A0A087WRK5_MOUSE Loading...

Glucuronyl C5-epimerase

AlphaFold DB , UniProt , Accession A0A087WRK5, Species MOUSE (Mus musculus, Mouse), Gene Glce, Length 44 aa.

						>A0A087WRK5_MOUSE|A0A087WRK5|Glce
MRCLAARVNYKTLIIICALFTLVTVLLWNKCSSDKAIQFPRHLS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.4	Very low	60	Low	243 Å²	243	142.3 Å²	142.3	100%	1.197	71%	0.705	S	S	*	*				0	94.6	0	-63.7	-150.7	-105.3	0	0	109.9
2	R	51.3	Low	62.2	Low	235 Å²	235	135.4 Å²	135.4	89%	0.887	68%	0.677	S	S	*	*			trans	-110.2	0	-176.6	-71.3	179.5	-179.9	156.4	-0.7	113.9
3	C	51.4	Low	63.9	Low	100 Å²	100	130.2 Å²	130.2	68%	0.676	65%	0.652	S	S	*	*			trans	-89.2	-8.4	-168.3	-54.4	0	0	0	0	114.9
4	L	55.9	Low	65.7	Low	150 Å²	150	128.6 Å²	128.6	79%	0.785	65%	0.645	S	S	*	*	S	Bend	trans	-71.4	-42	-178.9	-131	75.6	0	0	0	111.3	A6 R7 V8	L4-A6 PolarHBondContact O-N 3.03Å; L4-R7 PolarHBondContact O-N 3.38Å; L4-R7 VanDerWaalsContact O-N 3.15Å; L4-V8 WeakPolarHBondContact O-CG2 3.3Å; L4-V8 PolarHBondContact O-N 3.26Å
5	A	54.5	Low	67.2	Low	59 Å²	59	125.9 Å²	125.9	49%	0.488	63%	0.633	S	S	.	*	T	Hydrogen-bonded Turn	trans	-67.3	-19.3	-178.8	0	0	0	0	0	114.5	L13	A5-L13 HydrophobicContact CB-CD1 3.83Å
6	A	54.3	Low	68.6	Low	91 Å²	91	123.7 Å²	123.7	75%	0.752	62%	0.622	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.6	-15.8	176.4	0	0	0	0	0	113.2	L4	L4-A6 PolarHBondContact O-N 3.03Å
7	R	56.7	Low	69.7	Low	228 Å²	228	120.9 Å²	120.9	86%	0.86	62%	0.616	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.6	-34.3	178.2	-73.4	-87.6	-162.1	-116.1	-0.4	112.1	L4	L4-R7 PolarHBondContact O-N 3.38Å; L4-R7 VanDerWaalsContact O-N 3.15Å
8	V	62	Low	70.9	Confident	55 Å²	55	117.3 Å²	117.3	33%	0.333	61%	0.608	S	S	.	*	S	Bend	trans	-79.9	120.3	170.3	-67.8	0	0	0	0	108.3	L4 Y10 T12 L13	L4-V8 WeakPolarHBondContact O-CG2 3.3Å; L4-V8 PolarHBondContact O-N 3.26Å; V8-Y10 PolarHBondContact O-N 2.94Å; V8-T12 HydrophobicContact CB-CG2 3.94Å; V8-T12 HydrophobicContact CG1-CG2 4.35Å; V8-L13 HydrophobicContact CG2-CD1 3.5Å; V8-L13 VanDerWaalsContact CG2-CD1 3.5Å
9	N	72.5	Confident	72.2	Confident	99 Å²	99	116.4 Å²	116.4	53%	0.529	60%	0.603	S	S	.	*			trans	-48.2	139.9	-178.6	-163.3	-35.1	0	0	0	110.2	K11 T12 L13	N9-K11 PolarHBondContact O-N 3.15Å; N9-T12 WeakPolarHBondContact O-CA 3.36Å; N9-T12 VanDerWaalsContact O-CB 3.31Å; N9-T12 WeakPolarHBondContact O-CB 3.21Å; N9-T12 PolarHBondContact O-N 3.15Å; N9-L13 PolarHBondContact O-N 2.76Å; N9-L13 VanDerWaalsContact O-N 3.12Å
10	Y	77.8	Confident	73.1	Confident	173 Å²	173	117.8 Å²	117.8	68%	0.678	60%	0.604	S	S	*	*	H	α-helix	trans	-49	-34.4	-177.5	71	-86.2	0	0	0	112	V8 L13 I14	V8-Y10 PolarHBondContact O-N 2.94Å; Y10-L13 PolarHBondContact O-N 3.48Å; Y10-I14 HydrophobicContact CD2-CD1 4.06Å; Y10-I14 VanDerWaalsContact O-CG1 3.3Å; Y10-I14 WeakPolarHBondContact O-CG1 3.31Å; Y10-I14 PolarHBondContact O-N 3.49Å
11	K	81.7	Confident	74	Confident	132 Å²	132	116.1 Å²	116.1	57%	0.574	60%	0.6	S	S	*	*	H	α-helix	trans	-62.3	-42.2	175.5	-170.2	165	177	177.1	0	112.8	N9 I15	N9-K11 PolarHBondContact O-N 3.15Å; K11-I15 HydrophobicContact CG-CD1 4.35Å; K11-I15 WeakPolarHBondContact O-CD1 3.32Å; K11-I15 WeakPolarHBondContact O-CG1 3.38Å; K11-I15 PolarHBondContact O-N 2.96Å; K11-I15 VanDerWaalsContact O-N 3.15Å
12	T	85.9	Confident	76.5	Confident	60 Å²	60	109.7 Å²	109.7	37%	0.368	57%	0.57	S	S	.	*	H	α-helix	trans	-64.9	-43.9	172.9	-73.1	0	0	0	0	111	V8 N9 I14 I15 I16	V8-T12 HydrophobicContact CB-CG2 3.94Å; V8-T12 HydrophobicContact CG1-CG2 4.35Å; N9-T12 WeakPolarHBondContact O-CA 3.36Å; N9-T12 VanDerWaalsContact O-CB 3.31Å; N9-T12 WeakPolarHBondContact O-CB 3.21Å; N9-T12 PolarHBondContact O-N 3.15Å; T12-I14 VanDerWaalsContact C-N 3.32Å; T12-I14 PolarHBondContact O-N 3.32Å; T12-I15 PolarHBondContact O-N 3.43Å; T12-I15 VanDerWaalsContact O-N 3.15Å; T12-I16 HydrophobicContact CG2-CD1 3.53Å; T12-I16 HydrophobicContact CG2-CG1 4.14Å; T12-I16 WeakPolarHBondContact O-CD1 3.4Å; T12-I16 WeakPolarHBondContact O-CG1 3.18Å; T12-I16 PolarHBondContact O-N 2.95Å
13	L	84.8	Confident	78.5	Confident	67 Å²	67	102.1 Å²	102.1	35%	0.351	55%	0.549	S	S	.	.	H	α-helix	trans	-59.4	-44.1	179.7	-148.2	95.7	0	0	0	111.9	A5 V8 N9 Y10 I15 I16 C17	A5-L13 HydrophobicContact CB-CD1 3.83Å; V8-L13 HydrophobicContact CG2-CD1 3.5Å; V8-L13 VanDerWaalsContact CG2-CD1 3.5Å; N9-L13 PolarHBondContact O-N 2.76Å; N9-L13 VanDerWaalsContact O-N 3.12Å; Y10-L13 PolarHBondContact O-N 3.48Å; L13-I15 PolarHBondContact O-N 3.12Å; L13-I16 PolarHBondContact O-N 3.24Å; L13-C17 WeakPolarHBondContact O-CB 3.27Å; L13-C17 PolarHBondContact O-N 2.89Å
14	I	88.1	Confident	80.3	Confident	108 Å²	108	100.5 Å²	100.5	55%	0.554	54%	0.537	S	S	*	.	H	α-helix	trans	-60.7	-44.9	176.1	-67.8	165.8	0	0	0	110.7	Y10 T12 C17 A18	Y10-I14 HydrophobicContact CD2-CD1 4.06Å; Y10-I14 VanDerWaalsContact O-CG1 3.3Å; Y10-I14 WeakPolarHBondContact O-CG1 3.31Å; Y10-I14 PolarHBondContact O-N 3.49Å; T12-I14 VanDerWaalsContact C-N 3.32Å; T12-I14 PolarHBondContact O-N 3.32Å; I14-C17 PolarHBondContact O-N 2.73Å; I14-A18 VanDerWaalsContact O-CB 3.32Å; I14-A18 WeakPolarHBondContact O-CB 3.38Å; I14-A18 PolarHBondContact O-N 3.25Å
15	I	88.9	Confident	82	Confident	89 Å²	89	97.6 Å²	97.6	46%	0.456	53%	0.525	S	S	.	.	H	α-helix	trans	-61.9	-46.6	178.7	-66.4	162.5	0	0	0	110.7	K11 T12 L13 A18 L19	K11-I15 HydrophobicContact CG-CD1 4.35Å; K11-I15 WeakPolarHBondContact O-CD1 3.32Å; K11-I15 WeakPolarHBondContact O-CG1 3.38Å; K11-I15 PolarHBondContact O-N 2.96Å; K11-I15 VanDerWaalsContact O-N 3.15Å; T12-I15 PolarHBondContact O-N 3.43Å; T12-I15 VanDerWaalsContact O-N 3.15Å; L13-I15 PolarHBondContact O-N 3.12Å; I15-A18 PolarHBondContact O-N 3.4Å; I15-L19 HydrophobicContact CG2-CD1 3.79Å; I15-L19 HydrophobicContact CG2-CG 4.22Å; I15-L19 WeakPolarHBondContact O-CB 3.38Å; I15-L19 VanDerWaalsContact O-CG 3.23Å; I15-L19 WeakPolarHBondContact O-CG 3.44Å; I15-L19 PolarHBondContact O-N 2.83Å
16	I	90	Very high	83.7	Confident	90 Å²	90	100 Å²	100	46%	0.462	53%	0.529	S	S	.	.	H	α-helix	trans	-65.7	-42.7	-179.3	-50.2	152	0	0	0	110.7	T12 L13 A18 L19 F20	T12-I16 HydrophobicContact CG2-CD1 3.53Å; T12-I16 HydrophobicContact CG2-CG1 4.14Å; T12-I16 WeakPolarHBondContact O-CD1 3.4Å; T12-I16 WeakPolarHBondContact O-CG1 3.18Å; T12-I16 PolarHBondContact O-N 2.95Å; L13-I16 PolarHBondContact O-N 3.24Å; I16-A18 PolarHBondContact O-N 2.86Å; I16-L19 PolarHBondContact O-N 3.15Å; I16-F20 VanDerWaalsContact O-CB 3.27Å; I16-F20 WeakPolarHBondContact O-CB 3.38Å; I16-F20 PolarHBondContact O-N 2.93Å
17	C	86.9	Confident	85.2	Confident	76 Å²	76	100.6 Å²	100.6	51%	0.514	52%	0.519	S	S	.	.	H	α-helix	trans	-60.5	-44.1	175.5	-86.2	0	0	0	0	112	L13 I14 T21	L13-C17 WeakPolarHBondContact O-CB 3.27Å; L13-C17 PolarHBondContact O-N 2.89Å; I14-C17 PolarHBondContact O-N 2.73Å; C17-T21 WeakPolarHBondContact O-CB 3.23Å; C17-T21 PolarHBondContact O-N 3.36Å; C17-T21 PolarHBondContact O-OG1 3.49Å
18	A	92	Very high	86.5	Confident	57 Å²	57	99.1 Å²	99.1	47%	0.471	51%	0.514	S	S	.	.	H	α-helix	trans	-64.7	-46.5	177.3	0	0	0	0	0	111.4	I14 I15 I16 F20 T21 L22	I14-A18 VanDerWaalsContact O-CB 3.32Å; I14-A18 WeakPolarHBondContact O-CB 3.38Å; I14-A18 PolarHBondContact O-N 3.25Å; I15-A18 PolarHBondContact O-N 3.4Å; I16-A18 PolarHBondContact O-N 2.86Å; A18-F20 PolarHBondContact O-N 3.38Å; A18-T21 PolarHBondContact O-N 3.49Å; A18-L22 VanDerWaalsContact O-CB 3.27Å; A18-L22 WeakPolarHBondContact O-CB 3.33Å; A18-L22 PolarHBondContact O-N 2.85Å
19	L	94.1	Very high	87.4	Confident	100 Å²	100	101.6 Å²	101.6	52%	0.524	53%	0.525	S	S	.	.	H	α-helix	trans	-60.3	-45.6	176.4	-73	174	0	0	0	111.6	I15 I16 L22 V23	I15-L19 HydrophobicContact CG2-CD1 3.79Å; I15-L19 HydrophobicContact CG2-CG 4.22Å; I15-L19 WeakPolarHBondContact O-CB 3.38Å; I15-L19 VanDerWaalsContact O-CG 3.23Å; I15-L19 WeakPolarHBondContact O-CG 3.44Å; I15-L19 PolarHBondContact O-N 2.83Å; I16-L19 PolarHBondContact O-N 3.15Å; L19-L22 PolarHBondContact O-N 3.25Å; L19-V23 WeakPolarHBondContact O-CB 3.39Å; L19-V23 WeakPolarHBondContact O-CG2 3.27Å; L19-V23 PolarHBondContact O-N 3.4Å
20	F	90.5	Very high	87.6	Confident	143 Å²	143	104.6 Å²	104.6	63%	0.627	53%	0.534	S	S	*	.	H	α-helix	trans	-62.4	-47.5	178.8	-175.1	-100.3	0	0	0	111.2	I16 A18 L22 V23 T24	I16-F20 VanDerWaalsContact O-CB 3.27Å; I16-F20 WeakPolarHBondContact O-CB 3.38Å; I16-F20 PolarHBondContact O-N 2.93Å; A18-F20 PolarHBondContact O-N 3.38Å; F20-L22 VanDerWaalsContact C-N 3.31Å; F20-L22 PolarHBondContact O-N 2.86Å; F20-V23 PolarHBondContact O-N 3.3Å; F20-T24 PolarHBondContact O-N 2.92Å; F20-T24 PolarHBondContact O-OG1 3.35Å
21	T	92.6	Very high	87.3	Confident	84 Å²	84	99.9 Å²	99.9	52%	0.515	53%	0.525	S	S	.	.	H	α-helix	trans	-58.9	-44.4	176.1	-53.8	0	0	0	0	111.1	C17 A18 T24 V25	C17-T21 WeakPolarHBondContact O-CB 3.23Å; C17-T21 PolarHBondContact O-N 3.36Å; C17-T21 PolarHBondContact O-OG1 3.49Å; A18-T21 PolarHBondContact O-N 3.49Å; T21-T24 PolarHBondContact O-N 3.26Å; T21-V25 WeakPolarHBondContact O-CG2 3.39Å; T21-V25 PolarHBondContact O-N 2.82Å
22	L	94.5	Very high	86.8	Confident	107 Å²	107	96.7 Å²	96.7	56%	0.56	52%	0.519	S	S	*	.	H	α-helix	trans	-61.1	-46.8	178	-164.7	81.8	0	0	0	111.1	A18 L19 F20 V25 L26	A18-L22 VanDerWaalsContact O-CB 3.27Å; A18-L22 WeakPolarHBondContact O-CB 3.33Å; A18-L22 PolarHBondContact O-N 2.85Å; L19-L22 PolarHBondContact O-N 3.25Å; F20-L22 VanDerWaalsContact C-N 3.31Å; F20-L22 PolarHBondContact O-N 2.86Å; L22-V25 PolarHBondContact O-N 3.33Å; L22-L26 HydrophobicContact CD2-CD1 4.28Å; L22-L26 HydrophobicContact CG-CD1 3.83Å; L22-L26 WeakPolarHBondContact O-CB 3.22Å; L22-L26 WeakPolarHBondContact O-CD1 3.15Å; L22-L26 PolarHBondContact O-N 2.83Å
23	V	92.9	Very high	85.9	Confident	76 Å²	76	96.8 Å²	96.8	46%	0.461	52%	0.522	S	S	.	.	H	α-helix	trans	-61.8	-46.3	177	168.4	0	0	0	0	110.5	L19 F20 V25 L26 L27	L19-V23 WeakPolarHBondContact O-CB 3.39Å; L19-V23 WeakPolarHBondContact O-CG2 3.27Å; L19-V23 PolarHBondContact O-N 3.4Å; F20-V23 PolarHBondContact O-N 3.3Å; V23-V25 VanDerWaalsContact C-N 3.35Å; V23-V25 PolarHBondContact O-N 2.98Å; V23-L26 PolarHBondContact O-N 2.76Å; V23-L27 HydrophobicContact CG1-CD1 3.47Å; V23-L27 VanDerWaalsContact CG1-CD1 3.47Å; V23-L27 WeakPolarHBondContact O-CB 3.26Å; V23-L27 WeakPolarHBondContact O-CD1 3.38Å; V23-L27 PolarHBondContact O-N 3.4Å
24	T	90.8	Very high	85	Confident	66 Å²	66	98.5 Å²	98.5	41%	0.405	53%	0.532	S	S	.	.	H	α-helix	trans	-58.2	-45.7	176.1	-57.2	0	0	0	0	111.6	F20 T21 W28	F20-T24 PolarHBondContact O-N 2.92Å; F20-T24 PolarHBondContact O-OG1 3.35Å; T21-T24 PolarHBondContact O-N 3.26Å; T24-W28 WeakPolarHBondContact O-CB 3.2Å; T24-W28 PolarHBondContact O-N 2.81Å
25	V	90.8	Very high	83.7	Confident	90 Å²	90	99.5 Å²	99.5	55%	0.545	53%	0.532	S	S	.	.	H	α-helix	trans	-67.9	-39.8	178	173.6	0	0	0	0	111.5	T21 L22 V23 W28 N29	T21-V25 WeakPolarHBondContact O-CG2 3.39Å; T21-V25 PolarHBondContact O-N 2.82Å; L22-V25 PolarHBondContact O-N 3.33Å; V23-V25 VanDerWaalsContact C-N 3.35Å; V23-V25 PolarHBondContact O-N 2.98Å; V25-W28 PolarHBondContact O-N 3.46Å; V25-N29 VanDerWaalsContact O-CB 3.26Å; V25-N29 WeakPolarHBondContact O-CB 3.44Å; V25-N29 PolarHBondContact O-N 3.42Å
26	L	88.9	Confident	82.2	Confident	110 Å²	110	98.3 Å²	98.3	58%	0.576	54%	0.536	S	S	*	.	H	α-helix	trans	-64.1	-45.7	175.7	-105.4	114.9	0	0	0	111.8	L22 V23 W28 N29 K30	L22-L26 HydrophobicContact CD2-CD1 4.28Å; L22-L26 HydrophobicContact CG-CD1 3.83Å; L22-L26 WeakPolarHBondContact O-CB 3.22Å; L22-L26 WeakPolarHBondContact O-CD1 3.15Å; L22-L26 PolarHBondContact O-N 2.83Å; V23-L26 PolarHBondContact O-N 2.76Å; L26-W28 VanDerWaalsContact C-N 3.32Å; L26-N29 PolarHBondContact O-N 2.8Å; L26-K30 WeakPolarHBondContact O-CB 3.2Å; L26-K30 PolarHBondContact O-N 2.8Å
27	L	87.4	Confident	80.7	Confident	103 Å²	103	99.2 Å²	99.2	54%	0.539	54%	0.54	S	S	.	.	H	α-helix	trans	-65	-40	175.1	-90.1	86	0	0	0	110.5	V23 K30 C31	V23-L27 HydrophobicContact CG1-CD1 3.47Å; V23-L27 VanDerWaalsContact CG1-CD1 3.47Å; V23-L27 WeakPolarHBondContact O-CB 3.26Å; V23-L27 WeakPolarHBondContact O-CD1 3.38Å; V23-L27 PolarHBondContact O-N 3.4Å; L27-K30 PolarHBondContact O-N 3.42Å; L27-C31 WeakPolarHBondContact O-CB 3.19Å; L27-C31 PolarHBondContact O-N 3.04Å
28	W	84.1	Confident	79.2	Confident	196 Å²	196	102.2 Å²	102.2	74%	0.742	55%	0.547	S	S	*	.	H	α-helix	trans	-62.3	-46.2	176.4	-172.1	-88.1	0	0	0	111.2	T24 V25 L26 S32	T24-W28 WeakPolarHBondContact O-CB 3.2Å; T24-W28 PolarHBondContact O-N 2.81Å; V25-W28 PolarHBondContact O-N 3.46Å; L26-W28 VanDerWaalsContact C-N 3.32Å; W28-S32 WeakPolarHBondContact O-CA 3.23Å; W28-S32 WeakPolarHBondContact O-CB 3.23Å; W28-S32 PolarHBondContact O-N 2.82Å
29	N	79.7	Confident	77.4	Confident	108 Å²	108	108 Å²	108	58%	0.578	56%	0.561	S	S	*	*	H	α-helix	trans	-66.7	-43.9	178.5	-165.3	-13	0	0	0	111.1	V25 L26 S32 S33	V25-N29 VanDerWaalsContact O-CB 3.26Å; V25-N29 WeakPolarHBondContact O-CB 3.44Å; V25-N29 PolarHBondContact O-N 3.42Å; L26-N29 PolarHBondContact O-N 2.8Å; N29-S32 PolarHBondContact O-N 3.34Å; N29-S33 WeakPolarHBondContact O-CB 3.06Å; N29-S33 PolarHBondContact O-N 2.81Å
30	K	77.1	Confident	75.7	Confident	162 Å²	162	107.7 Å²	107.7	70%	0.704	57%	0.566	S	S	*	*	H	α-helix	trans	-64.6	-48.6	176.9	-171.1	172.8	169.4	76.3	0	111.7	L26 L27 S33 D34	L26-K30 WeakPolarHBondContact O-CB 3.2Å; L26-K30 PolarHBondContact O-N 2.8Å; L27-K30 PolarHBondContact O-N 3.42Å; K30-S33 PolarHBondContact O-N 2.79Å; K30-D34 VanDerWaalsContact O-CB 3.24Å; K30-D34 WeakPolarHBondContact O-CB 3Å; K30-D34 PolarHBondContact O-N 2.76Å
31	C	72.4	Confident	74.1	Confident	74 Å²	74	110.2 Å²	110.2	50%	0.5	57%	0.571	S	S	.	*	H	α-helix	trans	-65.2	-38.2	175	-83.7	0	0	0	0	112.2	L27 K35	L27-C31 WeakPolarHBondContact O-CB 3.19Å; L27-C31 PolarHBondContact O-N 3.04Å; C31-K35 VanDerWaalsContact O-CB 3.23Å; C31-K35 WeakPolarHBondContact O-CB 3.36Å; C31-K35 VanDerWaalsContact O-CG 3.23Å; C31-K35 WeakPolarHBondContact O-CG 3.44Å; C31-K35 PolarHBondContact O-N 3.31Å
32	S	70.8	Confident	72.2	Confident	64 Å²	64	114.9 Å²	114.9	45%	0.448	59%	0.587	S	S	.	*	H	α-helix	trans	-69	-36.1	176	-170.7	0	0	0	0	111.4	W28 N29 A36	W28-S32 WeakPolarHBondContact O-CA 3.23Å; W28-S32 WeakPolarHBondContact O-CB 3.23Å; W28-S32 PolarHBondContact O-N 2.82Å; N29-S32 PolarHBondContact O-N 3.34Å; S32-A36 WeakPolarHBondContact O-CB 3.16Å; S32-A36 PolarHBondContact O-N 3.34Å
33	S	67.1	Low	70.5	Confident	63 Å²	63	118 Å²	118	44%	0.441	60%	0.603	S	S	.	*	H	α-helix	trans	-71.5	-39.6	175.1	-170.8	0	0	0	0	111.4	N29 K30 A36 I37	N29-S33 WeakPolarHBondContact O-CB 3.06Å; N29-S33 PolarHBondContact O-N 2.81Å; K30-S33 PolarHBondContact O-N 2.79Å; S33-A36 PolarHBondContact O-N 2.75Å; S33-I37 WeakPolarHBondContact O-CG1 3.24Å; S33-I37 PolarHBondContact O-N 2.84Å
34	D	65.8	Low	68.2	Low	103 Å²	103	123 Å²	123	55%	0.551	64%	0.641	S	S	*	*	H	α-helix	trans	-66.5	-43	175.6	-158.2	-94.4	0	0	0	110.5	K30 A36 I37 Q38	K30-D34 VanDerWaalsContact O-CB 3.24Å; K30-D34 WeakPolarHBondContact O-CB 3Å; K30-D34 PolarHBondContact O-N 2.76Å; D34-A36 PolarHBondContact O-N 2.77Å; D34-I37 PolarHBondContact O-N 3.2Å; D34-Q38 PolarHBondContact O-N 3.49Å
35	K	59.5	Low	67	Low	128 Å²	128	125.9 Å²	125.9	56%	0.557	65%	0.653	S	S	*	*	H	α-helix	trans	-68	-31.9	172	-70.6	-163.3	-175.1	-170.4	0	113	C31 I37 Q38 F39	C31-K35 VanDerWaalsContact O-CB 3.23Å; C31-K35 WeakPolarHBondContact O-CB 3.36Å; C31-K35 VanDerWaalsContact O-CG 3.23Å; C31-K35 WeakPolarHBondContact O-CG 3.44Å; C31-K35 PolarHBondContact O-N 3.31Å; K35-I37 VanDerWaalsContact C-N 3.29Å; K35-I37 PolarHBondContact O-N 3.04Å; K35-Q38 CarbonylContact O-C 3.54Å; K35-Q38 PolarHBondContact O-N 3.2Å; K35-F39 VanDerWaalsContact O-CB 3.26Å; K35-F39 WeakPolarHBondContact O-CB 3.26Å; K35-F39 WeakPolarHBondContact O-CD2 3.1Å; K35-F39 PolarHBondContact O-N 3.49Å
36	A	58.8	Low	65.8	Low	64 Å²	64	127.7 Å²	127.7	53%	0.529	66%	0.659	S	S	.	*	H	α-helix	trans	-68.4	-28.2	172.7	0	0	0	0	0	112.5	S32 S33 D34 P40	S32-A36 WeakPolarHBondContact O-CB 3.16Å; S32-A36 PolarHBondContact O-N 3.34Å; S33-A36 PolarHBondContact O-N 2.75Å; D34-A36 PolarHBondContact O-N 2.77Å; A36-P40 WeakPolarHBondContact O-CD 3.41Å
37	I	57.5	Low	64.5	Low	109 Å²	109	128.7 Å²	128.7	56%	0.559	66%	0.663	S	S	*	*	H	α-helix	trans	-76.2	-28.3	171.3	-67.4	173	0	0	0	111.4	S33 D34 K35 P40	S33-I37 WeakPolarHBondContact O-CG1 3.24Å; S33-I37 PolarHBondContact O-N 2.84Å; D34-I37 PolarHBondContact O-N 3.2Å; K35-I37 VanDerWaalsContact C-N 3.29Å; K35-I37 PolarHBondContact O-N 3.04Å; I37-P40 WeakPolarHBondContact O-CD 3.5Å
38	Q	56.4	Low	63.1	Low	140 Å²	140	130.2 Å²	130.2	65%	0.654	67%	0.671	S	S	*	*	H	α-helix	trans	-85.6	-23.9	175.9	-152.6	176.2	-4.2	0	0	113.4	D34 K35 R41	D34-Q38 PolarHBondContact O-N 3.49Å; K35-Q38 CarbonylContact O-C 3.54Å; K35-Q38 PolarHBondContact O-N 3.2Å; Q38-R41 PolarHBondContact O-N 3.43Å
39	F	54.7	Low	61.8	Low	177 Å²	177	126.1 Å²	126.1	78%	0.776	67%	0.666	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.2	-2.2	-179.9	-109.2	-89.3	0	0	0	118.7	K35	K35-F39 VanDerWaalsContact O-CB 3.26Å; K35-F39 WeakPolarHBondContact O-CB 3.26Å; K35-F39 WeakPolarHBondContact O-CD2 3.1Å; K35-F39 PolarHBondContact O-N 3.49Å
40	P	57.2	Low	60.6	Low	94 Å²	94	127.3 Å²	127.3	61%	0.61	67%	0.672	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99	0.6	167.7	31	-18.6	0	0	0	113.1	A36 I37	A36-P40 WeakPolarHBondContact O-CD 3.41Å; I37-P40 WeakPolarHBondContact O-CD 3.5Å
41	R	57.3	Low	59.5	Low	197 Å²	197	124.9 Å²	124.9	74%	0.743	67%	0.67	S	S	*	*	S	Bend	trans	-108.9	5.7	-171.3	-68.5	-153.6	173	117.3	-0.6	116.4	Q38	Q38-R41 PolarHBondContact O-N 3.43Å
42	H	53.6	Low	58.5	Low	182 Å²	182	128.8 Å²	128.8	84%	0.843	68%	0.683	S	S	*	*	S	Bend	trans	-117.3	40.3	175.7	-152.6	-86.6	0	0	0	111.8
43	L	57.3	Low	57.4	Low	171 Å²	171	134.2 Å²	134.2	90%	0.895	70%	0.703	S	S	*	*			trans	-139.4	62.7	170.9	-141.4	114	0	0	0	109.4
44	S	44.2	Very low	56.6	Low	182 Å²	182	140.6 Å²	140.6	100%	1.273	73%	0.726	S	S	*	*			trans	-153.2	0	163.7	61.5	0	0	0	0	109.3

Retrieved 44 of 44 residues in 147.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).