N 3.25Å; I35-L38 PolarHBondContact O-N 3Å; L38-R41 PolarHBondContact O-N 3.25Å; L38-A42 PolarHBondContact O-N 2.96Å
39E97.8Very high96.8Very high95 Ų9577.7 Ų77.744%0.44443%0.429SS..Hα-helixtrans-59.7-46.4174.5-74176.616100111.3I35 R41 A42 R43I35-E39 HydrophobicContact CG2-CG 4.11Å; I35-E39 WeakPolarHBondContact O-CG 3.45Å; I35-E39 PolarHBondContact O-N 3.41Å; E39-R41 VanDerWaalsContact C-N 3.3Å; E39-R41 PolarHBondContact O-N 3.13Å; E39-A42 WeakPolarHBondContact O-CB 3.2Å; E39-A42 PolarHBondContact O-N 3.48Å; E39-R43 PolarHBondContact O-N 3.37Å
40E97Very high95.8Very high72 Ų7288.7 Ų88.734%0.33648%0.478SS..Hα-helixtrans-63.5-37.417717756.3-159.400111.5T36 R43 Q44T36-E40 WeakPolarHBondContact O-CB 3.5Å; T36-E40 PolarHBondContact O-N 2.94Å; T36-E40 VanDerWaalsContact O-N 3.13Å; E40-R43 PolarHBondContact O-N 2.89Å; E40-R43 IonicContact OE1-CZ 3.48Å; E40-R43 IonicContact OE1-NE 3.53Å; E40-R43 IonicContact OE1-NH2 2.65Å; E40-R43 PolarHBondContact OE1-NH2 2.63Å; E40-R43 IonicContact OE2-CZ 3.51Å; E40-R43 IonicContact OE2-NE 2.8Å; E40-R43 PolarHBondContact OE2-NE 2.73Å; E40-R43 IonicContact OE2-NH2 3.37Å; E40-R43 PolarHBondContact OE2-NH2 3.01Å; E40-Q44 VanDerWaalsContact O-CG 3.25Å; E40-Q44 WeakPolarHBondContact O-CG 3.44Å; E40-Q44 PolarHBondContact O-N 2.82Å; E40-Q44 PolarHBondContact OE1-NE2 2.78Å
41R96.7Very high95.8Very high76 Ų7689.4 Ų89.429%0.28748%0.482SS..Hα-helixtrans-68.4-38.9173.9-67.8-55-67.4-177.4-12.1112.6L15 F37 L38 E39 R43 Q44 L45L15-R41 VanDerWaalsContact CD1-NE 3.35Å; F37-R41 HydrophobicContact CD1-CG 4.25Å; F37-R41 HydrophobicContact CE1-CG 3.91Å; F37-R41 HydrophobicContact CZ-CG 4.14Å; F37-R41 VanDerWaalsContact O-CG 3.3Å; F37-R41 WeakPolarHBondContact O-CG 2.99Å; F37-R41 PolarHBondContact O-N 3.26Å; L38-R41 PolarHBondContact O-N 3.25Å; E39-R41 VanDerWaalsContact C-N 3.3Å; E39-R41 PolarHBondContact O-N 3.13Å; R41-R43 VanDerWaalsContact C-N 3.34Å; R41-Q44 PolarHBondContact O-N 3.25Å; R41-L45 WeakPolarHBondContact O-CB 3.35Å; R41-L45 VanDerWaalsContact O-CG 3.28Å; R41-L45 WeakPolarHBondContact O-CG 3.33Å; R41-L45 PolarHBondContact O-N 3.39Å
42A97.4Very high95.7Very high14 Ų1486.9 Ų86.912%0.11648%0.479CS..Hα-helixtrans-60-46.8173.400000110.5L38 E39 Q44 L45 G46 L47 C49L38-A42 PolarHBondContact O-N 2.96Å; E39-A42 WeakPolarHBondContact O-CB 3.2Å; E39-A42 PolarHBondContact O-N 3.48Å; A42-Q44 PolarHBondContact O-N 3.44Å; A42-L45 CarbonylContact O-C 3.55Å; A42-L45 PolarHBondContact O-N 3.45Å; A42-G46 PolarHBondContact O-N 2.95Å; A42-L47 CarbonylContact C-O 3.57Å; A42-L47 HydrophobicContact CB-CB 4.13Å; A42-L47 PolarHBondContact O-N 3.47Å; A42-C49 HydrophobicContact CB-CB 3.92Å
43R97Very high95.6Very high167 Ų16789.4 Ų89.463%0.6348%0.482SS*.Hα-helixtrans-56.8-46.9175.2-170-171.272.178.9-2.2112.4E39 E40 R41 L45 G46E39-R43 PolarHBondContact O-N 3.37Å; E40-R43 PolarHBondContact O-N 2.89Å; E40-R43 IonicContact OE1-CZ 3.48Å; E40-R43 IonicContact OE1-NE 3.53Å; E40-R43 IonicContact OE1-NH2 2.65Å; E40-R43 PolarHBondContact OE1-NH2 2.63Å; E40-R43 IonicContact OE2-CZ 3.51Å; E40-R43 IonicContact OE2-NE 2.8Å; E40-R43 PolarHBondContact OE2-NE 2.73Å; E40-R43 IonicContact OE2-NH2 3.37Å; E40-R43 PolarHBondContact OE2-NH2 3.01Å; R41-R43 VanDerWaalsContact C-N 3.34Å; R43-L45 VanDerWaalsContact C-N 3.29Å; R43-L45 PolarHBondContact O-N 3.44Å; R43-G46 PolarHBondContact O-N 3.01Å
44Q96.1Very high95.5Very high98 Ų9893.3 Ų93.346%0.45850%0.496SS..Hα-helixtrans-66.3-29.7179.7-72.3173.28.200113.3E40 R41 A42E40-Q44 VanDerWaalsContact O-CG 3.25Å; E40-Q44 WeakPolarHBondContact O-CG 3.44Å; E40-Q44 PolarHBondContact O-N 2.82Å; E40-Q44 PolarHBondContact OE1-NE2 2.78Å; R41-Q44 PolarHBondContact O-N 3.25Å; A42-Q44 PolarHBondContact O-N 3.44Å
45L96.7Very high95.4Very high112 Ų11298.7 Ų98.759%0.58652%0.523SS*.Hα-helixtrans-90.7-2.7178.1-66173.8000113.3R41 A42 R43 L47R41-L45 WeakPolarHBondContact O-CB 3.35Å; R41-L45 VanDerWaalsContact O-CG 3.28Å; R41-L45 WeakPolarHBondContact O-CG 3.33Å; R41-L45 PolarHBondContact O-N 3.39Å; A42-L45 CarbonylContact O-C 3.55Å; A42-L45 PolarHBondContact O-N 3.45Å; R43-L45 VanDerWaalsContact C-N 3.29Å; R43-L45 PolarHBondContact O-N 3.44Å; L45-L47 VanDerWaalsContact C-N 3.29Å; L45-L47 HydrophobicContact CB-CD1 3.97Å; L45-L47 HydrophobicContact CB-CG 3.87Å; L45-L47 HydrophobicContact CD1-CD1 4.11Å; L45-L47 PolarHBondContact O-N 2.95Å
46G97.2Very high95.2Very high71 Ų7199.1 Ų99.173%0.73253%0.527SS*.THydrogen-bonded Turntrans68.926.4-175.300000113.6A42 R43A42-G46 PolarHBondContact O-N 2.95Å; R43-G46 PolarHBondContact O-N 3.01Å
47L97.6Very high95.1Very high109 Ų10999.9 Ų99.957%0.57153%0.526SS*.  trans-93.6141.5177.4-57.3176.3000110.2A42 L45A42-L47 CarbonylContact C-O 3.57Å; A42-L47 HydrophobicContact CB-CB 4.13Å; A42-L47 PolarHBondContact O-N 3.47Å; L45-L47 VanDerWaalsContact C-N 3.29Å; L45-L47 HydrophobicContact CB-CD1 3.97Å; L45-L47 HydrophobicContact CB-CG 3.87Å; L45-L47 HydrophobicContact CD1-CD1 4.11Å; L45-L47 PolarHBondContact O-N 2.95Å
48S93.8Very high94.9Very high117 Ų117104.5 Ų104.582%0.81855%0.552SS**  trans-71.4135.1171.452.70000110.8
49C91.9Very high94.7Very high75 Ų75105.4 Ų105.451%0.50756%0.558SS.*  trans-128.2135.4172.2-1700000108.3A42A42-C49 HydrophobicContact CB-CB 3.92Å
50Q76.9Confident94.4Very high259 Ų259106.4 Ų106.4100%1.2157%0.568SS**  trans-138.30-178.4-64.9-166.9-87.900110.5

Retrieved 50 of 50 residues in 110.1 ms (Link to these results)