A0A087WRH6_MOUSE Loading...

COP9 signalosome subunit 5

AlphaFold DB , UniProt , Accession A0A087WRH6, Species MOUSE (Mus musculus, Mouse), Gene Cops5, Length 48 aa.

						>A0A087WRH6_MOUSE|A0A087WRH6|Cops5
MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.8	Very low	70.9	Confident	245 Å²	245	104 Å²	104	100%	1.207	65%	0.646	S	S	*	*				0	120.8	0	-68.6	-158.1	-176.8	0	107.7
2	A	48.9	Very low	72.4	Confident	87 Å²	87	102.7 Å²	102.7	72%	0.719	64%	0.638	S	S	*	*			trans	-65.2	140.1	-175.3	0	0	0	0	110.8	S4	A2-S4 VanDerWaalsContact C-N 3.32Å; A2-S4 PolarHBondContact O-N 2.66Å; A2-S4 PolarHBondContact O-OG 3.3Å
3	A	50.6	Low	73.9	Confident	79 Å²	79	106.9 Å²	106.9	65%	0.653	64%	0.635	S	S	*	*			trans	-55	90.5	177.9	0	0	0	0	110.9	G5 S6	A3-G5 VanDerWaalsContact C-N 3.25Å; A3-G5 PolarHBondContact O-N 3.24Å; A3-S6 WeakPolarHBondContact CB-OG 3.38Å
4	S	60.6	Low	75	Confident	127 Å²	127	103.9 Å²	103.9	89%	0.888	61%	0.611	S	S	*	*	S	Bend	trans	-83.2	70.5	-174.3	-56.6	0	0	0	108.9	A2	A2-S4 VanDerWaalsContact C-N 3.32Å; A2-S4 PolarHBondContact O-N 2.66Å; A2-S4 PolarHBondContact O-OG 3.3Å
5	G	64.2	Low	75.9	Confident	37 Å²	37	106.1 Å²	106.1	38%	0.381	62%	0.618	S	S	.	*	S	Bend	trans	155.8	-22.9	172.4	0	0	0	0	116.4	A3 G7 M8 A9	A3-G5 VanDerWaalsContact C-N 3.25Å; A3-G5 PolarHBondContact O-N 3.24Å; G5-G7 PolarHBondContact O-N 2.91Å; G5-M8 PolarHBondContact O-N 3.01Å; G5-A9 WeakPolarHBondContact O-CB 3.16Å; G5-A9 PolarHBondContact O-N 3.46Å
6	S	77.2	Confident	76.7	Confident	78 Å²	78	104 Å²	104	55%	0.545	62%	0.617	S	S	.	*	H	α-helix	trans	-62.6	-44.3	-174.4	56.4	0	0	0	112.8	A3 M8 A9 Q10	A3-S6 WeakPolarHBondContact CB-OG 3.38Å; S6-M8 VanDerWaalsContact C-N 3.34Å; S6-M8 PolarHBondContact O-N 3.36Å; S6-A9 PolarHBondContact O-N 2.92Å; S6-Q10 PolarHBondContact O-N 3.41Å; S6-Q10 VanDerWaalsContact O-N 3.1Å
7	G	84.1	Confident	77.5	Confident	38 Å²	38	102.8 Å²	102.8	39%	0.392	61%	0.607	S	S	.	*	H	α-helix	trans	-69.1	-28.1	179.4	0	0	0	0	114.2	G5 K11	G5-G7 PolarHBondContact O-N 2.91Å; G7-K11 WeakPolarHBondContact O-CG 3.22Å; G7-K11 PolarHBondContact O-N 3.12Å
8	M	88.5	Confident	78.1	Confident	136 Å²	136	104.8 Å²	104.8	67%	0.67	62%	0.615	S	S	*	*	H	α-helix	trans	-79.6	-42.8	176	-75.9	-64.9	-71.9	0	111.4	G5 S6 Q10 K11 T12	G5-M8 PolarHBondContact O-N 3.01Å; S6-M8 VanDerWaalsContact C-N 3.34Å; S6-M8 PolarHBondContact O-N 3.36Å; M8-Q10 VanDerWaalsContact C-N 3.28Å; M8-Q10 PolarHBondContact O-N 3.47Å; M8-K11 PolarHBondContact O-N 2.91Å; M8-T12 PolarHBondContact O-N 3.31Å; M8-T12 PolarHBondContact O-OG1 3.18Å; M8-T12 VanDerWaalsContact O-OG1 3.12Å
9	A	87.6	Confident	78.5	Confident	61 Å²	61	104.7 Å²	104.7	50%	0.504	61%	0.609	S	S	.	*	H	α-helix	trans	-59.4	-39.7	176.4	0	0	0	0	112	G5 S6 T12 W13	G5-A9 WeakPolarHBondContact O-CB 3.16Å; G5-A9 PolarHBondContact O-N 3.46Å; S6-A9 PolarHBondContact O-N 2.92Å; A9-T12 PolarHBondContact O-N 3.31Å; A9-W13 WeakPolarHBondContact O-CB 3.23Å; A9-W13 PolarHBondContact O-N 2.95Å
10	Q	87.2	Confident	78.7	Confident	117 Å²	117	108.7 Å²	108.7	55%	0.547	62%	0.621	S	S	.	*	H	α-helix	trans	-60	-51.3	175.1	-179.1	180	-14.8	0	111.8	S6 M8 T12 W13 E14	S6-Q10 PolarHBondContact O-N 3.41Å; S6-Q10 VanDerWaalsContact O-N 3.1Å; M8-Q10 VanDerWaalsContact C-N 3.28Å; M8-Q10 PolarHBondContact O-N 3.47Å; Q10-T12 VanDerWaalsContact C-N 3.29Å; Q10-T12 PolarHBondContact O-N 3.48Å; Q10-W13 WeakPolarHBondContact O-CB 3.4Å; Q10-W13 PolarHBondContact O-N 3.15Å; Q10-W13 VanDerWaalsContact O-N 3.08Å; Q10-E14 VanDerWaalsContact CG-OE1 3.27Å; Q10-E14 WeakPolarHBondContact CG-OE1 3.34Å; Q10-E14 PolarHBondContact NE2-OE1 3.01Å; Q10-E14 WeakPolarHBondContact O-CG 3.48Å; Q10-E14 PolarHBondContact O-N 2.98Å
11	K	87	Confident	78.7	Confident	139 Å²	139	112 Å²	112	60%	0.604	63%	0.631	S	S	*	*	H	α-helix	trans	-61.3	-37.1	179	-70.3	179.1	179.7	-171.3	112.7	G7 M8 W13 L15	G7-K11 WeakPolarHBondContact O-CG 3.22Å; G7-K11 PolarHBondContact O-N 3.12Å; M8-K11 PolarHBondContact O-N 2.91Å; K11-W13 VanDerWaalsContact C-N 3.35Å; K11-L15 WeakPolarHBondContact O-CB 3.34Å; K11-L15 PolarHBondContact O-N 3.24Å
12	T	88.8	Confident	80.4	Confident	88 Å²	88	102.3 Å²	102.3	54%	0.54	59%	0.59	S	S	.	*	H	α-helix	trans	-64.9	-39.9	174.6	-58.8	0	0	0	111.7	M8 A9 Q10 L15 A16	M8-T12 PolarHBondContact O-N 3.31Å; M8-T12 PolarHBondContact O-OG1 3.18Å; M8-T12 VanDerWaalsContact O-OG1 3.12Å; A9-T12 PolarHBondContact O-N 3.31Å; Q10-T12 VanDerWaalsContact C-N 3.29Å; Q10-T12 PolarHBondContact O-N 3.48Å; T12-L15 PolarHBondContact O-N 3.05Å; T12-A16 VanDerWaalsContact O-CB 3.28Å; T12-A16 WeakPolarHBondContact O-CB 3.37Å; T12-A16 PolarHBondContact O-N 3.23Å
13	W	92	Very high	81.5	Confident	158 Å²	158	106.3 Å²	106.3	60%	0.598	59%	0.594	S	S	*	*	H	α-helix	trans	-67.6	-42.5	177.9	-173.6	83.4	0	0	112.1	A9 Q10 K11 L15 A16 N17 M19	A9-W13 WeakPolarHBondContact O-CB 3.23Å; A9-W13 PolarHBondContact O-N 2.95Å; Q10-W13 WeakPolarHBondContact O-CB 3.4Å; Q10-W13 PolarHBondContact O-N 3.15Å; Q10-W13 VanDerWaalsContact O-N 3.08Å; K11-W13 VanDerWaalsContact C-N 3.35Å; W13-L15 PolarHBondContact O-N 3.36Å; W13-A16 PolarHBondContact O-N 3.23Å; W13-N17 VanDerWaalsContact CD2-ND2 3.31Å; W13-N17 VanDerWaalsContact CZ2-ND2 3.34Å; W13-N17 WeakPolarHBondContact CZ2-ND2 3.34Å; W13-N17 PolarHBondContact NE1-ND2 3.06Å; W13-N17 PolarHBondContact O-N 2.85Å; W13-N17 VanDerWaalsContact O-N 3.14Å; W13-N17 PolarHBondContact O-ND2 3.23Å; W13-M19 HydrophobicContact CE3-SD 3.61Å; W13-M19 HydrophobicContact CH2-SD 3.94Å; W13-M19 HydrophobicContact CZ3-CE 3.92Å; W13-M19 HydrophobicContact CZ3-SD 3.15Å; W13-M19 WeakPolarHBondContact CZ3-SD 3.31Å
14	E	89.9	Confident	82.4	Confident	64 Å²	64	105 Å²	105	30%	0.299	58%	0.58	S	S	.	*	H	α-helix	trans	-59.3	-46.3	174.6	-71.1	164.8	-177	0	111.2	Q10 N17 N18 M19	Q10-E14 VanDerWaalsContact CG-OE1 3.27Å; Q10-E14 WeakPolarHBondContact CG-OE1 3.34Å; Q10-E14 PolarHBondContact NE2-OE1 3.01Å; Q10-E14 WeakPolarHBondContact O-CG 3.48Å; Q10-E14 PolarHBondContact O-N 2.98Å; E14-N17 PolarHBondContact O-N 3.48Å; E14-N18 PolarHBondContact O-N 2.91Å; E14-M19 HydrophobicContact CB-CB 4.25Å; E14-M19 HydrophobicContact CB-SD 4.23Å; E14-M19 HydrophobicContact CG-CE 4.45Å; E14-M19 HydrophobicContact CG-SD 3.87Å; E14-M19 PolarHBondContact O-N 2.92Å
15	L	87.6	Confident	82.6	Confident	137 Å²	137	105.2 Å²	105.2	72%	0.717	57%	0.57	S	S	*	*	H	α-helix	trans	-65.9	-44.1	178	-175.3	66.6	0	0	112.7	K11 T12 W13 N17 N18	K11-L15 WeakPolarHBondContact O-CB 3.34Å; K11-L15 PolarHBondContact O-N 3.24Å; T12-L15 PolarHBondContact O-N 3.05Å; W13-L15 PolarHBondContact O-N 3.36Å; L15-N17 PolarHBondContact O-N 3.27Å; L15-N18 PolarHBondContact O-N 3.42Å; L15-N18 VanDerWaalsContact O-N 3.14Å
16	A	88.8	Confident	82.6	Confident	73 Å²	73	109.3 Å²	109.3	60%	0.603	58%	0.583	S	S	*	*	H	α-helix	trans	-62.8	-30.3	-179.8	0	0	0	0	112.7	T12 W13	T12-A16 VanDerWaalsContact O-CB 3.28Å; T12-A16 WeakPolarHBondContact O-CB 3.37Å; T12-A16 PolarHBondContact O-N 3.23Å; W13-A16 PolarHBondContact O-N 3.23Å
17	N	90.4	Very high	82.1	Confident	83 Å²	83	111.2 Å²	111.2	44%	0.444	58%	0.584	S	S	.	*	T	Hydrogen-bonded Turn	trans	-94.4	5.1	179	-66.5	-40.8	0	0	113.6	W13 E14 L15 M19	W13-N17 VanDerWaalsContact CD2-ND2 3.31Å; W13-N17 VanDerWaalsContact CZ2-ND2 3.34Å; W13-N17 WeakPolarHBondContact CZ2-ND2 3.34Å; W13-N17 PolarHBondContact NE1-ND2 3.06Å; W13-N17 PolarHBondContact O-N 2.85Å; W13-N17 VanDerWaalsContact O-N 3.14Å; W13-N17 PolarHBondContact O-ND2 3.23Å; E14-N17 PolarHBondContact O-N 3.48Å; L15-N17 PolarHBondContact O-N 3.27Å; N17-M19 HydrophobicContact CB-CG 4.04Å; N17-M19 PolarHBondContact O-N 2.82Å
18	N	89.6	Confident	81.7	Confident	140 Å²	140	115.8 Å²	115.8	75%	0.749	60%	0.597	S	S	*	*	T	Hydrogen-bonded Turn	trans	52.3	38.7	-174.4	-52.7	-70.5	0	0	112.6	E14 L15 Q20	E14-N18 PolarHBondContact O-N 2.91Å; L15-N18 PolarHBondContact O-N 3.42Å; L15-N18 VanDerWaalsContact O-N 3.14Å; N18-Q20 PolarHBondContact O-N 3.25Å
19	M	85.8	Confident	80.9	Confident	103 Å²	103	115.8 Å²	115.8	51%	0.507	59%	0.591	S	S	.	*			trans	-66.4	131.4	178.1	-71.1	178.8	70.7	0	110	W13 E14 N17	W13-M19 HydrophobicContact CE3-SD 3.61Å; W13-M19 HydrophobicContact CH2-SD 3.94Å; W13-M19 HydrophobicContact CZ3-CE 3.92Å; W13-M19 HydrophobicContact CZ3-SD 3.15Å; W13-M19 WeakPolarHBondContact CZ3-SD 3.31Å; E14-M19 HydrophobicContact CB-CB 4.25Å; E14-M19 HydrophobicContact CB-SD 4.23Å; E14-M19 HydrophobicContact CG-CE 4.45Å; E14-M19 HydrophobicContact CG-SD 3.87Å; E14-M19 PolarHBondContact O-N 2.92Å; N17-M19 HydrophobicContact CB-CG 4.04Å; N17-M19 PolarHBondContact O-N 2.82Å
20	Q	81.2	Confident	80.1	Confident	184 Å²	184	121.8 Å²	121.8	86%	0.86	61%	0.606	S	S	*	*			trans	-109.5	123.2	178.9	-153.9	142.4	7.4	0	108.5	N18 A22	N18-Q20 PolarHBondContact O-N 3.25Å; Q20-A22 PolarHBondContact O-N 3.14Å
21	E	78.2	Confident	79.2	Confident	177 Å²	177	122.2 Å²	122.2	83%	0.827	60%	0.603	S	S	*	*			trans	-70.4	117.7	171.9	-169.8	174.9	-168.8	0	107.8
22	A	79.8	Confident	78.7	Confident	42 Å²	42	119.7 Å²	119.7	35%	0.347	60%	0.596	S	S	.	*			trans	-104.7	125.5	175.8	0	0	0	0	108.9	Q20 E27 I28	Q20-A22 PolarHBondContact O-N 3.14Å; A22-E27 VanDerWaalsContact CA-OE2 3.31Å; A22-E27 WeakPolarHBondContact CA-OE2 3.48Å; A22-E27 HydrophobicContact CB-CB 4.2Å; A22-I28 HydrophobicContact CB-CD1 3.65Å; A22-I28 HydrophobicContact CB-CG1 3.33Å
23	Q	72.3	Confident	78.1	Confident	172 Å²	172	121.6 Å²	121.6	80%	0.804	60%	0.597	S	S	*	*	S	Bend	trans	-87.8	-23.8	-178.7	-64.4	-166.3	-21.3	0	112.4	E27	Q23-E27 PolarHBondContact N-OE2 3.19Å
24	S	70.1	Confident	77.6	Confident	51 Å²	51	120.6 Å²	120.6	36%	0.357	60%	0.597	S	S	.	*	S	Bend	trans	-132.1	149.4	179.5	-173.9	0	0	0	111.9	D26 E27	S24-D26 PolarHBondContact O-N 3.44Å; S24-D26 PolarHBondContact OG-N 3.5Å; S24-E27 PolarHBondContact N-OE2 3.28Å; S24-E27 WeakPolarHBondContact O-CB 3.3Å; S24-E27 PolarHBondContact O-N 3.3Å
25	I	63.9	Low	77.2	Confident	131 Å²	131	122.8 Å²	122.8	67%	0.672	61%	0.607	S	S	*	*	H	α-helix	trans	-55.1	-32.3	171.7	-65.7	169.4	0	0	110.4	E27 I28 Y29	I25-E27 PolarHBondContact O-N 3.14Å; I25-I28 PolarHBondContact O-N 3.3Å; I25-Y29 WeakPolarHBondContact O-CB 3.33Å; I25-Y29 PolarHBondContact O-N 3.4Å
26	D	63.9	Low	76.8	Confident	123 Å²	123	120.3 Å²	120.3	66%	0.658	59%	0.592	S	S	*	*	H	α-helix	trans	-66.6	-21.2	178.9	-60.6	-37.4	0	0	113.6	S24	S24-D26 PolarHBondContact O-N 3.44Å; S24-D26 PolarHBondContact OG-N 3.5Å
27	E	67.2	Low	76.6	Confident	119 Å²	119	122.6 Å²	122.6	56%	0.556	59%	0.59	S	S	*	*	H	α-helix	trans	-81.4	-27.5	176.6	-63.7	178.5	157	0	112.1	A22 Q23 S24 I25	A22-E27 VanDerWaalsContact CA-OE2 3.31Å; A22-E27 WeakPolarHBondContact CA-OE2 3.48Å; A22-E27 HydrophobicContact CB-CB 4.2Å; Q23-E27 PolarHBondContact N-OE2 3.19Å; S24-E27 PolarHBondContact N-OE2 3.28Å; S24-E27 WeakPolarHBondContact O-CB 3.3Å; S24-E27 PolarHBondContact O-N 3.3Å; I25-E27 PolarHBondContact O-N 3.14Å
28	I	75.6	Confident	76.3	Confident	133 Å²	133	123.9 Å²	123.9	68%	0.682	59%	0.594	S	S	*	*	H	α-helix	trans	-92.4	-36.6	179.9	-50.3	175.6	0	0	110.5	A22 I25	A22-I28 HydrophobicContact CB-CD1 3.65Å; A22-I28 HydrophobicContact CB-CG1 3.33Å; I25-I28 PolarHBondContact O-N 3.3Å
29	Y	72.1	Confident	75.9	Confident	136 Å²	136	120.8 Å²	120.8	53%	0.533	58%	0.576	S	S	.	*			trans	-123.5	94.1	-171	-169.8	-109.6	0	0	111	I25 Y31	I25-Y29 WeakPolarHBondContact O-CB 3.33Å; I25-Y29 PolarHBondContact O-N 3.4Å; Y29-Y31 HydrophobicContact CE1-CD2 4.15Å; Y29-Y31 HydrophobicContact CE1-CG 4.17Å; Y29-Y31 AromaticContact CZ-CD2 3.99Å; Y29-Y31 PolarHBondContact O-N 3Å; Y29-Y31 WeakPolarHBondContact OH-CD2 3.47Å
30	K	70.1	Confident	75.8	Confident	188 Å²	188	120.4 Å²	120.4	82%	0.817	58%	0.576	S	S	*	*			trans	-84.7	107.3	165.5	-72.3	-175.2	179.2	178.5	109.3
31	Y	68.6	Low	76	Confident	126 Å²	126	115.7 Å²	115.7	49%	0.494	57%	0.568	S	S	.	*			trans	-96.2	102.8	172.2	-176.4	-106.6	0	0	111	Y29 K33	Y29-Y31 HydrophobicContact CE1-CD2 4.15Å; Y29-Y31 HydrophobicContact CE1-CG 4.17Å; Y29-Y31 AromaticContact CZ-CD2 3.99Å; Y29-Y31 PolarHBondContact O-N 3Å; Y29-Y31 WeakPolarHBondContact OH-CD2 3.47Å; Y31-K33 HydrophobicContact CE1-CB 3.72Å; Y31-K33 HydrophobicContact CE1-CG 4.26Å
32	D	77.9	Confident	76.3	Confident	85 Å²	85	110.5 Å²	110.5	46%	0.455	56%	0.555	S	S	.	*			trans	-102.1	104	164.4	-173	-23.1	0	0	109.4	K34 Q35 Q36	D32-K34 PolarHBondContact O-N 3.18Å; D32-K34 WeakPolarHBondContact OD1-CA 3.34Å; D32-K34 VanDerWaalsContact OD1-CB 3.3Å; D32-K34 WeakPolarHBondContact OD1-CB 3.15Å; D32-K34 PolarHBondContact OD1-N 3.38Å; D32-Q35 HydrophobicContact CB-CB 3.79Å; D32-Q35 PolarHBondContact O-N 3.41Å; D32-Q35 PolarHBondContact OD1-N 3.08Å; D32-Q36 PolarHBondContact O-N 3Å
33	K	75.3	Confident	76.5	Confident	128 Å²	128	114 Å²	114	56%	0.557	56%	0.563	S	S	*	*	H	α-helix	trans	-56.8	-34.5	179.5	-172	175.3	179.9	-179.7	112.5	Y31 Q37	Y31-K33 HydrophobicContact CE1-CB 3.72Å; Y31-K33 HydrophobicContact CE1-CG 4.26Å; K33-Q37 WeakPolarHBondContact O-CG 3.5Å; K33-Q37 PolarHBondContact O-N 3.03Å; K33-Q37 VanDerWaalsContact O-N 3.15Å
34	K	81.2	Confident	76.8	Confident	138 Å²	138	109.2 Å²	109.2	60%	0.6	55%	0.546	S	S	*	.	H	α-helix	trans	-72.2	-46.8	-179.5	-175	-175.2	173.2	-170.8	110.2	D32 Q36 Q37 E38	D32-K34 PolarHBondContact O-N 3.18Å; D32-K34 WeakPolarHBondContact OD1-CA 3.34Å; D32-K34 VanDerWaalsContact OD1-CB 3.3Å; D32-K34 WeakPolarHBondContact OD1-CB 3.15Å; D32-K34 PolarHBondContact OD1-N 3.38Å; K34-Q36 VanDerWaalsContact C-N 3.28Å; K34-Q36 PolarHBondContact O-N 3.01Å; K34-Q37 PolarHBondContact O-N 2.94Å; K34-E38 WeakPolarHBondContact CE-OE1 3.43Å; K34-E38 WeakPolarHBondContact O-CG 3.45Å; K34-E38 PolarHBondContact O-N 3.45Å
35	Q	80.8	Confident	77.4	Confident	110 Å²	110	114.3 Å²	114.3	51%	0.514	56%	0.558	S	S	.	*	H	α-helix	trans	-58.5	-41.9	175.9	-170	-177.8	45.8	0	111.5	D32 Q37 E38 I39	D32-Q35 HydrophobicContact CB-CB 3.79Å; D32-Q35 PolarHBondContact O-N 3.41Å; D32-Q35 PolarHBondContact OD1-N 3.08Å; Q35-Q37 PolarHBondContact O-N 3.12Å; Q35-E38 PolarHBondContact O-N 3.49Å; Q35-I39 HydrophobicContact CG-CD1 4.09Å; Q35-I39 VanDerWaalsContact O-CG1 3.31Å; Q35-I39 WeakPolarHBondContact O-CG1 3.4Å; Q35-I39 PolarHBondContact O-N 2.73Å
36	Q	80.9	Confident	78.4	Confident	84 Å²	84	112.5 Å²	112.5	39%	0.393	55%	0.553	S	S	.	*	H	α-helix	trans	-67	-36.4	178.5	-170.5	158.4	-7.7	0	112.8	D32 K34 I39 L40	D32-Q36 PolarHBondContact O-N 3Å; K34-Q36 VanDerWaalsContact C-N 3.28Å; K34-Q36 PolarHBondContact O-N 3.01Å; Q36-I39 PolarHBondContact O-N 3.34Å; Q36-L40 HydrophobicContact CG-CD1 4.17Å; Q36-L40 WeakPolarHBondContact O-CB 3.28Å; Q36-L40 VanDerWaalsContact O-CG 3.23Å; Q36-L40 WeakPolarHBondContact O-CG 3.42Å; Q36-L40 PolarHBondContact O-N 3.37Å
37	Q	83.6	Confident	78.5	Confident	121 Å²	121	114.7 Å²	114.7	57%	0.565	56%	0.557	S	S	*	*	H	α-helix	trans	-65.5	-39.4	173.9	-76.8	-177.9	-17	0	112.4	K33 K34 Q35 L40 A41	K33-Q37 WeakPolarHBondContact O-CG 3.5Å; K33-Q37 PolarHBondContact O-N 3.03Å; K33-Q37 VanDerWaalsContact O-N 3.15Å; K34-Q37 PolarHBondContact O-N 2.94Å; Q35-Q37 PolarHBondContact O-N 3.12Å; Q37-L40 PolarHBondContact O-N 3.49Å; Q37-A41 WeakPolarHBondContact O-CB 3.31Å; Q37-A41 PolarHBondContact O-N 2.96Å
38	E	84.9	Confident	78.1	Confident	111 Å²	111	122.1 Å²	122.1	52%	0.519	59%	0.592	S	S	.	*	H	α-helix	trans	-64.3	-44	175.8	-70.5	172.6	-174.5	0	111.5	K34 Q35 A41 A42	K34-E38 WeakPolarHBondContact CE-OE1 3.43Å; K34-E38 WeakPolarHBondContact O-CG 3.45Å; K34-E38 PolarHBondContact O-N 3.45Å; Q35-E38 PolarHBondContact O-N 3.49Å; E38-A41 PolarHBondContact O-N 3.43Å; E38-A42 WeakPolarHBondContact O-CB 3.42Å; E38-A42 PolarHBondContact O-N 3.27Å
39	I	81.7	Confident	78.2	Confident	74 Å²	74	121.6 Å²	121.6	38%	0.379	59%	0.587	S	S	.	*	H	α-helix	trans	-61.2	-45.6	175.1	-70	167.8	0	0	111.1	Q35 Q36 A41 A42 K43 P44 W45	Q35-I39 HydrophobicContact CG-CD1 4.09Å; Q35-I39 VanDerWaalsContact O-CG1 3.31Å; Q35-I39 WeakPolarHBondContact O-CG1 3.4Å; Q35-I39 PolarHBondContact O-N 2.73Å; Q36-I39 PolarHBondContact O-N 3.34Å; I39-A41 VanDerWaalsContact C-N 3.33Å; I39-A41 PolarHBondContact O-N 3.1Å; I39-A42 PolarHBondContact O-N 3.42Å; I39-K43 PolarHBondContact O-N 2.85Å; I39-P44 HydrophobicContact CG2-CG 4.27Å; I39-P44 WeakPolarHBondContact O-CD 3.4Å; I39-W45 HydrophobicContact CG2-CH2 3.8Å; I39-W45 HydrophobicContact CG2-CZ3 3.38Å
40	L	83.4	Confident	78.5	Confident	96 Å²	96	120.8 Å²	120.8	50%	0.503	59%	0.59	S	S	.	*	H	α-helix	trans	-64.8	-35.5	177.7	-73.8	168.4	0	0	112.7	Q36 Q37 K43 W45	Q36-L40 HydrophobicContact CG-CD1 4.17Å; Q36-L40 WeakPolarHBondContact O-CB 3.28Å; Q36-L40 VanDerWaalsContact O-CG 3.23Å; Q36-L40 WeakPolarHBondContact O-CG 3.42Å; Q36-L40 PolarHBondContact O-N 3.37Å; Q37-L40 PolarHBondContact O-N 3.49Å; L40-K43 WeakPolarHBondContact O-CG 3.27Å; L40-W45 HydrophobicContact CD2-CH2 3.98Å; L40-W45 HydrophobicContact CD2-CZ2 4.18Å
41	A	84.4	Confident	79	Confident	85 Å²	85	117.1 Å²	117.1	70%	0.702	58%	0.577	S	S	*	*	H	α-helix	trans	-71	-40.4	176.2	0	0	0	0	111.9	Q37 E38 I39 K43	Q37-A41 WeakPolarHBondContact O-CB 3.31Å; Q37-A41 PolarHBondContact O-N 2.96Å; E38-A41 PolarHBondContact O-N 3.43Å; I39-A41 VanDerWaalsContact C-N 3.33Å; I39-A41 PolarHBondContact O-N 3.1Å; A41-K43 VanDerWaalsContact C-N 3.33Å
42	A	84.6	Confident	79.6	Confident	67 Å²	67	116.6 Å²	116.6	55%	0.554	58%	0.582	S	S	*	*	H	α-helix	trans	-73.1	-23.6	179.7	0	0	0	0	113.4	E38 I39	E38-A42 WeakPolarHBondContact O-CB 3.42Å; E38-A42 PolarHBondContact O-N 3.27Å; I39-A42 PolarHBondContact O-N 3.42Å
43	K	84.3	Confident	79.7	Confident	117 Å²	117	118.6 Å²	118.6	51%	0.509	59%	0.59	S	S	.	*			trans	42	55.6	-175.7	-61	-176.4	-179.9	175.9	112.7	I39 L40 A41 W45 T46	I39-K43 PolarHBondContact O-N 2.85Å; L40-K43 WeakPolarHBondContact O-CG 3.27Å; A41-K43 VanDerWaalsContact C-N 3.33Å; K43-W45 PolarHBondContact O-N 3.25Å; K43-W45 VanDerWaalsContact O-N 3.12Å; K43-T46 HydrophobicContact CB-CG2 3.97Å; K43-T46 WeakPolarHBondContact CB-OG1 3.49Å; K43-T46 HydrophobicContact CD-CG2 4.42Å; K43-T46 PolarHBondContact O-N 3.48Å; K43-T46 PolarHBondContact O-OG1 2.76Å
44	P	77.3	Confident	80	Confident	70 Å²	70	117.9 Å²	117.9	46%	0.455	59%	0.592	S	S	.	*	G	3₁₀ helix	trans	-60.7	-28.1	-172.3	24.1	-33.1	0	0	113	I39 T46 K47	I39-P44 HydrophobicContact CG2-CG 4.27Å; I39-P44 WeakPolarHBondContact O-CD 3.4Å; P44-T46 PolarHBondContact O-N 2.96Å; P44-K47 PolarHBondContact O-N 2.86Å
45	W	84.6	Confident	80	Confident	159 Å²	159	116.5 Å²	116.5	60%	0.602	59%	0.592	S	S	*	*	G	3₁₀ helix	trans	-72.1	-2.8	174.4	52.9	82.3	0	0	115.1	I39 L40 K43	I39-W45 HydrophobicContact CG2-CH2 3.8Å; I39-W45 HydrophobicContact CG2-CZ3 3.38Å; L40-W45 HydrophobicContact CD2-CH2 3.98Å; L40-W45 HydrophobicContact CD2-CZ2 4.18Å; K43-W45 PolarHBondContact O-N 3.25Å; K43-W45 VanDerWaalsContact O-N 3.12Å
46	T	83.9	Confident	79.9	Confident	93 Å²	93	117 Å²	117	57%	0.571	60%	0.598	S	S	*	*	G	3₁₀ helix	trans	-98.5	-5.6	174.2	62.1	0	0	0	113.2	K43 P44	K43-T46 HydrophobicContact CB-CG2 3.97Å; K43-T46 WeakPolarHBondContact CB-OG1 3.49Å; K43-T46 HydrophobicContact CD-CG2 4.42Å; K43-T46 PolarHBondContact O-N 3.48Å; K43-T46 PolarHBondContact O-OG1 2.76Å; P44-T46 PolarHBondContact O-N 2.96Å
47	K	65.8	Low	79.8	Confident	169 Å²	169	119.8 Å²	119.8	74%	0.735	62%	0.615	S	S	*	*			trans	-109.5	120.8	172.6	-71.3	-177.4	177.6	177.4	107.9	P44	P44-K47 PolarHBondContact O-N 2.86Å
48	E	59	Low	79.5	Confident	275 Å²	275	119.6 Å²	119.6	100%	1.285	62%	0.619	S	S	*	*			trans	-63	0	168.9	-63.5	-167.5	120.8	0	111.5

Retrieved 48 of 48 residues in 101.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).