A0A087WRG3_MOUSE Loading...

Autophagy related 9A

AlphaFold DB , UniProt , Accession A0A087WRG3, Species MOUSE (Mus musculus, Mouse), Gene Atg9a, Length 47 aa.

						>A0A087WRG3_MOUSE|A0A087WRG3|Atg9a
MAQFDTEYQRLEASYSDSPPGEEDLLVHVAEGSKSPWHHIENLDLFF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.9	Low	71.1	Confident	248 Å²	248	168.4 Å²	168.4	100%	1.222	81%	0.809	S	S	*	*				0	118.2	0	-126.4	148.5	154.5	0	0	105.9	Q3	M1-Q3 PolarHBondContact O-N 3.19Å
2	A	61.7	Low	71.8	Confident	80 Å²	80	166.8 Å²	166.8	66%	0.661	80%	0.8	S	S	*	*			trans	-73.2	121.9	179.7	0	0	0	0	0	108.7	F4	A2-F4 HydrophobicContact CB-CE2 4.3Å; A2-F4 HydrophobicContact CB-CZ 4.49Å
3	Q	64.7	Low	71.7	Confident	159 Å²	159	158.9 Å²	158.9	74%	0.743	78%	0.779	S	S	*	*			trans	-83.2	113.2	175.7	-170.8	163.4	-50.1	0	0	107.3	M1 D5	M1-Q3 PolarHBondContact O-N 3.19Å; Q3-D5 PolarHBondContact NE2-OD1 3.5Å; Q3-D5 PolarHBondContact O-N 3.42Å
4	F	66	Low	71.4	Confident	168 Å²	168	155.8 Å²	155.8	74%	0.737	78%	0.781	S	S	*	*			trans	-86.7	93.3	174	-67.1	-84.3	0	0	0	107.2	A2 T6	A2-F4 HydrophobicContact CB-CE2 4.3Å; A2-F4 HydrophobicContact CB-CZ 4.49Å; F4-T6 PolarHBondContact O-N 3.33Å
5	D	68.9	Low	71	Confident	125 Å²	125	159.5 Å²	159.5	67%	0.668	78%	0.784	S	S	*	*			trans	-74.1	59.2	171.7	-64.4	-62.2	0	0	0	110	Q3 E7	Q3-D5 PolarHBondContact NE2-OD1 3.5Å; Q3-D5 PolarHBondContact O-N 3.42Å; D5-E7 PolarHBondContact O-N 2.89Å
6	T	73.3	Confident	70.5	Confident	110 Å²	110	156.4 Å²	156.4	68%	0.675	78%	0.784	S	S	*	*			trans	-92.9	99.1	174.2	54.1	0	0	0	0	108.6	F4	F4-T6 PolarHBondContact O-N 3.33Å
7	E	79.9	Confident	70.3	Confident	173 Å²	173	156.1 Å²	156.1	81%	0.808	79%	0.785	S	S	*	*			trans	-63.6	139.2	173.5	-67	-66.5	98.8	0	0	110.4	D5 Q9	D5-E7 PolarHBondContact O-N 2.89Å; E7-Q9 PolarHBondContact O-N 3.14Å; E7-Q9 VanDerWaalsContact O-N 3.14Å
8	Y	77.9	Confident	70	Confident	242 Å²	242	151.9 Å²	151.9	95%	0.949	77%	0.773	S	S	*	*			trans	-63.7	114.5	176.1	-80.6	-88.3	0	0	0	110.3
9	Q	78.8	Confident	69.8	Low	164 Å²	164	149.2 Å²	149.2	77%	0.766	77%	0.766	S	S	*	*	P	Polyproline II helix	trans	-94.2	123.7	172.1	-172.5	162.5	-0	0	0	110.5	E7	E7-Q9 PolarHBondContact O-N 3.14Å; E7-Q9 VanDerWaalsContact O-N 3.14Å
10	R	81	Confident	69.6	Low	230 Å²	230	148.7 Å²	148.7	87%	0.868	77%	0.773	S	S	*	*	P	Polyproline II helix	trans	-76	127.2	174.5	-176.2	178.6	-72.3	-170.3	-2.2	109
11	L	79.6	Confident	69.3	Low	153 Å²	153	144.1 Å²	144.1	80%	0.801	76%	0.763	S	S	*	*	P	Polyproline II helix	trans	-67.8	136.8	175.8	-62.5	172.5	0	0	0	110.4	A13	L11-A13 PolarHBondContact O-N 3.21Å
12	E	79.3	Confident	69.6	Low	149 Å²	149	140 Å²	140	70%	0.696	74%	0.74	S	S	*	*	P	Polyproline II helix	trans	-64.3	116.7	172.3	-62.8	73.6	-162.7	0	0	108.7	S14	E12-S14 PolarHBondContact O-N 2.84Å; E12-S14 VanDerWaalsContact O-N 3.13Å
13	A	70.8	Confident	69.5	Low	65 Å²	65	144.7 Å²	144.7	54%	0.537	75%	0.748	S	S	.	*			trans	-67.7	112.9	169.2	0	0	0	0	0	107.5	L11 Y15	L11-A13 PolarHBondContact O-N 3.21Å; A13-Y15 HydrophobicContact CB-CE2 3.73Å; A13-Y15 PolarHBondContact O-N 3.13Å; A13-Y15 WeakPolarHBondContact O-CD2 3.17Å; A13-Y15 HydrophobicContact CB-CD2 4.08Å; A13-Y15 VanDerWaalsContact C-N 3.27Å
14	S	67.3	Low	69.4	Low	115 Å²	115	143.4 Å²	143.4	80%	0.804	75%	0.747	S	S	*	*			trans	-64	91	169	-64.7	0	0	0	0	108.7	E12 S16	E12-S14 PolarHBondContact O-N 2.84Å; E12-S14 VanDerWaalsContact O-N 3.13Å; S14-S16 PolarHBondContact O-N 2.85Å
15	Y	64.5	Low	69.2	Low	211 Å²	211	142.6 Å²	142.6	83%	0.827	75%	0.749	S	S	*	*			trans	-73.5	57.3	171.7	-73.3	-84.9	0	0	0	110.5	A13	A13-Y15 HydrophobicContact CB-CE2 3.73Å; A13-Y15 PolarHBondContact O-N 3.13Å; A13-Y15 WeakPolarHBondContact O-CD2 3.17Å; A13-Y15 HydrophobicContact CB-CD2 4.08Å; A13-Y15 VanDerWaalsContact C-N 3.27Å
16	S	63.7	Low	69.2	Low	111 Å²	111	144 Å²	144	78%	0.776	76%	0.756	S	S	*	*			trans	-123	25.1	178.3	-173.3	0	0	0	0	111.7	S14	S14-S16 PolarHBondContact O-N 2.85Å
17	D	66.7	Low	68.9	Low	151 Å²	151	144.6 Å²	144.6	81%	0.807	76%	0.759	S	S	*	*			trans	-133.3	41.5	173.3	-152.3	-104.9	0	0	0	110	P19	D17-P19 WeakPolarHBondContact O-CD 3.33Å
18	S	64.9	Low	68.2	Low	81 Å²	81	144.1 Å²	144.1	57%	0.566	76%	0.757	S	S	*	*	P	Polyproline II helix	trans	-71.5	117.6	159.1	-72.3	0	0	0	0	106.2
19	P	66.8	Low	67.7	Low	99 Å²	99	138.1 Å²	138.1	64%	0.643	75%	0.745	S	S	*	*	P	Polyproline II helix	trans	-57	128.9	177.7	21	-30.4	0	0	0	108.8	D17 G21	D17-P19 WeakPolarHBondContact O-CD 3.33Å; P19-G21 PolarHBondContact O-N 3.16Å; P19-G21 VanDerWaalsContact O-N 3.16Å
20	P	65	Low	66.9	Low	139 Å²	139	134 Å²	134	90%	0.903	74%	0.738	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.1	118.8	175.4	25.4	-30.8	0	0	0	108.1
21	G	63.5	Low	65.9	Low	54 Å²	54	131.3 Å²	131.3	56%	0.557	74%	0.736	S	S	*	*	T	Hydrogen-bonded Turn	trans	139.1	16.3	170.8	0	0	0	0	0	118.1	P19 E23	P19-G21 PolarHBondContact O-N 3.16Å; P19-G21 VanDerWaalsContact O-N 3.16Å; G21-E23 PolarHBondContact O-N 3.4Å
22	E	56.8	Low	65.2	Low	160 Å²	160	127.1 Å²	127.1	75%	0.748	73%	0.729	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.6	5.9	170.5	62.9	-176.2	145	0	0	114.1
23	E	60.3	Low	64.3	Low	179 Å²	179	125.1 Å²	125.1	84%	0.836	73%	0.732	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.8	-12.6	-177.6	65.9	-170.3	138	0	0	115.3	G21	G21-E23 PolarHBondContact O-N 3.4Å
24	D	61.5	Low	63.7	Low	132 Å²	132	131.5 Å²	131.5	71%	0.706	75%	0.748	S	S	*	*			trans	-106.3	82.8	168	-95.2	-25.8	0	0	0	109.2	L26	D24-L26 PolarHBondContact O-N 2.72Å
25	L	63.8	Low	63.4	Low	152 Å²	152	130.7 Å²	130.7	80%	0.796	74%	0.742	S	S	*	*			trans	-61.9	85.7	158.4	-66.3	174.6	0	0	0	106.8	V27	L25-V27 WeakPolarHBondContact O-CG2 3.45Å; L25-V27 PolarHBondContact O-N 2.76Å
26	L	68.1	Low	63.2	Low	155 Å²	155	124.9 Å²	124.9	81%	0.812	73%	0.73	S	S	*	*			trans	-58.8	93.2	170.7	-67.1	174.2	0	0	0	106.7	D24 H28	D24-L26 PolarHBondContact O-N 2.72Å; L26-H28 PolarHBondContact O-N 3.22Å
27	V	66.9	Low	63.1	Low	121 Å²	121	131.6 Å²	131.6	73%	0.733	74%	0.739	S	S	*	*			trans	-61.1	109.6	178.7	-177.1	0	0	0	0	105.6	L25 V29	L25-V27 WeakPolarHBondContact O-CG2 3.45Å; L25-V27 PolarHBondContact O-N 2.76Å; V27-V29 PolarHBondContact O-N 2.94Å; V27-V29 VanDerWaalsContact C-N 3.31Å
28	H	65.4	Low	62.8	Low	164 Å²	164	132 Å²	132	76%	0.759	74%	0.735	S	S	*	*			trans	-63	97.5	174.8	-179.2	80.1	0	0	0	108.2	L26 A30	L26-H28 PolarHBondContact O-N 3.22Å; H28-A30 PolarHBondContact O-N 2.82Å
29	V	66.2	Low	62.9	Low	116 Å²	116	135.1 Å²	135.1	70%	0.703	74%	0.74	S	S	*	*			trans	-70.4	109.9	162.4	177.6	0	0	0	0	104.8	V27 E31	V27-V29 PolarHBondContact O-N 2.94Å; V27-V29 VanDerWaalsContact C-N 3.31Å; V29-E31 PolarHBondContact O-N 2.8Å
30	A	62.9	Low	63	Low	76 Å²	76	136 Å²	136	63%	0.628	74%	0.739	S	S	*	*			trans	-61.5	99	167.3	0	0	0	0	0	106.6	H28 G32	H28-A30 PolarHBondContact O-N 2.82Å; A30-G32 PolarHBondContact O-N 3.12Å; A30-G32 VanDerWaalsContact O-N 3.12Å
31	E	61	Low	63.4	Low	175 Å²	175	135.7 Å²	135.7	82%	0.818	73%	0.725	S	S	*	*			trans	-52.8	122	-179	-149.9	-180	162.1	0	0	107.5	V29 S33	V29-E31 PolarHBondContact O-N 2.8Å; E31-S33 PolarHBondContact O-N 3.41Å
32	G	64.3	Low	63.4	Low	64 Å²	64	137.9 Å²	137.9	66%	0.66	72%	0.724	S	S	*	*	S	Bend	trans	-52.6	137.2	-178.9	0	0	0	0	0	110	A30	A30-G32 PolarHBondContact O-N 3.12Å; A30-G32 VanDerWaalsContact O-N 3.12Å
33	S	60	Low	64	Low	108 Å²	108	135.1 Å²	135.1	76%	0.755	71%	0.714	S	S	*	*	S	Bend	trans	78.1	88.7	-165.9	76.4	0	0	0	0	113.4	E31 S35	E31-S33 PolarHBondContact O-N 3.41Å; S33-S35 PolarHBondContact O-N 3.19Å
34	K	58.9	Low	64.4	Low	199 Å²	199	133.6 Å²	133.6	87%	0.865	71%	0.712	S	S	*	*			trans	-49.3	95	154	-67.6	-177.8	176.3	-178.5	0	107.9	P36	K34-P36 VanDerWaalsContact O-CD 3.23Å; K34-P36 WeakPolarHBondContact O-CD 3.23Å; K34-P36 VanDerWaalsContact O-N 3.08Å
35	S	60.4	Low	64.8	Low	97 Å²	97	133.9 Å²	133.9	68%	0.678	71%	0.712	S	S	*	*			trans	-55.2	113.5	145.7	-72.6	0	0	0	0	104.1	S33 W37	S33-S35 PolarHBondContact O-N 3.19Å; S35-W37 PolarHBondContact O-N 2.68Å
36	P	60.2	Low	64.8	Low	89 Å²	89	134.5 Å²	134.5	58%	0.578	71%	0.709	S	S	*	*			trans	-57.3	133.7	178.1	24.5	-30.6	0	0	0	105.7	K34 H38	K34-P36 VanDerWaalsContact O-CD 3.23Å; K34-P36 WeakPolarHBondContact O-CD 3.23Å; K34-P36 VanDerWaalsContact O-N 3.08Å; P36-H38 HydrophobicContact CB-CB 4.43Å; P36-H38 PolarHBondContact O-N 2.75Å
37	W	61.4	Low	64.4	Low	253 Å²	253	139.2 Å²	139.2	96%	0.958	72%	0.723	S	S	*	*	S	Bend	trans	-63.7	34.9	173	-90.4	75	0	0	0	112.4	S35	S35-W37 PolarHBondContact O-N 2.68Å
38	H	61.2	Low	64.2	Low	158 Å²	158	140.1 Å²	140.1	73%	0.731	72%	0.723	S	S	*	*			trans	-142.8	34.5	-169.5	-52.3	108.7	0	0	0	111.6	P36 I40	P36-H38 HydrophobicContact CB-CB 4.43Å; P36-H38 PolarHBondContact O-N 2.75Å; H38-I40 PolarHBondContact O-N 3.11Å; H38-I40 VanDerWaalsContact O-N 3.11Å
39	H	65.9	Low	64.2	Low	147 Å²	147	138.8 Å²	138.8	68%	0.681	72%	0.721	S	S	*	*			trans	-83.4	53	167.6	-167	-75.3	0	0	0	110.8	E41	H39-E41 IonicContact CE1-OE1 3.67Å; H39-E41 IonicContact NE2-OE1 3.53Å
40	I	69.3	Low	64.1	Low	118 Å²	118	140.1 Å²	140.1	61%	0.605	72%	0.722	S	S	*	*			trans	-99.9	93.3	166.9	-56	174.3	0	0	0	106.3	H38 L43	H38-I40 PolarHBondContact O-N 3.11Å; H38-I40 VanDerWaalsContact O-N 3.11Å; I40-L43 HydrophobicContact CB-CD2 4.48Å; I40-L43 HydrophobicContact CG2-CD2 3.69Å; I40-L43 HydrophobicContact CG2-CG 4.08Å
41	E	72.8	Confident	64.1	Low	133 Å²	133	143.9 Å²	143.9	62%	0.621	73%	0.727	S	S	*	*			trans	-72.7	145.7	167.3	-61.5	-176.2	159.7	0	0	109.1	H39	H39-E41 IonicContact CE1-OE1 3.67Å; H39-E41 IonicContact NE2-OE1 3.53Å
42	N	63.4	Low	64.3	Low	99 Å²	99	141.9 Å²	141.9	53%	0.529	72%	0.721	S	S	.	*			trans	78.1	34.8	172.9	-43.8	-73.9	0	0	0	118	D44 L45	N42-D44 PolarHBondContact O-N 3.18Å; N42-L45 HydrophobicContact CB-CD1 3.54Å; N42-L45 HydrophobicContact CB-CG 3.92Å; N42-L45 PolarHBondContact O-N 3.24Å
43	L	69.6	Low	64.3	Low	103 Å²	103	147.1 Å²	147.1	54%	0.539	73%	0.726	S	S	.	*	G	3₁₀ helix	trans	-59.8	-26.7	169.7	-68.8	175.2	0	0	0	113.2	I40 L45 F46	I40-L43 HydrophobicContact CB-CD2 4.48Å; I40-L43 HydrophobicContact CG2-CD2 3.69Å; I40-L43 HydrophobicContact CG2-CG 4.08Å; L43-L45 PolarHBondContact O-N 3.27Å; L43-F46 PolarHBondContact O-N 3.27Å
44	D	69.8	Low	64.6	Low	147 Å²	147	149.9 Å²	149.9	79%	0.786	72%	0.723	S	S	*	*	G	3₁₀ helix	trans	-69.5	-12.7	177.9	-59.1	-39.1	0	0	0	113.9	N42 F46	N42-D44 PolarHBondContact O-N 3.18Å; D44-F46 PolarHBondContact O-N 3.46Å
45	L	69.1	Low	65.1	Low	137 Å²	137	146.2 Å²	146.2	72%	0.717	71%	0.713	S	S	*	*	G	3₁₀ helix	trans	-79.6	-5.8	175.4	-64.6	177.4	0	0	0	113.1	N42 L43	N42-L45 HydrophobicContact CB-CD1 3.54Å; N42-L45 HydrophobicContact CB-CG 3.92Å; N42-L45 PolarHBondContact O-N 3.24Å; L43-L45 PolarHBondContact O-N 3.27Å
46	F	63.9	Low	65.5	Low	166 Å²	166	150.3 Å²	150.3	73%	0.728	72%	0.715	S	S	*	*	G	3₁₀ helix	trans	-106.7	6	-175.9	-65	-81.1	0	0	0	114.6	L43 D44	L43-F46 PolarHBondContact O-N 3.27Å; D44-F46 PolarHBondContact O-N 3.46Å
47	F	59	Low	65.9	Low	253 Å²	253	155.8 Å²	155.8	100%	1.11	73%	0.728	S	S	*	*			trans	-122.4	0	175.8	-70.2	-73.1	0	0	0	112.6

Retrieved 47 of 47 residues in 51.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).