A0A087WRG9_MOUSE Loading...

Lymphocyte antigen 6 family member C1

AlphaFold DB , UniProt , Accession A0A087WRG9, Species MOUSE (Mus musculus, Mouse), Gene Ly6c1, Length 81 aa.

						>A0A087WRG9_MOUSE|A0A087WRG9|Ly6c1
MDTSHTTKSCVLILLVALLCAERAQGLQCYECYGVPIETSCPAVTCRASDGFCIAQNIELIEGSHSNLRIDYKSPCSPVWD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.2	Very low	62.7	Low	221 Å²	221	110.8 Å²	110.8	100%	1.089	62%	0.618	S	S	*	*				0	110	0	-108.2	132.4	67.3	0	0	104.7
2	D	51.4	Low	64.2	Low	112 Å²	112	110.3 Å²	110.3	60%	0.599	61%	0.613	S	S	*	*			cis	-155.1	42.1	49.8	-78.9	-69.3	0	0	0	113.5	S4 T6	D2-S4 VanDerWaalsContact C-N 3.28Å; D2-S4 PolarHBondContact O-N 3.34Å; D2-T6 PolarHBondContact O-OG1 3.15Å
3	T	54.8	Low	65.6	Low	116 Å²	116	110.3 Å²	110.3	71%	0.712	61%	0.609	S	S	*	*	H	α-helix	trans	-70.7	-24.9	176.2	53.1	0	0	0	0	113	H5 T6 T7	T3-H5 VanDerWaalsContact C-N 3.3Å; T3-H5 PolarHBondContact O-N 3.39Å; T3-T6 PolarHBondContact O-OG1 2.84Å; T3-T7 PolarHBondContact O-N 3.43Å; T3-T7 PolarHBondContact O-OG1 3.42Å
4	S	56.8	Low	66.8	Low	86 Å²	86	110.4 Å²	110.4	60%	0.601	61%	0.607	S	S	*	*	H	α-helix	trans	-62.9	-33.7	178.9	176.1	0	0	0	0	113.2	D2 K8	D2-S4 VanDerWaalsContact C-N 3.28Å; D2-S4 PolarHBondContact O-N 3.34Å; S4-K8 PolarHBondContact O-N 3.23Å
5	H	57.8	Low	67.7	Low	147 Å²	147	108.9 Å²	108.9	68%	0.681	60%	0.598	S	S	*	*	H	α-helix	trans	-76	-37	-174.5	-136.7	-95.4	0	0	0	112	T3 S9	T3-H5 VanDerWaalsContact C-N 3.3Å; T3-H5 PolarHBondContact O-N 3.39Å; H5-S9 PolarHBondContact O-N 3.43Å
6	T	59.8	Low	68.5	Low	92 Å²	92	107.6 Å²	107.6	56%	0.564	59%	0.593	S	S	*	*	H	α-helix	trans	-67.9	-42.5	177.8	-0.8	0	0	0	0	110.9	D2 T3 S9 C10	D2-T6 PolarHBondContact O-OG1 3.15Å; T3-T6 PolarHBondContact O-OG1 2.84Å; T6-S9 PolarHBondContact O-N 3.44Å; T6-C10 PolarHBondContact O-N 3.13Å; T6-C10 VanDerWaalsContact O-N 3.15Å; T6-C10 PolarHBondContact O-SG 3.42Å
7	T	61.8	Low	69.1	Low	90 Å²	90	104.8 Å²	104.8	55%	0.552	59%	0.588	S	S	*	*	H	α-helix	trans	-66.7	-40.7	178.7	-24.7	0	0	0	0	112.1	T3 S9 C10 V11	T3-T7 PolarHBondContact O-N 3.43Å; T3-T7 PolarHBondContact O-OG1 3.42Å; T7-S9 VanDerWaalsContact C-N 3.32Å; T7-S9 PolarHBondContact O-N 3.32Å; T7-C10 PolarHBondContact O-N 3.39Å; T7-V11 VanDerWaalsContact O-CG2 3.31Å; T7-V11 WeakPolarHBondContact O-CG2 3.43Å; T7-V11 PolarHBondContact O-N 3.44Å; T7-V11 VanDerWaalsContact O-N 3.13Å
8	K	64	Low	69.5	Low	147 Å²	147	106 Å²	106	64%	0.639	59%	0.592	S	S	*	*	H	α-helix	trans	-61.8	-39.8	175.6	-100	-177.7	77.8	163.7	0	112.3	S4 L12	S4-K8 PolarHBondContact O-N 3.23Å; K8-L12 WeakPolarHBondContact O-CG 3.32Å; K8-L12 PolarHBondContact O-N 3.3Å; K8-L12 VanDerWaalsContact O-N 3.16Å
9	S	74.1	Confident	69.6	Low	60 Å²	60	107.4 Å²	107.4	42%	0.42	60%	0.597	S	S	.	*	H	α-helix	trans	-65.4	-44.5	179	-174.5	0	0	0	0	111.9	H5 T6 T7 V11 L12 I13	H5-S9 PolarHBondContact O-N 3.43Å; T6-S9 PolarHBondContact O-N 3.44Å; T7-S9 VanDerWaalsContact C-N 3.32Å; T7-S9 PolarHBondContact O-N 3.32Å; S9-V11 PolarHBondContact O-N 2.96Å; S9-L12 PolarHBondContact O-N 3.06Å; S9-I13 WeakPolarHBondContact O-CG1 3.31Å; S9-I13 PolarHBondContact O-N 3.48Å
10	C	77.1	Confident	69.4	Low	71 Å²	71	106.6 Å²	106.6	48%	0.48	60%	0.598	S	S	.	*	H	α-helix	trans	-63.7	-40	177.8	-66.7	0	0	0	0	113.1	T6 T7 L12 I13 L14	T6-C10 PolarHBondContact O-N 3.13Å; T6-C10 VanDerWaalsContact O-N 3.15Å; T6-C10 PolarHBondContact O-SG 3.42Å; T7-C10 PolarHBondContact O-N 3.39Å; C10-L12 VanDerWaalsContact C-N 3.33Å; C10-L12 PolarHBondContact O-N 3.18Å; C10-I13 PolarHBondContact O-N 3.16Å; C10-L14 WeakPolarHBondContact O-CG 3.3Å; C10-L14 PolarHBondContact O-N 3.29Å
11	V	82.7	Confident	69.2	Low	77 Å²	77	104.6 Å²	104.6	47%	0.467	60%	0.595	S	S	.	*	H	α-helix	trans	-63.6	-40.4	177.2	172.5	0	0	0	0	111.2	T7 S9 L14 L15	T7-V11 VanDerWaalsContact O-CG2 3.31Å; T7-V11 WeakPolarHBondContact O-CG2 3.43Å; T7-V11 PolarHBondContact O-N 3.44Å; T7-V11 VanDerWaalsContact O-N 3.13Å; S9-V11 PolarHBondContact O-N 2.96Å; V11-L14 PolarHBondContact O-N 3.45Å; V11-L15 HydrophobicContact CG1-CD1 3.92Å; V11-L15 WeakPolarHBondContact O-CB 3.43Å; V11-L15 WeakPolarHBondContact O-CG 3.46Å; V11-L15 PolarHBondContact O-N 2.99Å
12	L	80.9	Confident	69.6	Low	105 Å²	105	102.2 Å²	102.2	55%	0.55	58%	0.582	S	S	.	*	H	α-helix	trans	-63.6	-42.3	175.7	-72.6	168.3	0	0	0	111.8	K8 S9 C10 L15 V16	K8-L12 WeakPolarHBondContact O-CG 3.32Å; K8-L12 PolarHBondContact O-N 3.3Å; K8-L12 VanDerWaalsContact O-N 3.16Å; S9-L12 PolarHBondContact O-N 3.06Å; C10-L12 VanDerWaalsContact C-N 3.33Å; C10-L12 PolarHBondContact O-N 3.18Å; L12-L15 PolarHBondContact O-N 3.25Å; L12-V16 WeakPolarHBondContact O-CG2 3.33Å; L12-V16 PolarHBondContact O-N 3.37Å
13	I	82.1	Confident	70.1	Confident	110 Å²	110	106.6 Å²	106.6	56%	0.564	59%	0.59	S	S	*	*	H	α-helix	trans	-63.3	-43.3	177.5	-66.1	163.1	0	0	0	111.1	S9 C10 V16 A17	S9-I13 WeakPolarHBondContact O-CG1 3.31Å; S9-I13 PolarHBondContact O-N 3.48Å; C10-I13 PolarHBondContact O-N 3.16Å; I13-V16 PolarHBondContact O-N 3.49Å; I13-A17 PolarHBondContact O-N 3.34Å
14	L	83	Confident	70.5	Confident	111 Å²	111	104.8 Å²	104.8	58%	0.581	59%	0.586	S	S	*	*	H	α-helix	trans	-64.8	-40.9	177.2	-74.9	165	0	0	0	112.2	C10 V11 A17 L18	C10-L14 WeakPolarHBondContact O-CG 3.3Å; C10-L14 PolarHBondContact O-N 3.29Å; V11-L14 PolarHBondContact O-N 3.45Å; L14-A17 PolarHBondContact O-N 2.97Å; L14-L18 VanDerWaalsContact O-CG 3.3Å; L14-L18 WeakPolarHBondContact O-CG 3.34Å; L14-L18 PolarHBondContact O-N 2.88Å
15	L	80.7	Confident	71	Confident	89 Å²	89	107.4 Å²	107.4	47%	0.466	59%	0.589	S	S	.	*	H	α-helix	trans	-60.8	-46.1	174.9	-82.8	160.5	0	0	0	111.4	V11 L12 A17 L18 L19	V11-L15 HydrophobicContact CG1-CD1 3.92Å; V11-L15 WeakPolarHBondContact O-CB 3.43Å; V11-L15 WeakPolarHBondContact O-CG 3.46Å; V11-L15 PolarHBondContact O-N 2.99Å; L12-L15 PolarHBondContact O-N 3.25Å; L15-A17 PolarHBondContact O-N 3.37Å; L15-L18 PolarHBondContact O-N 3.36Å; L15-L19 WeakPolarHBondContact O-CB 3.3Å; L15-L19 VanDerWaalsContact O-CD1 3.3Å; L15-L19 WeakPolarHBondContact O-CD1 3.44Å; L15-L19 WeakPolarHBondContact O-CG 3.37Å; L15-L19 PolarHBondContact O-N 2.99Å
16	V	80.2	Confident	71.9	Confident	87 Å²	87	101.2 Å²	101.2	53%	0.527	57%	0.565	S	S	.	*	H	α-helix	trans	-61.1	-44.2	176.6	172.9	0	0	0	0	111	L12 I13 L18 L19 C20	L12-V16 WeakPolarHBondContact O-CG2 3.33Å; L12-V16 PolarHBondContact O-N 3.37Å; I13-V16 PolarHBondContact O-N 3.49Å; V16-L18 VanDerWaalsContact C-N 3.3Å; V16-L18 PolarHBondContact O-N 3.02Å; V16-L19 PolarHBondContact O-N 3.16Å; V16-C20 WeakPolarHBondContact O-CB 3.45Å; V16-C20 PolarHBondContact O-N 3.38Å; V16-C20 PolarHBondContact O-SG 2.88Å
17	A	78.6	Confident	73.1	Confident	61 Å²	61	99.8 Å²	99.8	50%	0.504	55%	0.553	S	S	.	*	H	α-helix	trans	-61.8	-36.7	177.1	0	0	0	0	0	112.9	I13 L14 L15 A21	I13-A17 PolarHBondContact O-N 3.34Å; L14-A17 PolarHBondContact O-N 2.97Å; L15-A17 PolarHBondContact O-N 3.37Å; A17-A21 PolarHBondContact O-N 3Å
18	L	76.6	Confident	74.3	Confident	126 Å²	126	101.9 Å²	101.9	66%	0.66	56%	0.557	S	S	*	*	H	α-helix	trans	-74.3	-33.4	176.1	-70.9	168.2	0	0	0	113	L14 L15 V16 A21	L14-L18 VanDerWaalsContact O-CG 3.3Å; L14-L18 WeakPolarHBondContact O-CG 3.34Å; L14-L18 PolarHBondContact O-N 2.88Å; L15-L18 PolarHBondContact O-N 3.36Å; V16-L18 VanDerWaalsContact C-N 3.3Å; V16-L18 PolarHBondContact O-N 3.02Å; L18-A21 WeakPolarHBondContact O-CB 3.38Å; L18-A21 PolarHBondContact O-N 3.24Å
19	L	70.6	Confident	75.4	Confident	133 Å²	133	95 Å²	95	70%	0.696	53%	0.527	S	S	*	.	H	α-helix	trans	-70.1	-36.3	173.7	-78.4	151.6	0	0	0	111.4	L15 V16 A21	L15-L19 WeakPolarHBondContact O-CB 3.3Å; L15-L19 VanDerWaalsContact O-CD1 3.3Å; L15-L19 WeakPolarHBondContact O-CD1 3.44Å; L15-L19 WeakPolarHBondContact O-CG 3.37Å; L15-L19 PolarHBondContact O-N 2.99Å; V16-L19 PolarHBondContact O-N 3.16Å; L19-A21 VanDerWaalsContact C-N 3.29Å
20	C	66.3	Low	75.9	Confident	91 Å²	91	99.1 Å²	99.1	62%	0.615	54%	0.535	S	S	*	.	S	Bend	trans	-78.7	-10.6	173.6	-66	0	0	0	0	113.4	V16 E22	V16-C20 WeakPolarHBondContact O-CB 3.45Å; V16-C20 PolarHBondContact O-N 3.38Å; V16-C20 PolarHBondContact O-SG 2.88Å; C20-E22 PolarHBondContact O-N 3.27Å
21	A	64.4	Low	76.1	Confident	65 Å²	65	98.6 Å²	98.6	54%	0.537	53%	0.525	S	S	.	.	S	Bend	trans	-73.4	63.6	159.8	0	0	0	0	0	107.9	A17 L18 L19 R23	A17-A21 PolarHBondContact O-N 3Å; L18-A21 WeakPolarHBondContact O-CB 3.38Å; L18-A21 PolarHBondContact O-N 3.24Å; L19-A21 VanDerWaalsContact C-N 3.29Å; A21-R23 PolarHBondContact O-N 2.98Å; A21-R23 VanDerWaalsContact O-N 3.16Å
22	E	58.1	Low	75.9	Confident	171 Å²	171	95.9 Å²	95.9	80%	0.799	51%	0.509	S	S	*	.			trans	-47.7	126.5	165.3	-75.9	177.2	115.6	0	0	106.3	C20 A24	C20-E22 PolarHBondContact O-N 3.27Å; E22-A24 VanDerWaalsContact C-N 3.31Å; E22-A24 PolarHBondContact O-N 2.74Å
23	R	61.1	Low	75.7	Confident	204 Å²	204	96.3 Å²	96.3	77%	0.77	50%	0.504	S	S	*	.			trans	-59.2	104	177.1	-73.6	-166.9	-179.4	-134.5	1	106.6	A21 Q25	A21-R23 PolarHBondContact O-N 2.98Å; A21-R23 VanDerWaalsContact O-N 3.16Å; R23-Q25 HydrophobicContact CB-CG 4.07Å; R23-Q25 VanDerWaalsContact NH1-NE2 3.16Å; R23-Q25 PolarHBondContact O-N 2.76Å
24	A	63	Low	75.3	Confident	77 Å²	77	93.3 Å²	93.3	64%	0.636	50%	0.5	S	S	*	.			trans	-68.3	47.9	164.2	0	0	0	0	0	109.8	E22 G26 A48	E22-A24 VanDerWaalsContact C-N 3.31Å; E22-A24 PolarHBondContact O-N 2.74Å; A24-G26 VanDerWaalsContact C-N 3.25Å; A24-G26 PolarHBondContact O-N 2.83Å; A24-A48 HydrophobicContact CB-CB 3.82Å
25	Q	68.9	Low	74.9	Confident	142 Å²	142	89.8 Å²	89.8	66%	0.664	48%	0.483	S	S	*	.			trans	-68.2	97.1	163	-76.1	174.1	-8.6	0	0	104.4	R23	R23-Q25 HydrophobicContact CB-CG 4.07Å; R23-Q25 VanDerWaalsContact NH1-NE2 3.16Å; R23-Q25 PolarHBondContact O-N 2.76Å
26	G	76.3	Confident	74.7	Confident	16 Å²	16	88.4 Å²	88.4	17%	0.165	48%	0.48	C	S	.	.	P	Polyproline II helix	trans	-54.7	151.8	-179.3	0	0	0	0	0	111.4	A24 Q28 C46	A24-G26 VanDerWaalsContact C-N 3.25Å; A24-G26 PolarHBondContact O-N 2.83Å; G26-Q28 PolarHBondContact O-N 2.78Å; G26-C46 WeakPolarHBondContact CA-O 3.14Å
27	L	84.8	Confident	74.2	Confident	62 Å²	62	87.7 Å²	87.7	33%	0.325	47%	0.473	S	S	.	.	P	Polyproline II helix	trans	-55.6	136.7	178.7	-177	67.9	0	0	0	110.7	C46 F52	L27-C46 HydrophobicContact CB-CB 4.24Å; L27-C46 VanDerWaalsContact O-CB 3.28Å; L27-C46 WeakPolarHBondContact O-CB 3.3Å; L27-C46 PolarHBondContact O-N 2.03Å; L27-C46 PolarHBondContact O-SG 3.22Å; L27-F52 VanDerWaalsContact CD2-CA 3.45Å
28	Q	87.6	Confident	74.1	Confident	134 Å²	134	93.2 Å²	93.2	63%	0.626	49%	0.488	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-90.8	128.2	169.7	-79.6	-173.2	35.1	0	0	110.8	G26 V44	G26-Q28 PolarHBondContact O-N 2.78Å; Q28-V44 CarbonylContact C-O 3.55Å; Q28-V44 VanDerWaalsContact CA-O 3.31Å; Q28-V44 WeakPolarHBondContact CA-O 3.38Å
29	C	86.1	Confident	74.3	Confident	2 Å²	2	90.1 Å²	90.1	1%	0.014	47%	0.474	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.3	147.7	178.7	-64.7	0	0	0	0	110.5	A43 V44 C46 C53 P75	C29-A43 CarbonylContact O-C 3.56Å; C29-A43 WeakPolarHBondContact O-CA 3.02Å; C29-V44 PolarHBondContact N-O 3.08Å; C29-V44 WeakPolarHBondContact O-CG2 3.34Å; C29-V44 PolarHBondContact O-N 2.86Å; C29-C46 PolarHBondContact SG-SG 3.24Å; C29-C53 VanDerWaalsContact CA-SG 3.5Å; C29-C53 HydrophobicContact CB-CB 3.81Å; C29-C53 WeakPolarHBondContact CB-SG 2.99Å; C29-C53 VanDerWaalsContact SG-CA 3.58Å; C29-C53 WeakPolarHBondContact SG-CB 3.45Å; C29-C53 CovalentContact SG-SG 2.03Å; C29-C53 PolarHBondContact SG-SG 3.41Å; C29-P75 HydrophobicContact CB-CB 3.94Å; C29-P75 VanDerWaalsContact CB-O 3.23Å; C29-P75 WeakPolarHBondContact CB-O 3.17Å; C29-P75 PolarHBondContact SG-O 3.39Å
30	Y	84.9	Confident	74.9	Confident	148 Å²	148	89.2 Å²	89.2	58%	0.58	48%	0.479	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-79.3	132.4	172.3	-64.1	-72.5	0	0	0	110.8	C41 P42 A43 K73	Y30-C41 VanDerWaalsContact CD1-O 3.3Å; Y30-C41 WeakPolarHBondContact CD1-O 3.38Å; Y30-P42 CarbonylContact C-O 3.6Å; Y30-P42 WeakPolarHBondContact CA-O 3.28Å; Y30-A43 HydrophobicContact CD1-CB 4.23Å; Y30-A43 HydrophobicContact CE1-CB 4.21Å; Y30-K73 WeakPolarHBondContact O-CD 3.43Å; Y30-K73 WeakPolarHBondContact O-CE 3.4Å; Y30-K73 PolarHBondContact O-NZ 2.97Å
31	E	80.6	Confident	75.8	Confident	59 Å²	59	86 Å²	86	28%	0.276	46%	0.458	S	S	.	.			trans	-122	129	-178.7	-175.5	179.7	-126	0	0	111.6	Y33 P42 V44 P75	E31-Y33 HydrophobicContact CG-CE2 3.77Å; E31-Y33 PolarHBondContact OE1-OH 2.9Å; E31-Y33 VanDerWaalsContact OE1-OH 3.05Å; E31-P42 PolarHBondContact N-O 3.14Å; E31-P42 VanDerWaalsContact O-CD 3.28Å; E31-P42 WeakPolarHBondContact O-CD 3.34Å; E31-P42 WeakPolarHBondContact O-CG 3.33Å; E31-V44 HydrophobicContact CB-CG1 3.84Å; E31-V44 HydrophobicContact CB-CG2 3.86Å; E31-V44 WeakPolarHBondContact OE2-CG1 3.25Å; E31-P75 HydrophobicContact CB-CB 4.06Å; E31-P75 HydrophobicContact CB-CG 4.05Å; E31-P75 HydrophobicContact CG-CB 4.36Å; E31-P75 HydrophobicContact CG-CG 3.89Å; E31-P75 WeakPolarHBondContact OE1-CG 3.4Å
32	C	78.7	Confident	76.8	Confident	20 Å²	20	87.1 Å²	87.1	14%	0.135	46%	0.459	C	S	.	.			trans	-164.9	153.5	176.7	36.7	0	0	0	0	110.1	V35 C41 K73	C32-V35 HydrophobicContact CB-CG2 3.7Å; C32-C41 HydrophobicContact CB-CB 3.69Å; C32-C41 WeakPolarHBondContact CB-SG 3.44Å; C32-C41 WeakPolarHBondContact SG-CB 3.28Å; C32-C41 CovalentContact SG-SG 2.02Å; C32-C41 PolarHBondContact SG-SG 2.76Å; C32-K73 WeakPolarHBondContact O-CB 3Å
33	Y	76.7	Confident	78.1	Confident	114 Å²	114	81.5 Å²	81.5	45%	0.447	44%	0.442	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.2	130.8	-174	-61.6	-82.9	0	0	0	109.7	E31 V35 Y72 K73	E31-Y33 HydrophobicContact CG-CE2 3.77Å; E31-Y33 PolarHBondContact OE1-OH 2.9Å; E31-Y33 VanDerWaalsContact OE1-OH 3.05Å; Y33-V35 PolarHBondContact O-N 2.91Å; Y33-Y72 HydrophobicContact CD1-CD2 4.23Å; Y33-Y72 HydrophobicContact CD1-CE2 4.07Å; Y33-K73 WeakPolarHBondContact CE1-O 3.47Å; Y33-K73 VanDerWaalsContact CZ-O 3.29Å; Y33-K73 PolarHBondContact OH-O 3.47Å
34	G	73.6	Confident	79.3	Confident	47 Å²	47	73.5 Å²	73.5	49%	0.485	42%	0.415	S	S	.	.	E	Extended strand (participates in β ladder)	trans	74.5	10.3	169.1	0	0	0	0	0	114.2	D71	G34-D71 PolarHBondContact N-O 3.05Å
35	V	75.4	Confident	80.5	Confident	37 Å²	37	74.6 Å²	74.6	22%	0.224	41%	0.414	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.5	149.6	-174.6	-60.9	0	0	0	0	111.5	C32 Y33 T39 D71	C32-V35 HydrophobicContact CB-CG2 3.7Å; Y33-V35 PolarHBondContact O-N 2.91Å; V35-T39 HydrophobicContact CB-CG2 4.07Å; V35-T39 HydrophobicContact CG1-CG2 4.3Å; V35-T39 HydrophobicContact CG2-CG2 4.33Å; V35-D71 PolarHBondContact O-N 2.92Å
36	P	75.9	Confident	81.2	Confident	61 Å²	61	68.2 Å²	68.2	40%	0.396	39%	0.386	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-56.5	146.4	168.2	-19.6	27.9	0	0	0	111.8	E38 T39 L68	P36-E38 PolarHBondContact O-N 2.02Å; P36-E38 VanDerWaalsContact O-N 3.08Å; P36-T39 WeakPolarHBondContact CD-OG1 3.42Å; P36-T39 WeakPolarHBondContact O-CB 3.31Å; P36-T39 PolarHBondContact O-N 3.14Å; P36-T39 PolarHBondContact O-OG1 3.36Å; P36-L68 HydrophobicContact CB-CD1 4.42Å; P36-L68 HydrophobicContact CG-CD1 4.16Å
37	I	70.6	Confident	81.6	Confident	72 Å²	72	76.9 Å²	76.9	37%	0.369	41%	0.413	S	S	.	.	T	Hydrogen-bonded Turn	trans	-48.8	-36.8	177.6	-78.1	172.1	0	0	0	113.4	T39 R69 D71	I37-T39 PolarHBondContact O-N 3.38Å; I37-R69 HydrophobicContact CD1-CB 3.6Å; I37-R69 HydrophobicContact CD1-CG 4.33Å; I37-R69 HydrophobicContact CG1-CB 4.17Å; I37-D71 WeakPolarHBondContact CG1-OD2 2.99Å
38	E	75.9	Confident	81.1	Confident	177 Å²	177	77.5 Å²	77.5	83%	0.827	43%	0.427	S	S	*	.	T	Hydrogen-bonded Turn	trans	-75.7	-0.2	-177.5	-53.3	-55.8	148.8	0	0	113.6	P36	P36-E38 PolarHBondContact O-N 2.02Å; P36-E38 VanDerWaalsContact O-N 3.08Å
39	T	81.5	Confident	80.7	Confident	60 Å²	60	74.6 Å²	74.6	37%	0.368	42%	0.422	S	S	.	.	S	Bend	trans	-81.1	128.9	-178.8	-48.7	0	0	0	0	110.1	V35 P36 I37 C41	V35-T39 HydrophobicContact CB-CG2 4.07Å; V35-T39 HydrophobicContact CG1-CG2 4.3Å; V35-T39 HydrophobicContact CG2-CG2 4.33Å; P36-T39 WeakPolarHBondContact CD-OG1 3.42Å; P36-T39 WeakPolarHBondContact O-CB 3.31Å; P36-T39 PolarHBondContact O-N 3.14Å; P36-T39 PolarHBondContact O-OG1 3.36Å; I37-T39 PolarHBondContact O-N 3.38Å; T39-C41 PolarHBondContact O-N 3.44Å; T39-C41 PolarHBondContact O-SG 3.47Å
40	S	83.4	Confident	80.5	Confident	115 Å²	115	75.7 Å²	75.7	80%	0.804	43%	0.427	S	S	*	.			trans	-65.5	131.2	171.1	-175.3	0	0	0	0	110.6
41	C	83.2	Confident	80.3	Confident	24 Å²	24	70.5 Å²	70.5	16%	0.162	42%	0.419	C	S	.	.			trans	-110.4	142.8	-179.4	-57.7	0	0	0	0	111.6	Y30 C32 T39	Y30-C41 VanDerWaalsContact CD1-O 3.3Å; Y30-C41 WeakPolarHBondContact CD1-O 3.38Å; C32-C41 HydrophobicContact CB-CB 3.69Å; C32-C41 WeakPolarHBondContact CB-SG 3.44Å; C32-C41 WeakPolarHBondContact SG-CB 3.28Å; C32-C41 CovalentContact SG-SG 2.02Å; C32-C41 PolarHBondContact SG-SG 2.76Å; T39-C41 PolarHBondContact O-N 3.44Å; T39-C41 PolarHBondContact O-SG 3.47Å
42	P	85.6	Confident	80.4	Confident	88 Å²	88	71.9 Å²	71.9	57%	0.571	42%	0.424	S	S	*	.			trans	-65.8	150.7	172.5	28.8	-35.8	0	0	0	111.5	Y30 E31	Y30-P42 CarbonylContact C-O 3.6Å; Y30-P42 WeakPolarHBondContact CA-O 3.28Å; E31-P42 PolarHBondContact N-O 3.14Å; E31-P42 VanDerWaalsContact O-CD 3.28Å; E31-P42 WeakPolarHBondContact O-CD 3.34Å; E31-P42 WeakPolarHBondContact O-CG 3.33Å
43	A	86.5	Confident	80.8	Confident	53 Å²	53	73.7 Å²	73.7	44%	0.438	44%	0.436	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.9	141.2	170.8	0	0	0	0	0	110.6	C29 Y30	C29-A43 CarbonylContact O-C 3.56Å; C29-A43 WeakPolarHBondContact O-CA 3.02Å; Y30-A43 HydrophobicContact CD1-CB 4.23Å; Y30-A43 HydrophobicContact CE1-CB 4.21Å
44	V	86.6	Confident	81.1	Confident	35 Å²	35	70.7 Å²	70.7	21%	0.212	43%	0.428	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.3	147.8	174.5	-60.8	0	0	0	0	110.2	Q28 C29 E31 P75	Q28-V44 CarbonylContact C-O 3.55Å; Q28-V44 VanDerWaalsContact CA-O 3.31Å; Q28-V44 WeakPolarHBondContact CA-O 3.38Å; C29-V44 PolarHBondContact N-O 3.08Å; C29-V44 WeakPolarHBondContact O-CG2 3.34Å; C29-V44 PolarHBondContact O-N 2.86Å; E31-V44 HydrophobicContact CB-CG1 3.84Å; E31-V44 HydrophobicContact CB-CG2 3.86Å; E31-V44 WeakPolarHBondContact OE2-CG1 3.25Å; V44-P75 HydrophobicContact CG2-CB 3.95Å; V44-P75 HydrophobicContact CG2-CG 3.96Å
45	T	87.8	Confident	81.3	Confident	100 Å²	100	71.2 Å²	71.2	61%	0.613	43%	0.427	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-92.2	117.3	174.5	-53.8	0	0	0	0	109.5
46	C	84.3	Confident	81.2	Confident	9 Å²	9	74.4 Å²	74.4	6%	0.061	44%	0.439	C	S	.	.	P	Polyproline II helix	trans	-73.5	168.5	176.6	-61.2	0	0	0	0	112.1	G26 L27 C29 D50 C76	G26-C46 WeakPolarHBondContact CA-O 3.14Å; L27-C46 HydrophobicContact CB-CB 4.24Å; L27-C46 VanDerWaalsContact O-CB 3.28Å; L27-C46 WeakPolarHBondContact O-CB 3.3Å; L27-C46 PolarHBondContact O-N 2.03Å; L27-C46 PolarHBondContact O-SG 3.22Å; C29-C46 PolarHBondContact SG-SG 3.24Å; C46-D50 HydrophobicContact CB-CB 3.76Å; C46-C76 WeakPolarHBondContact CA-SG 3.35Å; C46-C76 HydrophobicContact CB-CB 3.61Å; C46-C76 WeakPolarHBondContact CB-SG 2.91Å; C46-C76 WeakPolarHBondContact SG-CB 3.23Å; C46-C76 CovalentContact SG-SG 2.02Å; C46-C76 PolarHBondContact SG-SG 2.75Å
47	R	83.5	Confident	81.1	Confident	198 Å²	198	75.9 Å²	75.9	75%	0.747	44%	0.444	S	S	*	.	P	Polyproline II helix	trans	-70	158	173	-62.9	-178.9	-176.4	153.6	2.7	109.2	S49 D50	R47-S49 PolarHBondContact O-N 2.02Å; R47-S49 VanDerWaalsContact O-N 3.14Å; R47-D50 WeakPolarHBondContact CB-OD2 3.25Å; R47-D50 PolarHBondContact N-OD2 3.14Å; R47-D50 WeakPolarHBondContact O-CB 3.06Å; R47-D50 PolarHBondContact O-N 3.01Å
48	A	74.8	Confident	81.1	Confident	74 Å²	74	76 Å²	76	61%	0.612	45%	0.445	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.7	-22.3	177.8	0	0	0	0	0	113.7	A24 D50	A24-A48 HydrophobicContact CB-CB 3.82Å; A48-D50 VanDerWaalsContact C-N 3.29Å
49	S	79.2	Confident	80.8	Confident	73 Å²	73	73.1 Å²	73.1	51%	0.51	43%	0.431	S	S	.	.	T	Hydrogen-bonded Turn	trans	-74.5	-17.8	174.6	54.9	0	0	0	0	113.7	R47 P78 V79	R47-S49 PolarHBondContact O-N 2.02Å; R47-S49 VanDerWaalsContact O-N 3.14Å; S49-P78 WeakPolarHBondContact O-CA 3.07Å; S49-V79 PolarHBondContact O-N 3.12Å
50	D	82.5	Confident	80	Confident	25 Å²	25	74.3 Å²	74.3	13%	0.134	44%	0.435	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.3	126	-178.4	-58.1	-48.4	0	0	0	110	C46 R47 A48 C76 S77	C46-D50 HydrophobicContact CB-CB 3.76Å; R47-D50 WeakPolarHBondContact CB-OD2 3.25Å; R47-D50 PolarHBondContact N-OD2 3.14Å; R47-D50 WeakPolarHBondContact O-CB 3.06Å; R47-D50 PolarHBondContact O-N 3.01Å; A48-D50 VanDerWaalsContact C-N 3.29Å; D50-C76 HydrophobicContact CB-CB 3.96Å; D50-C76 WeakPolarHBondContact OD2-CB 3.38Å; D50-S77 CarbonylContact C-O 3.59Å; D50-S77 VanDerWaalsContact CA-O 3.25Å; D50-S77 WeakPolarHBondContact CA-O 3Å
51	G	79.9	Confident	79.2	Confident	39 Å²	39	75.5 Å²	75.5	40%	0.402	43%	0.431	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.9	-11.5	-177.2	0	0	0	0	0	115.1	S77 V79	G51-S77 PolarHBondContact N-O 3.23Å; G51-V79 VanDerWaalsContact CA-CG2 3.47Å
52	F	83.8	Confident	77.9	Confident	89 Å²	89	80.2 Å²	80.2	39%	0.39	45%	0.451	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-151.9	155.8	-178.9	56.6	-84.4	0	0	0	112.8	L27 I54 S77 P78	L27-F52 VanDerWaalsContact CD2-CA 3.45Å; F52-I54 HydrophobicContact CD2-CD1 4.36Å; F52-I54 HydrophobicContact CD2-CG1 3.79Å; F52-I54 HydrophobicContact CE2-CD1 3.73Å; F52-I54 HydrophobicContact CE2-CG1 3.67Å; F52-S77 VanDerWaalsContact CE2-CB 3.43Å; F52-S77 WeakPolarHBondContact CE2-OG 3.36Å; F52-S77 WeakPolarHBondContact CZ-OG 3.41Å; F52-S77 PolarHBondContact O-N 3.19Å; F52-S77 VanDerWaalsContact O-N 3.12Å; F52-P78 VanDerWaalsContact CE1-O 3.22Å; F52-P78 WeakPolarHBondContact CE1-O 3.39Å
53	C	85.6	Confident	76.6	Confident	58 Å²	58	78.8 Å²	78.8	39%	0.392	45%	0.452	S	S	.	.			trans	-93.3	135.4	174.4	-47.6	0	0	0	0	110.8	C29 P75	C29-C53 VanDerWaalsContact CA-SG 3.5Å; C29-C53 HydrophobicContact CB-CB 3.81Å; C29-C53 WeakPolarHBondContact CB-SG 2.99Å; C29-C53 VanDerWaalsContact SG-CA 3.58Å; C29-C53 WeakPolarHBondContact SG-CB 3.45Å; C29-C53 CovalentContact SG-SG 2.03Å; C29-C53 PolarHBondContact SG-SG 3.41Å; C53-P75 VanDerWaalsContact CA-O 3.25Å; C53-P75 WeakPolarHBondContact CA-O 2.99Å
54	I	83.4	Confident	75.5	Confident	51 Å²	51	82 Å²	82	26%	0.262	47%	0.471	S	S	.	.			trans	-110.1	135.3	175.8	-56.7	-179.7	0	0	0	110	F52 Q56 K73 S77	F52-I54 HydrophobicContact CD2-CD1 4.36Å; F52-I54 HydrophobicContact CD2-CG1 3.79Å; F52-I54 HydrophobicContact CE2-CD1 3.73Å; F52-I54 HydrophobicContact CE2-CG1 3.67Å; I54-Q56 HydrophobicContact CG2-CG 4.31Å; I54-K73 VanDerWaalsContact O-CD 3.28Å; I54-K73 WeakPolarHBondContact O-CD 3.45Å; I54-K73 WeakPolarHBondContact O-CE 3.22Å; I54-K73 VanDerWaalsContact O-CG 3.3Å; I54-K73 WeakPolarHBondContact O-CG 3.16Å; I54-S77 VanDerWaalsContact CD1-CB 3.41Å
55	A	77.9	Confident	74	Confident	57 Å²	57	89.6 Å²	89.6	47%	0.471	50%	0.504	S	S	.	.			trans	-116.6	140.4	165.6	0	0	0	0	0	109.3	K73	A55-K73 HydrophobicContact CB-CD 4.3Å
56	Q	73.6	Confident	72.5	Confident	104 Å²	104	88.1 Å²	88.1	49%	0.486	50%	0.498	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.5	123.1	170.7	-62	180	43.9	0	0	109.3	I54 D71 Y72	I54-Q56 HydrophobicContact CG2-CG 4.31Å; Q56-D71 CarbonylContact O-C 3.6Å; Q56-D71 WeakPolarHBondContact O-CA 3.39Å; Q56-Y72 WeakPolarHBondContact CB-O 3.3Å; Q56-Y72 PolarHBondContact N-O 2.89Å; Q56-Y72 PolarHBondContact O-N 2.88Å
57	N	73.1	Confident	71.4	Confident	92 Å²	92	94.1 Å²	94.1	49%	0.492	53%	0.529	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.4	119.6	177.5	-59.5	70.9	0	0	0	109	I70 D71	N57-I70 CarbonylContact C-O 3.56Å; N57-D71 PolarHBondContact ND2-OD1 3.07Å; N57-D71 PolarHBondContact ND2-OD2 3.17Å; N57-D71 PolarHBondContact OD1-OD1 3.01Å; N57-D71 VanDerWaalsContact OD1-OD1 3.07Å
58	I	69.9	Low	70.2	Confident	76 Å²	76	87.4 Å²	87.4	39%	0.39	51%	0.508	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.1	119.9	171.4	-54.3	177.1	0	0	0	107.3	L60 I70 Y72	I58-L60 HydrophobicContact CG2-CD1 4.08Å; I58-L60 PolarHBondContact O-N 3.48Å; I58-I70 PolarHBondContact N-O 2.87Å; I58-I70 PolarHBondContact O-N 3.44Å; I58-Y72 HydrophobicContact CD1-CG 4.46Å
59	E	70.5	Confident	69.6	Low	116 Å²	116	90.4 Å²	90.4	54%	0.542	50%	0.503	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.9	109	170.9	-54.5	-162.3	142.3	0	0	108.4	R69	E59-R69 HydrophobicContact CG-CG 4.17Å; E59-R69 IonicContact OE1-CZ 3.19Å; E59-R69 IonicContact OE1-NE 2.75Å; E59-R69 PolarHBondContact OE1-NE 3.4Å; E59-R69 IonicContact OE1-NH2 2.8Å; E59-R69 PolarHBondContact OE1-NH2 2.77Å
60	L	65.6	Low	68.8	Low	84 Å²	84	88 Å²	88	44%	0.44	49%	0.485	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92	115.6	170.8	-124.9	87.3	0	0	0	108.6	I58 E62 L68 I70	I58-L60 HydrophobicContact CG2-CD1 4.08Å; I58-L60 PolarHBondContact O-N 3.48Å; L60-E62 PolarHBondContact O-N 3.19Å; L60-L68 PolarHBondContact N-O 2.75Å; L60-L68 PolarHBondContact O-N 3.43Å; L60-L68 VanDerWaalsContact O-N 3.17Å; L60-I70 HydrophobicContact CB-CD1 4.07Å; L60-I70 HydrophobicContact CD1-CD1 4.38Å; L60-I70 HydrophobicContact CD2-CD1 4.3Å; L60-I70 HydrophobicContact CG-CD1 4.48Å
61	I	64.9	Low	67.8	Low	140 Å²	140	88.1 Å²	88.1	72%	0.718	49%	0.485	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-85.4	89.1	169.9	-54.5	173.2	0	0	0	106.9
62	E	57.8	Low	66.6	Low	124 Å²	124	92.5 Å²	92.5	58%	0.579	49%	0.49	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-87.4	130.6	168.1	-159.8	168.5	-164.4	0	0	108.3	L60	L60-E62 PolarHBondContact O-N 3.19Å
63	G	58	Low	65.4	Low	58 Å²	58	89.5 Å²	89.5	60%	0.598	48%	0.477	S	S	*	.	T	Hydrogen-bonded Turn	trans	-48.2	149.6	-156.9	0	0	0	0	0	118.6	H65	G63-H65 PolarHBondContact O-N 2.92Å
64	S	61.8	Low	64.4	Low	121 Å²	121	89.1 Å²	89.1	85%	0.846	48%	0.475	S	S	*	.	T	Hydrogen-bonded Turn	trans	66.4	-24.6	168.3	69.3	0	0	0	0	121.4
65	H	55.3	Low	63.8	Low	194 Å²	194	87.3 Å²	87.3	90%	0.898	47%	0.467	S	S	*	.	T	Hydrogen-bonded Turn	trans	-163.2	8.1	172.1	-99.9	143.1	0	0	0	119.7	G63	G63-H65 PolarHBondContact O-N 2.92Å
66	S	58	Low	64.1	Low	69 Å²	69	86.2 Å²	86.2	48%	0.483	46%	0.455	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.9	105.6	178.4	47.2	0	0	0	0	111.8	L68	S66-L68 VanDerWaalsContact C-N 3.33Å; S66-L68 PolarHBondContact O-N 2.81Å
67	N	59.4	Low	64.4	Low	135 Å²	135	82 Å²	82	72%	0.722	44%	0.437	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-68.4	94.6	162.3	-67.3	-41.1	0	0	0	107.3	R69	N67-R69 PolarHBondContact O-N 3.08Å
68	L	59.9	Low	64.6	Low	57 Å²	57	79.8 Å²	79.8	30%	0.298	43%	0.428	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.5	107	176.8	-176.2	64.2	0	0	0	108.1	P36 L60 S66 I70	P36-L68 HydrophobicContact CB-CD1 4.42Å; P36-L68 HydrophobicContact CG-CD1 4.16Å; L60-L68 PolarHBondContact N-O 2.75Å; L60-L68 PolarHBondContact O-N 3.43Å; L60-L68 VanDerWaalsContact O-N 3.17Å; S66-L68 VanDerWaalsContact C-N 3.33Å; S66-L68 PolarHBondContact O-N 2.81Å; L68-I70 HydrophobicContact CD2-CD1 3.85Å; L68-I70 HydrophobicContact CD2-CG1 3.96Å; L68-I70 HydrophobicContact CG-CD1 4.23Å; L68-I70 HydrophobicContact CG-CG1 3.8Å
69	R	62.3	Low	64.8	Low	136 Å²	136	80.4 Å²	80.4	51%	0.513	44%	0.435	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.9	116.6	169.4	-71.8	-171.9	171.7	165.2	-1.2	109	I37 E59 N67	I37-R69 HydrophobicContact CD1-CB 3.6Å; I37-R69 HydrophobicContact CD1-CG 4.33Å; I37-R69 HydrophobicContact CG1-CB 4.17Å; E59-R69 HydrophobicContact CG-CG 4.17Å; E59-R69 IonicContact OE1-CZ 3.19Å; E59-R69 IonicContact OE1-NE 2.75Å; E59-R69 PolarHBondContact OE1-NE 3.4Å; E59-R69 IonicContact OE1-NH2 2.8Å; E59-R69 PolarHBondContact OE1-NH2 2.77Å; N67-R69 PolarHBondContact O-N 3.08Å
70	I	61.3	Low	64.5	Low	24 Å²	24	85.1 Å²	85.1	12%	0.123	45%	0.448	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.1	131.1	179.3	-63.9	-177.1	0	0	0	108.3	N57 I58 L60 L68	N57-I70 CarbonylContact C-O 3.56Å; I58-I70 PolarHBondContact N-O 2.87Å; I58-I70 PolarHBondContact O-N 3.44Å; L60-I70 HydrophobicContact CB-CD1 4.07Å; L60-I70 HydrophobicContact CD1-CD1 4.38Å; L60-I70 HydrophobicContact CD2-CD1 4.3Å; L60-I70 HydrophobicContact CG-CD1 4.48Å; L68-I70 HydrophobicContact CD2-CD1 3.85Å; L68-I70 HydrophobicContact CD2-CG1 3.96Å; L68-I70 HydrophobicContact CG-CD1 4.23Å; L68-I70 HydrophobicContact CG-CG1 3.8Å
71	D	62.2	Low	63.9	Low	26 Å²	26	92.1 Å²	92.1	14%	0.139	49%	0.486	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89	128.2	166.8	-81.7	-56.5	0	0	0	110.9	G34 V35 I37 Q56 N57	G34-D71 PolarHBondContact N-O 3.05Å; V35-D71 PolarHBondContact O-N 2.92Å; I37-D71 WeakPolarHBondContact CG1-OD2 2.99Å; Q56-D71 CarbonylContact O-C 3.6Å; Q56-D71 WeakPolarHBondContact O-CA 3.39Å; N57-D71 PolarHBondContact ND2-OD1 3.07Å; N57-D71 PolarHBondContact ND2-OD2 3.17Å; N57-D71 PolarHBondContact OD1-OD1 3.01Å; N57-D71 VanDerWaalsContact OD1-OD1 3.07Å
72	Y	54.4	Low	63.8	Low	131 Å²	131	89.7 Å²	89.7	51%	0.514	47%	0.474	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.3	110.8	168.3	-163.6	-88.9	0	0	0	108.1	Y33 Q56 I58	Y33-Y72 HydrophobicContact CD1-CD2 4.23Å; Y33-Y72 HydrophobicContact CD1-CE2 4.07Å; Q56-Y72 WeakPolarHBondContact CB-O 3.3Å; Q56-Y72 PolarHBondContact N-O 2.89Å; Q56-Y72 PolarHBondContact O-N 2.88Å; I58-Y72 HydrophobicContact CD1-CG 4.46Å
73	K	59.4	Low	64.1	Low	27 Å²	27	87.9 Å²	87.9	12%	0.117	47%	0.469	C	S	.	.			trans	-109.1	117.4	-171.3	-164.5	125.1	-179.7	-156.1	0	112.1	Y30 C32 Y33 I54 A55 P75	Y30-K73 WeakPolarHBondContact O-CD 3.43Å; Y30-K73 WeakPolarHBondContact O-CE 3.4Å; Y30-K73 PolarHBondContact O-NZ 2.97Å; C32-K73 WeakPolarHBondContact O-CB 3Å; Y33-K73 WeakPolarHBondContact CE1-O 3.47Å; Y33-K73 VanDerWaalsContact CZ-O 3.29Å; Y33-K73 PolarHBondContact OH-O 3.47Å; I54-K73 VanDerWaalsContact O-CD 3.28Å; I54-K73 WeakPolarHBondContact O-CD 3.45Å; I54-K73 WeakPolarHBondContact O-CE 3.22Å; I54-K73 VanDerWaalsContact O-CG 3.3Å; I54-K73 WeakPolarHBondContact O-CG 3.16Å; A55-K73 HydrophobicContact CB-CD 4.3Å; K73-P75 HydrophobicContact CG-CB 4.01Å; K73-P75 WeakPolarHBondContact O-CD 3.28Å
74	S	63.9	Low	64.5	Low	50 Å²	50	89.6 Å²	89.6	35%	0.35	46%	0.461	S	S	.	.			trans	-87.1	99.5	146.8	60.9	0	0	0	0	106.3	C76	S74-C76 PolarHBondContact O-N 3.43Å; S74-C76 VanDerWaalsContact O-N 3.14Å
75	P	70.9	Confident	64.6	Low	12 Å²	12	87.7 Å²	87.7	8%	0.078	44%	0.439	C	S	.	.			trans	-67.3	-20.4	-164.3	26.1	-35.8	0	0	0	113.7	C29 E31 V44 C53 K73	C29-P75 HydrophobicContact CB-CB 3.94Å; C29-P75 VanDerWaalsContact CB-O 3.23Å; C29-P75 WeakPolarHBondContact CB-O 3.17Å; C29-P75 PolarHBondContact SG-O 3.39Å; E31-P75 HydrophobicContact CB-CB 4.06Å; E31-P75 HydrophobicContact CB-CG 4.05Å; E31-P75 HydrophobicContact CG-CB 4.36Å; E31-P75 HydrophobicContact CG-CG 3.89Å; E31-P75 WeakPolarHBondContact OE1-CG 3.4Å; V44-P75 HydrophobicContact CG2-CB 3.95Å; V44-P75 HydrophobicContact CG2-CG 3.96Å; C53-P75 VanDerWaalsContact CA-O 3.25Å; C53-P75 WeakPolarHBondContact CA-O 2.99Å; K73-P75 HydrophobicContact CG-CB 4.01Å; K73-P75 WeakPolarHBondContact O-CD 3.28Å
76	C	83.5	Confident	65.2	Low	34 Å²	34	81.1 Å²	81.1	23%	0.23	41%	0.41	C	S	.	.			trans	-130.5	133.6	-169.5	-49.8	0	0	0	0	110.2	C46 D50 S74	C46-C76 WeakPolarHBondContact CA-SG 3.35Å; C46-C76 HydrophobicContact CB-CB 3.61Å; C46-C76 WeakPolarHBondContact CB-SG 2.91Å; C46-C76 WeakPolarHBondContact SG-CB 3.23Å; C46-C76 CovalentContact SG-SG 2.02Å; C46-C76 PolarHBondContact SG-SG 2.75Å; D50-C76 HydrophobicContact CB-CB 3.96Å; D50-C76 WeakPolarHBondContact OD2-CB 3.38Å; S74-C76 PolarHBondContact O-N 3.43Å; S74-C76 VanDerWaalsContact O-N 3.14Å
77	S	81.2	Confident	65.7	Low	16 Å²	16	81.9 Å²	81.9	11%	0.112	41%	0.405	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.4	139.9	173.4	-178.5	0	0	0	0	111.6	D50 G51 F52 I54	D50-S77 CarbonylContact C-O 3.59Å; D50-S77 VanDerWaalsContact CA-O 3.25Å; D50-S77 WeakPolarHBondContact CA-O 3Å; G51-S77 PolarHBondContact N-O 3.23Å; F52-S77 VanDerWaalsContact CE2-CB 3.43Å; F52-S77 WeakPolarHBondContact CE2-OG 3.36Å; F52-S77 WeakPolarHBondContact CZ-OG 3.41Å; F52-S77 PolarHBondContact O-N 3.19Å; F52-S77 VanDerWaalsContact O-N 3.12Å; I54-S77 VanDerWaalsContact CD1-CB 3.41Å
78	P	76.8	Confident	66.2	Low	46 Å²	46	78.1 Å²	78.1	30%	0.299	38%	0.383	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.1	148.9	176.3	26.2	-32.5	0	0	0	111.9	S49 F52 W80	S49-P78 WeakPolarHBondContact O-CA 3.07Å; F52-P78 VanDerWaalsContact CE1-O 3.22Å; F52-P78 WeakPolarHBondContact CE1-O 3.39Å; P78-W80 HydrophobicContact CG-CZ2 3.88Å; P78-W80 VanDerWaalsContact O-CD1 3.23Å; P78-W80 PolarHBondContact O-NE1 2.8Å
79	V	73.2	Confident	66.6	Low	88 Å²	88	79.7 Å²	79.7	53%	0.533	39%	0.389	S	S	.	.			trans	-74.3	125.4	163.1	-176.8	0	0	0	0	107.6	S49 G51	S49-V79 PolarHBondContact O-N 3.12Å; G51-V79 VanDerWaalsContact CA-CG2 3.47Å
80	W	65.1	Low	67	Low	215 Å²	215	75 Å²	75	81%	0.814	38%	0.379	S	S	*	.			trans	-102.2	114.7	169.5	-48.6	76.5	0	0	0	105.8	P78	P78-W80 HydrophobicContact CG-CZ2 3.88Å; P78-W80 VanDerWaalsContact O-CD1 3.23Å; P78-W80 PolarHBondContact O-NE1 2.8Å
81	D	52	Low	67.5	Low	231 Å²	231	79.6 Å²	79.6	100%	1.235	40%	0.402	S	S	*	.			trans	-81.5	0	168.7	-112.1	-64.1	0	0	0	110.3

Retrieved 81 of 81 residues in 118.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).