A0A087WRK7_MOUSE Loading...

Potassium voltage-gated channel, subfamily Q, member 1

AlphaFold DB , UniProt , Accession A0A087WRK7, Species MOUSE (Mus musculus, Mouse), Gene Kcnq1, Length 60 aa.

						>A0A087WRK7_MOUSE|A0A087WRK7|Kcnq1
MTLGCVKLTTEANRTVSESYSCEWCESPGTMHQLPTSILIPKNMPGGFLIVLVCLIFSVL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	32.9	Very low	41.2	Very low	232 Å²	232	99.3 Å²	99.3	100%	1.143	54%	0.544	S	S	*	.				0	98.7	0	-72.6	161.2	169.6	0	0	107
2	T	34.3	Very low	41.4	Very low	143 Å²	143	100.6 Å²	100.6	88%	0.877	58%	0.578	S	S	*	*			trans	-81.7	116.8	-177.9	5.8	0	0	0	0	109.1	G4	T2-G4 PolarHBondContact O-N 3.26Å
3	L	37.5	Very low	41	Very low	119 Å²	119	105 Å²	105	62%	0.623	60%	0.599	S	S	*	*			trans	-75.8	114.3	170.4	-82.7	104.2	0	0	0	108.6
4	G	40	Very low	40.7	Very low	33 Å²	33	111.8 Å²	111.8	34%	0.34	61%	0.61	S	S	.	*	P	Polyproline II helix	trans	-80.3	124.9	169.1	0	0	0	0	0	110.2	T2	T2-G4 PolarHBondContact O-N 3.26Å
5	C	45.2	Very low	40.7	Very low	33 Å²	33	111.3 Å²	111.3	22%	0.223	61%	0.612	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-95.9	122.6	173.3	-65.4	0	0	0	0	107	Y20 C25	C5-Y20 PolarHBondContact O-N 3.37Å; C5-C25 WeakPolarHBondContact CB-SG 3.4Å; C5-C25 WeakPolarHBondContact SG-CB 3.26Å; C5-C25 CovalentContact SG-SG 2.11Å; C5-C25 PolarHBondContact SG-SG 3.2Å
6	V	45.3	Very low	40.7	Very low	48 Å²	48	108.8 Å²	108.8	29%	0.291	60%	0.601	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-100	122.3	176.1	178.1	0	0	0	0	108.3	L8 S17	V6-L8 HydrophobicContact CG1-CD1 4.2Å; V6-L8 HydrophobicContact CG1-CG 4.38Å; V6-S17 WeakPolarHBondContact CG1-OG 3.4Å
7	K	44	Very low	40.8	Very low	104 Å²	104	106.9 Å²	106.9	45%	0.452	60%	0.597	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-93.6	111	173.9	-172.5	174.6	177.2	169	0	108.2	E18	K7-E18 PolarHBondContact N-O 3.4Å; K7-E18 VanDerWaalsContact N-O 3.09Å; K7-E18 PolarHBondContact O-N 3.24Å
8	L	43.5	Very low	40.9	Very low	78 Å²	78	105.7 Å²	105.7	41%	0.408	59%	0.586	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-94.2	107.8	169.7	-81.8	129.5	0	0	0	107.9	V6 T15	V6-L8 HydrophobicContact CG1-CD1 4.2Å; V6-L8 HydrophobicContact CG1-CG 4.38Å; L8-T15 HydrophobicContact CD2-CG2 4.21Å
9	T	44.8	Very low	41	Very low	49 Å²	49	105.2 Å²	105.2	30%	0.301	59%	0.591	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-102.5	115	173.7	-27.7	0	0	0	0	107.1	V16	T9-V16 PolarHBondContact N-O 3.45Å; T9-V16 PolarHBondContact O-N 3.28Å
10	T	44.4	Very low	41.2	Very low	101 Å²	101	105.5 Å²	105.5	62%	0.62	58%	0.583	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-96.7	93.4	175.1	-51.4	0	0	0	0	107.9
11	E	40.9	Very low	41	Very low	152 Å²	152	106.2 Å²	106.2	71%	0.71	60%	0.595	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-86.1	150	158.9	-74.3	-169.8	130	0	0	108.3	N13 R14	E11-N13 PolarHBondContact O-N 2.63Å; E11-R14 PolarHBondContact O-N 3.09Å
12	A	43.4	Very low	41.3	Very low	115 Å²	115	98 Å²	98	95%	0.95	56%	0.56	S	S	*	*	T	Hydrogen-bonded Turn	trans	-51.1	5.8	-159.3	0	0	0	0	0	119.5
13	N	37	Very low	41.6	Very low	158 Å²	158	100.8 Å²	100.8	85%	0.845	56%	0.563	S	S	*	*	T	Hydrogen-bonded Turn	trans	-159.2	15.4	168.9	-154.2	-7.4	0	0	0	114.2	E11	E11-N13 PolarHBondContact O-N 2.63Å
14	R	35.9	Very low	41.8	Very low	200 Å²	200	105.9 Å²	105.9	76%	0.755	57%	0.574	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-148.2	119.4	179.1	-96.6	-170	171.4	100.4	-1.5	110.7	E11 V16	E11-R14 PolarHBondContact O-N 3.09Å; R14-V16 HydrophobicContact CB-CG2 4.39Å; R14-V16 PolarHBondContact O-N 3.37Å
15	T	41.5	Very low	42.1	Very low	104 Å²	104	108.4 Å²	108.4	64%	0.638	59%	0.586	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-83	104.1	164.4	4.9	0	0	0	0	108.3	L8	L8-T15 HydrophobicContact CD2-CG2 4.21Å
16	V	40.3	Very low	41.9	Very low	72 Å²	72	114.9 Å²	114.9	44%	0.436	61%	0.613	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-96.1	116.7	172.1	-171	0	0	0	0	107.8	T9 R14 E18	T9-V16 PolarHBondContact N-O 3.45Å; T9-V16 PolarHBondContact O-N 3.28Å; R14-V16 HydrophobicContact CB-CG2 4.39Å; R14-V16 PolarHBondContact O-N 3.37Å; V16-E18 HydrophobicContact CG1-CG 3.93Å
17	S	42.8	Very low	41.4	Very low	76 Å²	76	117.7 Å²	117.7	53%	0.531	64%	0.635	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-97.3	99.4	176	-175.2	0	0	0	0	108.5	V6	V6-S17 WeakPolarHBondContact CG1-OG 3.4Å
18	E	43.1	Very low	41.5	Very low	85 Å²	85	119.7 Å²	119.7	40%	0.397	66%	0.658	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-99.5	119.9	173.4	-66.7	-165.6	118.2	0	0	109.6	K7 V16 Y20	K7-E18 PolarHBondContact N-O 3.4Å; K7-E18 VanDerWaalsContact N-O 3.09Å; K7-E18 PolarHBondContact O-N 3.24Å; V16-E18 HydrophobicContact CG1-CG 3.93Å; E18-Y20 HydrophobicContact CB-CD2 3.89Å; E18-Y20 HydrophobicContact CB-CE2 3.28Å; E18-Y20 HydrophobicContact CG-CE2 4.21Å; E18-Y20 PolarHBondContact OE1-OH 3.39Å; E18-Y20 WeakPolarHBondContact OE2-CE2 3.49Å; E18-Y20 PolarHBondContact OE2-OH 2.11Å
19	S	42.8	Very low	41.2	Very low	97 Å²	97	118.6 Å²	118.6	68%	0.678	67%	0.666	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-91.5	104.5	175.9	-65	0	0	0	0	108.6
20	Y	44.7	Very low	40.9	Very low	110 Å²	110	123 Å²	123	43%	0.431	69%	0.693	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-100.8	128.4	174.9	-66.5	-86.2	0	0	0	109.7	C5 E18 C22	C5-Y20 PolarHBondContact O-N 3.37Å; E18-Y20 HydrophobicContact CB-CD2 3.89Å; E18-Y20 HydrophobicContact CB-CE2 3.28Å; E18-Y20 HydrophobicContact CG-CE2 4.21Å; E18-Y20 PolarHBondContact OE1-OH 3.39Å; E18-Y20 WeakPolarHBondContact OE2-CE2 3.49Å; E18-Y20 PolarHBondContact OE2-OH 2.11Å; Y20-C22 PolarHBondContact O-N 3.43Å
21	S	37.7	Very low	40.8	Very low	121 Å²	121	123.7 Å²	123.7	85%	0.846	69%	0.69	S	S	*	*			trans	-84.7	95.8	166.9	-71.7	0	0	0	0	107.9
22	C	39.2	Very low	40.7	Very low	61 Å²	61	125.9 Å²	125.9	41%	0.412	70%	0.7	S	S	.	*			trans	-109.6	124.8	179.9	-63.3	0	0	0	0	110.9	Y20 W24	Y20-C22 PolarHBondContact O-N 3.43Å; C22-W24 PolarHBondContact O-N 2.91Å
23	E	38.8	Very low	40.3	Very low	200 Å²	200	128.7 Å²	128.7	94%	0.935	69%	0.694	S	S	*	*	S	Bend	trans	-71.2	2.3	162.9	-72.6	-177.3	114	0	0	112.6
24	W	42.9	Very low	40.7	Very low	227 Å²	227	128.4 Å²	128.4	86%	0.86	69%	0.691	S	S	*	*			trans	-125.6	36.9	-166.1	-106.6	29.5	0	0	0	113.4	C22 E26	C22-W24 PolarHBondContact O-N 2.91Å; W24-E26 PolarHBondContact O-N 2.9Å
25	C	46.4	Very low	41	Very low	86 Å²	86	122 Å²	122	58%	0.581	68%	0.676	S	S	*	*			trans	-73.9	38.5	162.7	-66.9	0	0	0	0	110.5	C5	C5-C25 WeakPolarHBondContact CB-SG 3.4Å; C5-C25 WeakPolarHBondContact SG-CB 3.26Å; C5-C25 CovalentContact SG-SG 2.11Å; C5-C25 PolarHBondContact SG-SG 3.2Å
26	E	40.4	Very low	41.2	Very low	168 Å²	168	123 Å²	123	79%	0.785	68%	0.682	S	S	*	*			trans	-128.9	80.6	177.1	-167.2	-179.3	119	0	0	110	W24	W24-E26 PolarHBondContact O-N 2.9Å
27	S	34.1	Very low	41.4	Very low	108 Å²	108	121 Å²	121	76%	0.755	67%	0.671	S	S	*	*			trans	-176.4	106.8	148.6	-92.1	0	0	0	0	110.8	G29	S27-G29 VanDerWaalsContact C-N 3.28Å; S27-G29 PolarHBondContact O-N 3.22Å; S27-G29 VanDerWaalsContact O-N 3.13Å
28	P	47.3	Very low	41.7	Very low	146 Å²	146	121.3 Å²	121.3	95%	0.948	67%	0.666	S	S	*	*			trans	-84.4	73.6	169.4	34.9	-29.9	0	0	0	108.2
29	G	37.8	Very low	42.1	Very low	55 Å²	55	123.1 Å²	123.1	57%	0.567	68%	0.678	S	S	*	*			trans	-171.4	54	-168.9	0	0	0	0	0	114.9	S27	S27-G29 VanDerWaalsContact C-N 3.28Å; S27-G29 PolarHBondContact O-N 3.22Å; S27-G29 VanDerWaalsContact O-N 3.13Å
30	T	38.2	Very low	42.5	Very low	142 Å²	142	120.8 Å²	120.8	87%	0.871	66%	0.657	S	S	*	*			trans	168	84.6	151.1	31.4	0	0	0	0	108.9
31	M	41.4	Very low	42.5	Very low	115 Å²	115	118.7 Å²	118.7	57%	0.567	66%	0.657	S	S	*	*			trans	-122.8	87.3	156	-80.9	-134.2	-73.5	0	0	108.1	Q33 L34	M31-Q33 PolarHBondContact O-N 3.02Å; M31-L34 HydrophobicContact CE-CD1 4.4Å
32	H	38.9	Very low	42.9	Very low	198 Å²	198	121.4 Å²	121.4	92%	0.917	65%	0.654	S	S	*	*	S	Bend	trans	-60.3	125.1	147.2	-104.7	-170.2	0	0	0	106.7
33	Q	35.5	Very low	43.3	Very low	173 Å²	173	125 Å²	125	81%	0.808	67%	0.668	S	S	*	*	S	Bend	trans	64.5	113.7	-167.8	-68.1	175.9	-0.6	0	0	113.4	M31 P35	M31-Q33 PolarHBondContact O-N 3.02Å; Q33-P35 VanDerWaalsContact C-CD 3.44Å; Q33-P35 WeakPolarHBondContact O-CD 3.36Å
34	L	45.9	Very low	43.7	Very low	152 Å²	152	121.9 Å²	121.9	80%	0.796	66%	0.656	S	S	*	*			trans	-82.4	93.2	163.2	-167.6	78.2	0	0	0	106.6	M31	M31-L34 HydrophobicContact CE-CD1 4.4Å
35	P	40.8	Very low	43.7	Very low	67 Å²	67	117.9 Å²	117.9	44%	0.435	66%	0.659	S	S	.	*			trans	-68.1	147.8	148.9	33.8	-30.7	0	0	0	105.5	Q33 S37	Q33-P35 VanDerWaalsContact C-CD 3.44Å; Q33-P35 WeakPolarHBondContact O-CD 3.36Å; P35-S37 PolarHBondContact O-N 2.82Å
36	T	47.1	Very low	44	Very low	124 Å²	124	115.9 Å²	115.9	76%	0.761	65%	0.653	S	S	*	*			trans	-58.5	61.3	173.1	26.8	0	0	0	0	111.9	I38	T36-I38 PolarHBondContact O-N 3.13Å
37	S	43.2	Very low	44.6	Very low	31 Å²	31	108.4 Å²	108.4	22%	0.217	62%	0.621	C	S	.	*			trans	-87.3	88.3	178.3	-179.5	0	0	0	0	107.2	P35 L39	P35-S37 PolarHBondContact O-N 2.82Å; S37-L39 PolarHBondContact O-N 2.93Å; S37-L39 VanDerWaalsContact O-N 3.09Å
38	I	50.3	Low	45.6	Very low	82 Å²	82	110.9 Å²	110.9	42%	0.421	62%	0.618	S	S	.	*			trans	-73.8	101.6	175.4	-49.6	174.5	0	0	0	107	T36 I40 C54	T36-I38 PolarHBondContact O-N 3.13Å; I38-I40 HydrophobicContact CB-CD1 4.42Å; I38-I40 HydrophobicContact CB-CG1 4.32Å; I38-I40 HydrophobicContact CG2-CD1 3.77Å; I38-I40 HydrophobicContact CG2-CG1 3.51Å; I38-I40 PolarHBondContact O-N 2.63Å; I38-C54 HydrophobicContact CD1-CB 3.95Å
39	L	50.3	Low	46	Very low	123 Å²	123	109.5 Å²	109.5	64%	0.644	60%	0.602	S	S	*	*			trans	-75.6	103.4	172.1	-75.8	152.5	0	0	0	108.2	S37	S37-L39 PolarHBondContact O-N 2.93Å; S37-L39 VanDerWaalsContact O-N 3.09Å
40	I	52	Low	47	Very low	47 Å²	47	111.6 Å²	111.6	24%	0.241	60%	0.599	C	S	.	*			trans	-104.3	114.6	-179	-55.5	174.5	0	0	0	108.7	I38 K42 V51	I38-I40 HydrophobicContact CB-CD1 4.42Å; I38-I40 HydrophobicContact CB-CG1 4.32Å; I38-I40 HydrophobicContact CG2-CD1 3.77Å; I38-I40 HydrophobicContact CG2-CG1 3.51Å; I38-I40 PolarHBondContact O-N 2.63Å; I40-K42 PolarHBondContact O-N 3.2Å; I40-V51 HydrophobicContact CD1-CB 4.29Å; I40-V51 HydrophobicContact CD1-CG2 3.32Å; I40-V51 HydrophobicContact CG2-CG2 4.21Å
41	P	44.1	Very low	47.9	Very low	66 Å²	66	107.3 Å²	107.3	43%	0.429	57%	0.573	S	S	.	*			trans	-65.4	120.2	176.1	23.9	-29.6	0	0	0	109.7	N43 M44	P41-N43 PolarHBondContact O-N 3.25Å; P41-M44 HydrophobicContact CG-SD 4.29Å
42	K	47.1	Very low	48.5	Very low	179 Å²	179	105.7 Å²	105.7	78%	0.778	57%	0.566	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.7	0.1	-176.7	-161.1	-159.1	156.9	78.3	0	114.4	I40	I40-K42 PolarHBondContact O-N 3.2Å
43	N	45.8	Very low	49.3	Very low	135 Å²	135	100 Å²	100	72%	0.722	55%	0.545	S	S	*	.	T	Hydrogen-bonded Turn	trans	-134.9	30.9	-167.9	-149	18.9	0	0	0	114.7	P41	P41-N43 PolarHBondContact O-N 3.25Å
44	M	47.3	Very low	50.2	Low	135 Å²	135	93.9 Å²	93.9	67%	0.665	52%	0.521	S	S	*	.	S	Bend	trans	-108	123.9	167.1	-102.3	172	155.2	0	0	109.7	P41 G46 G47	P41-M44 HydrophobicContact CG-SD 4.29Å; M44-G46 VanDerWaalsContact C-N 3.29Å; M44-G46 PolarHBondContact O-N 3.09Å; M44-G47 PolarHBondContact O-N 2.99Å
45	P	44.3	Very low	50.5	Low	144 Å²	144	91.7 Å²	91.7	94%	0.935	51%	0.51	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.5	92.6	170.4	27.5	-31.5	0	0	0	108.2
46	G	51.3	Low	51	Low	44 Å²	44	93.4 Å²	93.4	45%	0.454	51%	0.514	S	S	.	.	T	Hydrogen-bonded Turn	trans	143.2	-17.8	-171.4	0	0	0	0	0	114.4	M44 F48 L49	M44-G46 VanDerWaalsContact C-N 3.29Å; M44-G46 PolarHBondContact O-N 3.09Å; G46-F48 PolarHBondContact O-N 3.45Å; G46-L49 WeakPolarHBondContact O-CB 3.38Å; G46-L49 PolarHBondContact O-N 3.45Å; G46-L49 VanDerWaalsContact O-N 3.09Å
47	G	53.8	Low	51	Low	10 Å²	10	95.6 Å²	95.6	10%	0.103	51%	0.513	C	S	.	.	H	α-helix	trans	-60.7	-30.3	179.2	0	0	0	0	0	113.7	M44 L49 I50 V51	M44-G47 PolarHBondContact O-N 2.99Å; G47-L49 VanDerWaalsContact C-N 3.28Å; G47-L49 PolarHBondContact O-N 2.95Å; G47-I50 PolarHBondContact O-N 3.41Å; G47-V51 WeakPolarHBondContact O-CG2 3.19Å; G47-V51 PolarHBondContact O-N 3.44Å; G47-V51 VanDerWaalsContact O-N 3.17Å
48	F	56.1	Low	51	Low	160 Å²	160	98.9 Å²	98.9	70%	0.702	54%	0.536	S	S	*	.	H	α-helix	trans	-61	-35.9	176	-176.4	-99.8	0	0	0	112.7	G46 I50 V51 L52	G46-F48 PolarHBondContact O-N 3.45Å; F48-I50 VanDerWaalsContact C-N 3.34Å; F48-V51 PolarHBondContact O-N 3.31Å; F48-L52 HydrophobicContact CE1-CD1 3.96Å; F48-L52 HydrophobicContact CZ-CD1 4.01Å; F48-L52 WeakPolarHBondContact O-CB 3.36Å; F48-L52 PolarHBondContact O-N 3.36Å
49	L	55.2	Low	50.8	Low	118 Å²	118	101.1 Å²	101.1	62%	0.618	55%	0.553	S	S	*	*	H	α-helix	trans	-71	-34.9	-177.2	-147	139.1	0	0	0	110.9	G46 G47 L52 V53	G46-L49 WeakPolarHBondContact O-CB 3.38Å; G46-L49 PolarHBondContact O-N 3.45Å; G46-L49 VanDerWaalsContact O-N 3.09Å; G47-L49 VanDerWaalsContact C-N 3.28Å; G47-L49 PolarHBondContact O-N 2.95Å; L49-L52 PolarHBondContact O-N 3.09Å; L49-V53 HydrophobicContact CD2-CG2 4.31Å; L49-V53 WeakPolarHBondContact O-CB 3.38Å; L49-V53 VanDerWaalsContact O-CG2 3.23Å; L49-V53 WeakPolarHBondContact O-CG2 3.39Å; L49-V53 PolarHBondContact O-N 3.4Å
50	I	58.9	Low	50.5	Low	99 Å²	99	105.2 Å²	105.2	51%	0.508	58%	0.575	S	S	.	*	H	α-helix	trans	-69	-43.7	175.4	-62	165.5	0	0	0	110.7	G47 F48 L52 V53 C54	G47-I50 PolarHBondContact O-N 3.41Å; F48-I50 VanDerWaalsContact C-N 3.34Å; I50-L52 VanDerWaalsContact C-N 3.32Å; I50-L52 PolarHBondContact O-N 3.44Å; I50-V53 PolarHBondContact O-N 3.17Å; I50-C54 WeakPolarHBondContact O-CB 3.48Å; I50-C54 PolarHBondContact O-N 2.98Å; I50-C54 PolarHBondContact O-SG 3.36Å; I50-C54 VanDerWaalsContact O-SG 3.41Å
51	V	56	Low	50.4	Low	52 Å²	52	108.2 Å²	108.2	32%	0.315	59%	0.592	S	S	.	*	H	α-helix	trans	-58	-47.5	173.6	-179.2	0	0	0	0	110.4	I40 G47 F48 C54 L55	I40-V51 HydrophobicContact CD1-CB 4.29Å; I40-V51 HydrophobicContact CD1-CG2 3.32Å; I40-V51 HydrophobicContact CG2-CG2 4.21Å; G47-V51 WeakPolarHBondContact O-CG2 3.19Å; G47-V51 PolarHBondContact O-N 3.44Å; G47-V51 VanDerWaalsContact O-N 3.17Å; F48-V51 PolarHBondContact O-N 3.31Å; V51-C54 PolarHBondContact O-N 2.99Å; V51-L55 HydrophobicContact CG1-CD1 3.84Å; V51-L55 HydrophobicContact CG1-CG 4.34Å; V51-L55 WeakPolarHBondContact O-CB 2.87Å; V51-L55 WeakPolarHBondContact O-CG 3.37Å; V51-L55 PolarHBondContact O-N 3.28Å
52	L	55.4	Low	50.8	Low	80 Å²	80	110.4 Å²	110.4	42%	0.419	60%	0.6	S	S	.	*	H	α-helix	trans	-62.5	-45.6	-177.2	-162	99.7	0	0	0	111.2	F48 L49 I50 L55 I56	F48-L52 HydrophobicContact CE1-CD1 3.96Å; F48-L52 HydrophobicContact CZ-CD1 4.01Å; F48-L52 WeakPolarHBondContact O-CB 3.36Å; F48-L52 PolarHBondContact O-N 3.36Å; L49-L52 PolarHBondContact O-N 3.09Å; I50-L52 VanDerWaalsContact C-N 3.32Å; I50-L52 PolarHBondContact O-N 3.44Å; L52-L55 PolarHBondContact O-N 3.23Å; L52-I56 HydrophobicContact CD2-CD1 3.97Å; L52-I56 HydrophobicContact CG-CD1 4.05Å; L52-I56 WeakPolarHBondContact O-CD1 3.49Å; L52-I56 WeakPolarHBondContact O-CG1 3.23Å; L52-I56 PolarHBondContact O-N 2.63Å
53	V	55.8	Low	51	Low	78 Å²	78	106.6 Å²	106.6	47%	0.473	59%	0.59	S	S	.	*	H	α-helix	trans	-65	-43.8	178.1	172.2	0	0	0	0	111.4	L49 I50 L55 I56 F57	L49-V53 HydrophobicContact CD2-CG2 4.31Å; L49-V53 WeakPolarHBondContact O-CB 3.38Å; L49-V53 VanDerWaalsContact O-CG2 3.23Å; L49-V53 WeakPolarHBondContact O-CG2 3.39Å; L49-V53 PolarHBondContact O-N 3.4Å; I50-V53 PolarHBondContact O-N 3.17Å; V53-L55 VanDerWaalsContact C-N 3.35Å; V53-L55 PolarHBondContact O-N 3.33Å; V53-I56 PolarHBondContact O-N 3.47Å; V53-F57 PolarHBondContact O-N 2.78Å
54	C	53.8	Low	51.3	Low	45 Å²	45	104.9 Å²	104.9	30%	0.304	58%	0.583	S	S	.	*	H	α-helix	trans	-65.4	-36.5	177.3	-73.1	0	0	0	0	112.8	I38 I50 V51 S58	I38-C54 HydrophobicContact CD1-CB 3.95Å; I50-C54 WeakPolarHBondContact O-CB 3.48Å; I50-C54 PolarHBondContact O-N 2.98Å; I50-C54 PolarHBondContact O-SG 3.36Å; I50-C54 VanDerWaalsContact O-SG 3.41Å; V51-C54 PolarHBondContact O-N 2.99Å; C54-S58 WeakPolarHBondContact O-CB 3.48Å; C54-S58 PolarHBondContact O-N 3.47Å; C54-S58 PolarHBondContact O-OG 3.41Å
55	L	51	Low	51.5	Low	107 Å²	107	103 Å²	103	56%	0.56	58%	0.577	S	S	*	*	H	α-helix	trans	-66.1	-45.2	174.4	-81	173.5	0	0	0	111.7	V51 L52 V53 F57 S58 V59	V51-L55 HydrophobicContact CG1-CD1 3.84Å; V51-L55 HydrophobicContact CG1-CG 4.34Å; V51-L55 WeakPolarHBondContact O-CB 2.87Å; V51-L55 WeakPolarHBondContact O-CG 3.37Å; V51-L55 PolarHBondContact O-N 3.28Å; L52-L55 PolarHBondContact O-N 3.23Å; V53-L55 VanDerWaalsContact C-N 3.35Å; V53-L55 PolarHBondContact O-N 3.33Å; L55-F57 VanDerWaalsContact C-N 3.35Å; L55-F57 PolarHBondContact O-N 3.23Å; L55-S58 PolarHBondContact O-N 3.4Å; L55-V59 WeakPolarHBondContact O-CG2 3.42Å; L55-V59 PolarHBondContact O-N 3.03Å
56	I	52.2	Low	52	Low	102 Å²	102	100.3 Å²	100.3	52%	0.523	55%	0.554	S	S	.	*	H	α-helix	trans	-62.5	-43	179.2	-67.6	162.9	0	0	0	110.9	L52 V53 S58 V59 L60	L52-I56 HydrophobicContact CD2-CD1 3.97Å; L52-I56 HydrophobicContact CG-CD1 4.05Å; L52-I56 WeakPolarHBondContact O-CD1 3.49Å; L52-I56 WeakPolarHBondContact O-CG1 3.23Å; L52-I56 PolarHBondContact O-N 2.63Å; V53-I56 PolarHBondContact O-N 3.47Å; I56-S58 PolarHBondContact O-N 2.91Å; I56-V59 PolarHBondContact O-N 3.36Å; I56-L60 PolarHBondContact O-N 3.38Å
57	F	46.9	Very low	52.1	Low	171 Å²	171	104.3 Å²	104.3	75%	0.75	56%	0.561	S	S	*	*	H	α-helix	trans	-69.6	-20.1	179.8	-139.1	-87.6	0	0	0	113.6	V53 L55	V53-F57 PolarHBondContact O-N 2.78Å; L55-F57 VanDerWaalsContact C-N 3.35Å; L55-F57 PolarHBondContact O-N 3.23Å
58	S	44.4	Very low	51.9	Low	100 Å²	100	111.5 Å²	111.5	70%	0.699	60%	0.596	S	S	*	*	H	α-helix	trans	-88.1	-12.6	177.8	-57.6	0	0	0	0	113.3	C54 L55 I56	C54-S58 WeakPolarHBondContact O-CB 3.48Å; C54-S58 PolarHBondContact O-N 3.47Å; C54-S58 PolarHBondContact O-OG 3.41Å; L55-S58 PolarHBondContact O-N 3.4Å; I56-S58 PolarHBondContact O-N 2.91Å
59	V	46.1	Very low	51.6	Low	128 Å²	128	107.5 Å²	107.5	78%	0.776	59%	0.587	S	S	*	*	H	α-helix	trans	-100.3	-18.6	-179.8	175.8	0	0	0	0	111.9	L55 I56	L55-V59 WeakPolarHBondContact O-CG2 3.42Å; L55-V59 PolarHBondContact O-N 3.03Å; I56-V59 PolarHBondContact O-N 3.36Å
60	L	43.4	Very low	51.3	Low	210 Å²	210	106.5 Å²	106.5	100%	1.099	58%	0.584	S	S	*	*			trans	-85	0	173.2	-146.7	90.7	0	0	0	111.1	I56	I56-L60 PolarHBondContact O-N 3.38Å

Retrieved 60 of 60 residues in 175.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).