A0A087WRJ8_MOUSE Loading...

Delta/notch-like EGF repeat containing

AlphaFold DB , UniProt , Accession A0A087WRJ8, Species MOUSE (Mus musculus, Mouse), Gene Dner, Length 38 aa.

						>A0A087WRJ8_MOUSE|A0A087WRJ8|Dner
MKWDQVEVVPDVACGNASSNNSAGGRLVSFEVPQNTSV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.9	Low	61.3	Low	205 Å²	205	149.9 Å²	149.9	100%	1.01	75%	0.75	S	S	*	*				0	113	0	-165.2	170.9	-97.6	0	0	106.3	W3	M1-W3 HydrophobicContact SD-CZ2 4.18Å
2	K	49.4	Very low	61.1	Low	196 Å²	196	148.2 Å²	148.2	85%	0.852	75%	0.752	S	S	*	*			trans	-84.7	115.6	174.9	-69.9	-174.2	176.5	-176.6	0	105.9	D4	K2-D4 PolarHBondContact O-N 3.23Å
3	W	65.5	Low	61	Low	220 Å²	220	141.8 Å²	141.8	83%	0.833	74%	0.737	S	S	*	*			trans	-82.9	110.5	173	-72	89.3	0	0	0	106.7	M1 Q5	M1-W3 HydrophobicContact SD-CZ2 4.18Å; W3-Q5 PolarHBondContact O-N 2.95Å
4	D	67.7	Low	61.1	Low	141 Å²	141	137.9 Å²	137.9	75%	0.754	73%	0.726	S	S	*	*			trans	-70.1	113.7	173.8	-65.2	-42	0	0	0	107.5	K2 V6	K2-D4 PolarHBondContact O-N 3.23Å; D4-V6 VanDerWaalsContact C-N 3.3Å; D4-V6 PolarHBondContact O-N 3.25Å
5	Q	61	Low	60.9	Low	197 Å²	197	132.1 Å²	132.1	92%	0.921	71%	0.713	S	S	*	*			trans	-73	90.1	177.9	-167.9	171.1	44.3	0	0	107.6	W3 E7	W3-Q5 PolarHBondContact O-N 2.95Å; Q5-E7 PolarHBondContact O-N 3.18Å
6	V	69.6	Low	60.6	Low	113 Å²	113	134.3 Å²	134.3	69%	0.685	72%	0.724	S	S	*	*			trans	-75.5	115.2	170.6	179.8	0	0	0	0	107.1	D4 V8	D4-V6 VanDerWaalsContact C-N 3.3Å; D4-V6 PolarHBondContact O-N 3.25Å; V6-V8 PolarHBondContact O-N 3.43Å
7	E	61.2	Low	60.7	Low	176 Å²	176	131.3 Å²	131.3	82%	0.822	72%	0.722	S	S	*	*			trans	-67.7	100.2	172.3	-167	174	-173.2	0	0	108.2	Q5 V9	Q5-E7 PolarHBondContact O-N 3.18Å; E7-V9 PolarHBondContact O-N 3.02Å
8	V	62.8	Low	60.8	Low	102 Å²	102	130.7 Å²	130.7	62%	0.618	73%	0.728	S	S	*	*			trans	-78.5	101.9	178.9	-178.8	0	0	0	0	107.8	V6 P10 A13	V6-V8 PolarHBondContact O-N 3.43Å; V8-P10 WeakPolarHBondContact O-CD 3.45Å; V8-A13 HydrophobicContact CG1-CB 3.58Å
9	V	68.1	Low	60.6	Low	80 Å²	80	128.4 Å²	128.4	49%	0.485	72%	0.722	S	S	.	*			trans	-66.7	116.8	172.8	-179.1	0	0	0	0	108.4	E7 D11 V12 A13	E7-V9 PolarHBondContact O-N 3.02Å; V9-D11 HydrophobicContact CG1-CB 4.41Å; V9-D11 PolarHBondContact O-N 3.34Å; V9-V12 PolarHBondContact O-N 3Å; V9-V12 VanDerWaalsContact O-N 3.14Å; V9-A13 PolarHBondContact O-N 2.7Å
10	P	56.7	Low	60.3	Low	84 Å²	84	130.1 Å²	130.1	55%	0.545	73%	0.729	S	S	.	*	H	α-helix	trans	-63.7	-26.1	-169.5	22.6	-32.7	0	0	0	113.5	V8 V12 A13 C14	V8-P10 WeakPolarHBondContact O-CD 3.45Å; P10-V12 VanDerWaalsContact C-N 3.28Å; P10-V12 PolarHBondContact O-N 2.87Å; P10-A13 PolarHBondContact O-N 3.45Å; P10-C14 WeakPolarHBondContact O-CB 3.39Å; P10-C14 PolarHBondContact O-N 3.24Å
11	D	59.5	Low	60.3	Low	135 Å²	135	129.9 Å²	129.9	72%	0.722	73%	0.727	S	S	*	*	H	α-helix	trans	-63.9	-30.7	177.6	-68.4	-51	0	0	0	113.3	V9 G15	V9-D11 HydrophobicContact CG1-CB 4.41Å; V9-D11 PolarHBondContact O-N 3.34Å; D11-G15 WeakPolarHBondContact O-CA 3.32Å
12	V	59.3	Low	60.8	Low	129 Å²	129	125 Å²	125	78%	0.782	71%	0.713	S	S	*	*	H	α-helix	trans	-84.9	-37.4	176.1	180	0	0	0	0	110.9	V9 P10	V9-V12 PolarHBondContact O-N 3Å; V9-V12 VanDerWaalsContact O-N 3.14Å; P10-V12 VanDerWaalsContact C-N 3.28Å; P10-V12 PolarHBondContact O-N 2.87Å
13	A	58.7	Low	61.4	Low	66 Å²	66	120.3 Å²	120.3	55%	0.545	71%	0.71	S	S	.	*	H	α-helix	trans	-73.8	-34.3	-177.7	0	0	0	0	0	113.4	V8 V9 P10	V8-A13 HydrophobicContact CG1-CB 3.58Å; V9-A13 PolarHBondContact O-N 2.7Å; P10-A13 PolarHBondContact O-N 3.45Å
14	C	62.5	Low	61.4	Low	87 Å²	87	113 Å²	113	59%	0.588	70%	0.703	S	S	*	*	T	Hydrogen-bonded Turn	trans	-110.6	21.6	-176.3	-61	0	0	0	0	112.3	P10 N16 A17	P10-C14 WeakPolarHBondContact O-CB 3.39Å; P10-C14 PolarHBondContact O-N 3.24Å; C14-N16 PolarHBondContact O-N 3.24Å; C14-A17 PolarHBondContact O-N 2.81Å
15	G	57.9	Low	61.5	Low	51 Å²	51	109.2 Å²	109.2	53%	0.526	70%	0.698	S	S	.	*	T	Hydrogen-bonded Turn	trans	-31.5	117	-169.6	0	0	0	0	0	113.9	D11 A17	D11-G15 WeakPolarHBondContact O-CA 3.32Å; G15-A17 VanDerWaalsContact C-N 3.33Å; G15-A17 PolarHBondContact O-N 3.33Å; G15-A17 VanDerWaalsContact O-N 3.09Å
16	N	56.5	Low	62	Low	166 Å²	166	110.6 Å²	110.6	89%	0.888	70%	0.695	S	S	*	*	T	Hydrogen-bonded Turn	trans	27.2	64.7	-179.1	-88.6	5.7	0	0	0	113.9	C14 S18	C14-N16 PolarHBondContact O-N 3.24Å; N16-S18 PolarHBondContact O-N 3.37Å
17	A	62.3	Low	62.1	Low	84 Å²	84	113.4 Å²	113.4	69%	0.694	71%	0.705	S	S	*	*			trans	-71.2	63.8	175.6	0	0	0	0	0	112.1	C14 G15 S19	C14-A17 PolarHBondContact O-N 2.81Å; G15-A17 VanDerWaalsContact C-N 3.33Å; G15-A17 PolarHBondContact O-N 3.33Å; G15-A17 VanDerWaalsContact O-N 3.09Å; A17-S19 PolarHBondContact O-N 3.39Å
18	S	63.2	Low	62.7	Low	120 Å²	120	109.4 Å²	109.4	84%	0.839	69%	0.692	S	S	*	*			trans	-84	63.4	153.6	179.1	0	0	0	0	107.6	N16 N20	N16-S18 PolarHBondContact O-N 3.37Å; S18-N20 PolarHBondContact O-N 2.74Å
19	S	57.5	Low	63.4	Low	87 Å²	87	110.3 Å²	110.3	61%	0.608	70%	0.703	S	S	*	*			trans	-89.9	96.2	176.4	-172.3	0	0	0	0	108.5	A17 N21	A17-S19 PolarHBondContact O-N 3.39Å; S19-N21 PolarHBondContact O-N 3.09Å; S19-N21 PolarHBondContact OG-N 3.24Å; S19-N21 PolarHBondContact OG-O 3.32Å
20	N	52.8	Low	63.9	Low	163 Å²	163	114.3 Å²	114.3	87%	0.872	71%	0.714	S	S	*	*			trans	-78.8	12.9	161.4	-158.2	18	0	0	0	111.6	S18 S22	S18-N20 PolarHBondContact O-N 2.74Å; N20-S22 PolarHBondContact O-N 3.21Å
21	N	61.1	Low	65.1	Low	126 Å²	126	119.5 Å²	119.5	67%	0.674	73%	0.731	S	S	*	*			trans	-86.6	89.9	170	-158.8	40.5	0	0	0	106.8	S19 A23	S19-N21 PolarHBondContact O-N 3.09Å; S19-N21 PolarHBondContact OG-N 3.24Å; S19-N21 PolarHBondContact OG-O 3.32Å; N21-A23 VanDerWaalsContact C-N 3.33Å; N21-A23 PolarHBondContact O-N 3.23Å
22	S	63.6	Low	65.9	Low	103 Å²	103	118 Å²	118	72%	0.72	73%	0.727	S	S	*	*			trans	-52.5	104.8	163.1	42	0	0	0	0	106.9	N20 G24	N20-S22 PolarHBondContact O-N 3.21Å; S22-G24 PolarHBondContact O-N 3.38Å
23	A	62.9	Low	66.9	Low	96 Å²	96	116 Å²	116	79%	0.793	72%	0.716	S	S	*	*			trans	-68.1	68	164	0	0	0	0	0	106.8	N21 G25	N21-A23 VanDerWaalsContact C-N 3.33Å; N21-A23 PolarHBondContact O-N 3.23Å; A23-G25 PolarHBondContact O-N 2.87Å
24	G	64.4	Low	67.8	Low	66 Å²	66	121.4 Å²	121.4	68%	0.68	73%	0.731	S	S	*	*			trans	-60.2	96.2	172	0	0	0	0	0	105.9	S22 R26	S22-G24 PolarHBondContact O-N 3.38Å; G24-R26 PolarHBondContact O-N 3.35Å
25	G	70.4	Confident	68.3	Low	63 Å²	63	124.7 Å²	124.7	65%	0.649	74%	0.742	S	S	*	*			trans	-49.4	129	-179	0	0	0	0	0	108.8	A23 L27	A23-G25 PolarHBondContact O-N 2.87Å; G25-L27 PolarHBondContact O-N 3.14Å
26	R	71.8	Confident	68.6	Low	225 Å²	225	126.8 Å²	126.8	85%	0.849	75%	0.745	S	S	*	*			trans	-64	110.3	176.7	-175.8	175.1	178.3	-169.9	-1.4	107.4	G24 V28	G24-R26 PolarHBondContact O-N 3.35Å; R26-V28 PolarHBondContact O-N 3.18Å
27	L	71.9	Confident	69.3	Low	173 Å²	173	124.2 Å²	124.2	91%	0.906	74%	0.74	S	S	*	*			trans	-61.7	110.7	172.2	-61.6	179	0	0	0	107.4	G25	G25-L27 PolarHBondContact O-N 3.14Å
28	V	72.3	Confident	69.4	Low	92 Å²	92	130.4 Å²	130.4	56%	0.558	77%	0.769	S	S	*	*			trans	-95.1	121.7	174.5	-75.6	0	0	0	0	107.7	R26 F30	R26-V28 PolarHBondContact O-N 3.18Å; V28-F30 HydrophobicContact CB-CZ 4.07Å; V28-F30 VanDerWaalsContact CG2-CZ 3.48Å; V28-F30 HydrophobicContact CG2-CZ 3.48Å; V28-F30 HydrophobicContact CG2-CE2 3.92Å; V28-F30 HydrophobicContact CG2-CE1 4.23Å; V28-F30 HydrophobicContact CB-CE1 4.4Å
29	S	78.1	Confident	69.7	Low	121 Å²	121	131 Å²	131	85%	0.846	77%	0.765	S	S	*	*			trans	-94.5	135.4	171	-171.1	0	0	0	0	108
30	F	78.4	Confident	70.3	Confident	163 Å²	163	133.3 Å²	133.3	72%	0.715	77%	0.773	S	S	*	*			trans	-111.1	128.3	175.5	-49.2	-80.9	0	0	0	107.8	V28 V32	V28-F30 HydrophobicContact CB-CZ 4.07Å; V28-F30 VanDerWaalsContact CG2-CZ 3.48Å; V28-F30 HydrophobicContact CG2-CZ 3.48Å; V28-F30 HydrophobicContact CG2-CE2 3.92Å; V28-F30 HydrophobicContact CG2-CE1 4.23Å; V28-F30 HydrophobicContact CB-CE1 4.4Å; F30-V32 PolarHBondContact O-N 2.93Å
31	E	81.6	Confident	71.3	Confident	194 Å²	194	131.6 Å²	131.6	91%	0.907	77%	0.768	S	S	*	*	P	Polyproline II helix	trans	-72.1	124.7	172.6	-70.9	-179.3	175.6	0	0	109.3	P33	E31-P33 WeakPolarHBondContact O-CD 3.35Å
32	V	77.7	Confident	71.9	Confident	102 Å²	102	131.9 Å²	131.9	62%	0.618	77%	0.774	S	S	*	*	P	Polyproline II helix	trans	-83.1	119.6	172.5	179.7	0	0	0	0	108	F30 Q34	F30-V32 PolarHBondContact O-N 2.93Å; V32-Q34 PolarHBondContact O-N 3Å
33	P	78.8	Confident	72.4	Confident	87 Å²	87	133.8 Å²	133.8	57%	0.565	78%	0.777	S	S	*	*	P	Polyproline II helix	trans	-59.9	125.1	176.7	-19.7	31	0	0	0	110.1	E31 N35 T36	E31-P33 WeakPolarHBondContact O-CD 3.35Å; P33-N35 PolarHBondContact O-N 3.37Å; P33-T36 HydrophobicContact CB-CG2 4.17Å; P33-T36 HydrophobicContact CG-CG2 4.39Å; P33-T36 PolarHBondContact O-N 3.19Å; P33-T36 PolarHBondContact O-OG1 3.17Å
34	Q	78.1	Confident	73	Confident	181 Å²	181	136.3 Å²	136.3	85%	0.846	78%	0.776	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.1	-9	-174.3	-64	-71.4	-81.6	0	0	114.4	V32	V32-Q34 PolarHBondContact O-N 3Å
35	N	72.8	Confident	73.7	Confident	156 Å²	156	141.3 Å²	141.3	83%	0.834	78%	0.783	S	S	*	*	T	Hydrogen-bonded Turn	trans	-110.5	16.2	-176.4	-66.5	-10	0	0	0	113.4	P33 S37	P33-N35 PolarHBondContact O-N 3.37Å; N35-S37 PolarHBondContact O-N 3.47Å
36	T	65.1	Low	73.9	Confident	94 Å²	94	147.3 Å²	147.3	58%	0.577	79%	0.793	S	S	*	*			trans	-78.2	98.2	168	59.7	0	0	0	0	108.8	P33	P33-T36 HydrophobicContact CB-CG2 4.17Å; P33-T36 HydrophobicContact CG-CG2 4.39Å; P33-T36 PolarHBondContact O-N 3.19Å; P33-T36 PolarHBondContact O-OG1 3.17Å
37	S	71.1	Confident	74.1	Confident	112 Å²	112	140.8 Å²	140.8	78%	0.783	79%	0.788	S	S	*	*			trans	-66.9	137.7	162.5	56.3	0	0	0	0	109.3	N35	N35-S37 PolarHBondContact O-N 3.47Å
38	V	63.2	Low	74.3	Confident	215 Å²	215	137.9 Å²	137.9	100%	1.303	78%	0.777	S	S	*	*			trans	-64	0	173.4	179.9	0	0	0	0	110.8

Retrieved 38 of 38 residues in 75.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).