A0A087WRK9_MOUSE Loading...

Thyroid hormone receptor interactor 12

AlphaFold DB , UniProt , Accession A0A087WRK9, Species MOUSE (Mus musculus, Mouse), Gene Trip12, Length 33 aa.

						>A0A087WRK9_MOUSE|A0A087WRK9|Trip12
PAHIAKVKMKFRFLGKLMAKAIMDFRLPDQYIT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	P	60	Low	76.9	Confident	158 Å²	158	128.5 Å²	128.5	100%	1.026	67%	0.67	S	S	*	*				0	-24.2	0	16.9	3.7	0	0	0	116.6
2	A	71.3	Confident	77.5	Confident	70 Å²	70	133 Å²	133	58%	0.579	67%	0.671	S	S	*	*	H	α-helix	trans	-76.4	-27.3	-177.1	0	0	0	0	0	115.3
3	H	73.6	Confident	78.3	Confident	154 Å²	154	133 Å²	133	71%	0.713	66%	0.664	S	S	*	*	H	α-helix	trans	-70.4	-38.4	-179.8	-104.8	-98.5	0	0	0	113	A5 K6 V7	H3-A5 PolarHBondContact O-N 3.49Å; H3-K6 PolarHBondContact O-N 3.4Å; H3-V7 WeakPolarHBondContact O-CG2 3.5Å; H3-V7 PolarHBondContact O-N 3.42Å
4	I	75.5	Confident	79.1	Confident	129 Å²	129	129.4 Å²	129.4	66%	0.662	65%	0.648	S	S	*	*	H	α-helix	trans	-67.3	-37.8	-177.6	-59.7	166.3	0	0	0	110.9	K6 V7 K8	I4-K6 PolarHBondContact O-N 3.47Å; I4-V7 PolarHBondContact O-N 3.32Å; I4-K8 VanDerWaalsContact O-CB 3.29Å; I4-K8 WeakPolarHBondContact O-CB 3.29Å; I4-K8 PolarHBondContact O-N 3.24Å
5	A	78.6	Confident	79.7	Confident	56 Å²	56	123.5 Å²	123.5	46%	0.463	63%	0.632	S	S	.	*	H	α-helix	trans	-64.4	-39.6	177.7	0	0	0	0	0	112.5	H3 K8 M9	H3-A5 PolarHBondContact O-N 3.49Å; A5-K8 PolarHBondContact O-N 3.35Å; A5-M9 WeakPolarHBondContact O-CG 3.45Å; A5-M9 PolarHBondContact O-N 2.96Å
6	K	77.6	Confident	80.2	Confident	142 Å²	142	124.1 Å²	124.1	62%	0.617	63%	0.629	S	S	*	*	H	α-helix	trans	-65.4	-42.5	176.2	-73.1	-179.4	-179.4	178.4	0	112	H3 I4 M9 K10	H3-K6 PolarHBondContact O-N 3.4Å; I4-K6 PolarHBondContact O-N 3.47Å; K6-M9 PolarHBondContact O-N 3.48Å; K6-K10 PolarHBondContact O-N 3.47Å; K6-K10 VanDerWaalsContact O-N 3.13Å
7	V	81.9	Confident	80.6	Confident	89 Å²	89	121.9 Å²	121.9	54%	0.539	62%	0.619	S	S	.	*	H	α-helix	trans	-65.1	-44.1	175.5	177.4	0	0	0	0	110.4	H3 I4 M9 K10 F11	H3-V7 WeakPolarHBondContact O-CG2 3.5Å; H3-V7 PolarHBondContact O-N 3.42Å; I4-V7 PolarHBondContact O-N 3.32Å; V7-M9 VanDerWaalsContact C-N 3.35Å; V7-M9 PolarHBondContact O-N 2.91Å; V7-K10 PolarHBondContact O-N 2.87Å; V7-F11 WeakPolarHBondContact O-CB 3.36Å; V7-F11 PolarHBondContact O-N 3.15Å
8	K	81.1	Confident	80.9	Confident	161 Å²	161	120.7 Å²	120.7	70%	0.7	61%	0.612	S	S	*	*	H	α-helix	trans	-60.4	-40.1	177.4	-170.7	-179.5	-179.8	-175.3	0	112.6	I4 A5 F11 R12	I4-K8 VanDerWaalsContact O-CB 3.29Å; I4-K8 WeakPolarHBondContact O-CB 3.29Å; I4-K8 PolarHBondContact O-N 3.24Å; A5-K8 PolarHBondContact O-N 3.35Å; K8-F11 PolarHBondContact O-N 3.13Å; K8-R12 WeakPolarHBondContact O-CB 3.46Å; K8-R12 PolarHBondContact O-N 3.37Å
9	M	81.3	Confident	81.3	Confident	146 Å²	146	117 Å²	117	72%	0.719	60%	0.602	S	S	*	*	H	α-helix	trans	-67.8	-42	176	-75.2	-161.8	90.2	0	0	112.5	A5 K6 V7 F11 R12 F13	A5-M9 WeakPolarHBondContact O-CG 3.45Å; A5-M9 PolarHBondContact O-N 2.96Å; K6-M9 PolarHBondContact O-N 3.48Å; V7-M9 VanDerWaalsContact C-N 3.35Å; V7-M9 PolarHBondContact O-N 2.91Å; M9-F11 VanDerWaalsContact C-N 3.33Å; M9-F11 PolarHBondContact O-N 3.47Å; M9-R12 PolarHBondContact O-N 3.39Å; M9-F13 PolarHBondContact O-N 2.89Å; M9-F13 VanDerWaalsContact O-N 3.15Å
10	K	78.3	Confident	81.5	Confident	162 Å²	162	117 Å²	117	70%	0.704	60%	0.597	S	S	*	*	H	α-helix	trans	-61.3	-41.9	174	-75.1	176.3	178.6	-79.2	0	111.6	K6 V7 F13 L14	K6-K10 PolarHBondContact O-N 3.47Å; K6-K10 VanDerWaalsContact O-N 3.13Å; V7-K10 PolarHBondContact O-N 2.87Å; K10-F13 PolarHBondContact O-N 3.38Å; K10-L14 PolarHBondContact O-N 2.77Å
11	F	86.9	Confident	81.6	Confident	147 Å²	147	113.8 Å²	113.8	65%	0.645	59%	0.588	S	S	*	*	H	α-helix	trans	-69.2	-36.6	178.7	-142.2	-91.6	0	0	0	112.6	V7 K8 M9 F13 L14 G15	V7-F11 WeakPolarHBondContact O-CB 3.36Å; V7-F11 PolarHBondContact O-N 3.15Å; K8-F11 PolarHBondContact O-N 3.13Å; M9-F11 VanDerWaalsContact C-N 3.33Å; M9-F11 PolarHBondContact O-N 3.47Å; F11-F13 VanDerWaalsContact C-N 3.29Å; F11-F13 PolarHBondContact O-N 3.21Å; F11-L14 PolarHBondContact O-N 3.12Å; F11-G15 PolarHBondContact O-N 2.97Å
12	R	84.4	Confident	82.8	Confident	182 Å²	182	110.2 Å²	110.2	69%	0.687	56%	0.56	S	S	*	*	H	α-helix	trans	-62.1	-37.3	174	-172.9	176	-172.5	-179.1	1.9	112	K8 M9 K16	K8-R12 WeakPolarHBondContact O-CB 3.46Å; K8-R12 PolarHBondContact O-N 3.37Å; M9-R12 PolarHBondContact O-N 3.39Å; R12-K16 WeakPolarHBondContact O-CG 3.47Å; R12-K16 PolarHBondContact O-N 3.36Å
13	F	87.8	Confident	83.5	Confident	133 Å²	133	113.2 Å²	113.2	58%	0.583	56%	0.563	S	S	*	*	H	α-helix	trans	-69.7	-45.3	175.6	-177.6	-103.6	0	0	0	111.7	M9 K10 F11 G15 K16 L17	M9-F13 PolarHBondContact O-N 2.89Å; M9-F13 VanDerWaalsContact O-N 3.15Å; K10-F13 PolarHBondContact O-N 3.38Å; F11-F13 VanDerWaalsContact C-N 3.29Å; F11-F13 PolarHBondContact O-N 3.21Å; F13-G15 VanDerWaalsContact C-N 3.33Å; F13-G15 PolarHBondContact O-N 3.44Å; F13-K16 WeakPolarHBondContact O-CB 3.39Å; F13-K16 PolarHBondContact O-N 3.13Å; F13-K16 VanDerWaalsContact O-N 3.13Å; F13-L17 HydrophobicContact CD1-CD1 3.97Å; F13-L17 HydrophobicContact CD1-CG 4.5Å; F13-L17 HydrophobicContact CE1-CD1 3.44Å; F13-L17 VanDerWaalsContact CE1-CD1 3.44Å; F13-L17 HydrophobicContact CE1-CG 4.12Å; F13-L17 HydrophobicContact CZ-CD1 3.94Å; F13-L17 HydrophobicContact CZ-CD2 4.41Å; F13-L17 HydrophobicContact CZ-CG 4.26Å; F13-L17 PolarHBondContact O-N 3.4Å; F13-L17 VanDerWaalsContact O-N 3.11Å
14	L	88.8	Confident	83.7	Confident	83 Å²	83	109.7 Å²	109.7	44%	0.435	55%	0.55	S	S	.	.	H	α-helix	trans	-59.3	-43	176.3	-175.5	60.4	0	0	0	111.8	K10 F11 K16 L17 M18	K10-L14 PolarHBondContact O-N 2.77Å; F11-L14 PolarHBondContact O-N 3.12Å; L14-K16 VanDerWaalsContact C-N 3.3Å; L14-K16 PolarHBondContact O-N 2.94Å; L14-L17 PolarHBondContact O-N 2.9Å; L14-M18 HydrophobicContact CD1-CE 4.27Å; L14-M18 HydrophobicContact CD1-CG 4.44Å; L14-M18 HydrophobicContact CG-CG 4.46Å; L14-M18 VanDerWaalsContact O-CG 3.29Å; L14-M18 WeakPolarHBondContact O-CG 3.23Å; L14-M18 PolarHBondContact O-N 3.33Å
15	G	88.6	Confident	83.5	Confident	40 Å²	40	112 Å²	112	41%	0.412	56%	0.556	S	S	.	*	H	α-helix	trans	-61.5	-34.6	176	0	0	0	0	0	113.6	F11 F13 A19	F11-G15 PolarHBondContact O-N 2.97Å; F13-G15 VanDerWaalsContact C-N 3.33Å; F13-G15 PolarHBondContact O-N 3.44Å; G15-A19 WeakPolarHBondContact O-CB 3.27Å; G15-A19 PolarHBondContact O-N 3.3Å
16	K	87.8	Confident	82.6	Confident	133 Å²	133	118.7 Å²	118.7	58%	0.578	57%	0.569	S	S	*	*	H	α-helix	trans	-68.4	-42.4	174.2	-74.3	-178.8	175.3	-168.8	0	112.2	R12 F13 L14 A19 K20	R12-K16 WeakPolarHBondContact O-CG 3.47Å; R12-K16 PolarHBondContact O-N 3.36Å; F13-K16 WeakPolarHBondContact O-CB 3.39Å; F13-K16 PolarHBondContact O-N 3.13Å; F13-K16 VanDerWaalsContact O-N 3.13Å; L14-K16 VanDerWaalsContact C-N 3.3Å; L14-K16 PolarHBondContact O-N 2.94Å; K16-A19 PolarHBondContact O-N 3.21Å; K16-K20 WeakPolarHBondContact O-CB 3.46Å; K16-K20 PolarHBondContact O-N 3.11Å
17	L	86.8	Confident	81.7	Confident	88 Å²	88	116.4 Å²	116.4	46%	0.461	56%	0.563	S	S	.	*	H	α-helix	trans	-64.6	-42	176.4	-69.7	178.3	0	0	0	111.5	F13 L14 K20 A21	F13-L17 HydrophobicContact CD1-CD1 3.97Å; F13-L17 HydrophobicContact CD1-CG 4.5Å; F13-L17 HydrophobicContact CE1-CD1 3.44Å; F13-L17 VanDerWaalsContact CE1-CD1 3.44Å; F13-L17 HydrophobicContact CE1-CG 4.12Å; F13-L17 HydrophobicContact CZ-CD1 3.94Å; F13-L17 HydrophobicContact CZ-CD2 4.41Å; F13-L17 HydrophobicContact CZ-CG 4.26Å; F13-L17 PolarHBondContact O-N 3.4Å; F13-L17 VanDerWaalsContact O-N 3.11Å; L14-L17 PolarHBondContact O-N 2.9Å; L17-K20 PolarHBondContact O-N 3.19Å; L17-A21 VanDerWaalsContact O-CB 3.29Å; L17-A21 WeakPolarHBondContact O-CB 3.38Å; L17-A21 PolarHBondContact O-N 3.45Å
18	M	86.3	Confident	80.6	Confident	99 Å²	99	117.1 Å²	117.1	49%	0.488	57%	0.569	S	S	.	*	H	α-helix	trans	-64.6	-43.6	175.7	-66.5	-66.1	105.1	0	0	111.7	L14 K20 A21 I22	L14-M18 HydrophobicContact CD1-CE 4.27Å; L14-M18 HydrophobicContact CD1-CG 4.44Å; L14-M18 HydrophobicContact CG-CG 4.46Å; L14-M18 VanDerWaalsContact O-CG 3.29Å; L14-M18 WeakPolarHBondContact O-CG 3.23Å; L14-M18 PolarHBondContact O-N 3.33Å; M18-K20 PolarHBondContact O-N 2.91Å; M18-A21 PolarHBondContact O-N 3.05Å; M18-I22 VanDerWaalsContact O-CB 3.31Å; M18-I22 WeakPolarHBondContact O-CB 3.34Å; M18-I22 WeakPolarHBondContact O-CD1 3.42Å; M18-I22 WeakPolarHBondContact O-CG1 3.04Å; M18-I22 PolarHBondContact O-N 2.85Å
19	A	88.2	Confident	79.5	Confident	51 Å²	51	115.8 Å²	115.8	42%	0.421	57%	0.57	S	S	.	*	H	α-helix	trans	-61.6	-43.1	176	0	0	0	0	0	112	G15 K16 I22 M23	G15-A19 WeakPolarHBondContact O-CB 3.27Å; G15-A19 PolarHBondContact O-N 3.3Å; K16-A19 PolarHBondContact O-N 3.21Å; A19-I22 PolarHBondContact O-N 3.46Å; A19-M23 WeakPolarHBondContact O-CB 3.29Å; A19-M23 VanDerWaalsContact O-CG 3.23Å; A19-M23 WeakPolarHBondContact O-CG 3.29Å; A19-M23 PolarHBondContact O-N 2.83Å
20	K	85.6	Confident	78.3	Confident	116 Å²	116	116.1 Å²	116.1	50%	0.504	57%	0.569	S	S	.	*	H	α-helix	trans	-63.9	-48.4	176.2	-179.2	57.1	176.2	148.7	0	111.5	K16 L17 M18 I22 M23 D24	K16-K20 WeakPolarHBondContact O-CB 3.46Å; K16-K20 PolarHBondContact O-N 3.11Å; L17-K20 PolarHBondContact O-N 3.19Å; M18-K20 PolarHBondContact O-N 2.91Å; K20-I22 VanDerWaalsContact C-N 3.34Å; K20-I22 PolarHBondContact O-N 3.42Å; K20-M23 PolarHBondContact O-N 3.41Å; K20-D24 VanDerWaalsContact CD-OD2 3.27Å; K20-D24 WeakPolarHBondContact CD-OD2 3.14Å; K20-D24 WeakPolarHBondContact CE-OD2 3.31Å; K20-D24 WeakPolarHBondContact CG-OD2 3.44Å; K20-D24 IonicContact NZ-OD1 2.77Å; K20-D24 PolarHBondContact NZ-OD1 3.47Å; K20-D24 IonicContact NZ-OD2 3.12Å; K20-D24 PolarHBondContact NZ-OD2 3.41Å; K20-D24 VanDerWaalsContact NZ-OD2 3.12Å; K20-D24 WeakPolarHBondContact O-CB 3.45Å; K20-D24 VanDerWaalsContact O-CG 3.27Å; K20-D24 PolarHBondContact O-N 2.86Å; K20-D24 VanDerWaalsContact O-OD2 3.12Å
21	A	83.2	Confident	77.4	Confident	50 Å²	50	119 Å²	119	41%	0.413	58%	0.577	S	S	.	*	H	α-helix	trans	-61.6	-40.1	176.9	0	0	0	0	0	112.2	L17 M18 D24 F25	L17-A21 VanDerWaalsContact O-CB 3.29Å; L17-A21 WeakPolarHBondContact O-CB 3.38Å; L17-A21 PolarHBondContact O-N 3.45Å; M18-A21 PolarHBondContact O-N 3.05Å; A21-D24 PolarHBondContact O-N 2.92Å; A21-F25 WeakPolarHBondContact O-CB 3.49Å; A21-F25 PolarHBondContact O-N 3.35Å
22	I	85.8	Confident	76	Confident	84 Å²	84	119 Å²	119	43%	0.431	58%	0.583	S	S	.	*	H	α-helix	trans	-66.9	-41.2	175.5	-69.4	163.6	0	0	0	110.7	M18 A19 K20 F25 R26	M18-I22 VanDerWaalsContact O-CB 3.31Å; M18-I22 WeakPolarHBondContact O-CB 3.34Å; M18-I22 WeakPolarHBondContact O-CD1 3.42Å; M18-I22 WeakPolarHBondContact O-CG1 3.04Å; M18-I22 PolarHBondContact O-N 2.85Å; A19-I22 PolarHBondContact O-N 3.46Å; K20-I22 VanDerWaalsContact C-N 3.34Å; K20-I22 PolarHBondContact O-N 3.42Å; I22-F25 PolarHBondContact O-N 3.46Å; I22-R26 HydrophobicContact CG2-CG 4.17Å; I22-R26 WeakPolarHBondContact O-CB 3.06Å; I22-R26 WeakPolarHBondContact O-CD 3.1Å; I22-R26 WeakPolarHBondContact O-CG 3.14Å; I22-R26 PolarHBondContact O-N 2.86Å
23	M	85.1	Confident	74.1	Confident	132 Å²	132	120.1 Å²	120.1	65%	0.65	61%	0.61	S	S	*	*	H	α-helix	trans	-64.3	-42.5	175.3	-72.5	178	75.3	0	0	112.2	A19 K20 R26	A19-M23 WeakPolarHBondContact O-CB 3.29Å; A19-M23 VanDerWaalsContact O-CG 3.23Å; A19-M23 WeakPolarHBondContact O-CG 3.29Å; A19-M23 PolarHBondContact O-N 2.83Å; K20-M23 PolarHBondContact O-N 3.41Å; M23-R26 PolarHBondContact O-N 3.45Å
24	D	79.1	Confident	73.4	Confident	81 Å²	81	119.5 Å²	119.5	43%	0.433	61%	0.611	S	S	.	*	H	α-helix	trans	-70.7	-32.9	177.9	-65.9	-36.3	0	0	0	111.6	K20 A21	K20-D24 VanDerWaalsContact CD-OD2 3.27Å; K20-D24 WeakPolarHBondContact CD-OD2 3.14Å; K20-D24 WeakPolarHBondContact CE-OD2 3.31Å; K20-D24 WeakPolarHBondContact CG-OD2 3.44Å; K20-D24 IonicContact NZ-OD1 2.77Å; K20-D24 PolarHBondContact NZ-OD1 3.47Å; K20-D24 IonicContact NZ-OD2 3.12Å; K20-D24 PolarHBondContact NZ-OD2 3.41Å; K20-D24 VanDerWaalsContact NZ-OD2 3.12Å; K20-D24 WeakPolarHBondContact O-CB 3.45Å; K20-D24 VanDerWaalsContact O-CG 3.27Å; K20-D24 PolarHBondContact O-N 2.86Å; K20-D24 VanDerWaalsContact O-OD2 3.12Å; A21-D24 PolarHBondContact O-N 2.92Å
25	F	69.6	Low	72.6	Confident	178 Å²	178	121.4 Å²	121.4	78%	0.781	62%	0.62	S	S	*	*	H	α-helix	trans	-80.4	-23.4	176.3	-158.1	-93.5	0	0	0	113	A21 I22 L27 P28	A21-F25 WeakPolarHBondContact O-CB 3.49Å; A21-F25 PolarHBondContact O-N 3.35Å; I22-F25 PolarHBondContact O-N 3.46Å; F25-L27 PolarHBondContact O-N 2.8Å; F25-P28 WeakPolarHBondContact O-CD 3.47Å
26	R	60.1	Low	71.7	Confident	196 Å²	196	125.9 Å²	125.9	74%	0.74	63%	0.632	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.8	7.6	171.2	-77.5	176.6	170.9	-171.8	-5.5	113.6	I22 M23 P28	I22-R26 HydrophobicContact CG2-CG 4.17Å; I22-R26 WeakPolarHBondContact O-CB 3.06Å; I22-R26 WeakPolarHBondContact O-CD 3.1Å; I22-R26 WeakPolarHBondContact O-CG 3.14Å; I22-R26 PolarHBondContact O-N 2.86Å; M23-R26 PolarHBondContact O-N 3.45Å; R26-P28 WeakPolarHBondContact O-CD 3.1Å
27	L	59.5	Low	70.8	Confident	94 Å²	94	125.5 Å²	125.5	49%	0.492	64%	0.635	S	S	.	*			trans	-94.5	40	171.2	-87.7	156.7	0	0	0	115	F25 D29	F25-L27 PolarHBondContact O-N 2.8Å; L27-D29 PolarHBondContact O-N 3.28Å
28	P	58.3	Low	69.8	Low	103 Å²	103	127.8 Å²	127.8	67%	0.669	65%	0.646	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.3	31.1	168.9	39.8	-32.6	0	0	0	112.1	F25 R26	F25-P28 WeakPolarHBondContact O-CD 3.47Å; R26-P28 WeakPolarHBondContact O-CD 3.1Å
29	D	57.9	Low	68.7	Low	134 Å²	134	129.7 Å²	129.7	72%	0.717	66%	0.657	S	S	*	*	T	Hydrogen-bonded Turn	trans	-121.6	-11.4	-174.5	-150.2	-109.6	0	0	0	114.4	L27	L27-D29 PolarHBondContact O-N 3.28Å
30	Q	57.1	Low	67.3	Low	152 Å²	152	135.4 Å²	135.4	71%	0.71	67%	0.673	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.1	7.4	-174.9	-100.7	-168.1	-24.6	0	0	116.3
31	Y	58.3	Low	65.9	Low	222 Å²	222	136.8 Å²	136.8	87%	0.871	69%	0.686	S	S	*	*	T	Hydrogen-bonded Turn	trans	-118.4	16.5	174.6	-66.7	-77.8	0	0	0	113.6
32	I	57.9	Low	64.4	Low	148 Å²	148	144.1 Å²	144.1	76%	0.759	71%	0.709	S	S	*	*			trans	-130.2	71.1	175.4	-47.7	174.9	0	0	0	108.2
33	T	44.7	Very low	62.5	Low	205 Å²	205	149.5 Å²	149.5	100%	1.258	73%	0.734	S	S	*	*			trans	-141.9	0	157.2	-8.8	0	0	0	0	108.4

Retrieved 33 of 33 residues in 59.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).