A0A087WRR4_MOUSE Loading...

Inhibitor of growth family, member 5

AlphaFold DB , UniProt , Accession A0A087WRR4, Species MOUSE (Mus musculus, Mouse), Gene Ing5, Length 41 aa.

						>A0A087WRR4_MOUSE|A0A087WRR4|Ing5
MATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEVTCPH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.4	Low	77.4	Confident	208 Å²	208	122.6 Å²	122.6	100%	1.025	63%	0.626	S	S	*	*				0	-51.5	0	-70.9	178.4	163.7	0	0	111.8	T3 A4	M1-T3 PolarHBondContact O-N 2.62Å; M1-A4 PolarHBondContact O-N 3.39Å
2	A	64.4	Low	77.9	Confident	74 Å²	74	120.7 Å²	120.7	61%	0.612	62%	0.618	S	S	*	*	H	α-helix	trans	-60.6	-36.1	178.8	0	0	0	0	0	115.3	A4 M5 Y6	A2-A4 VanDerWaalsContact C-N 3.34Å; A2-A4 PolarHBondContact O-N 2.92Å; A2-M5 PolarHBondContact O-N 2.92Å; A2-Y6 PolarHBondContact O-N 3.33Å; A2-Y6 VanDerWaalsContact O-N 3.13Å
3	T	69.6	Low	78.3	Confident	119 Å²	119	117.4 Å²	117.4	73%	0.73	61%	0.613	S	S	*	*	H	α-helix	trans	-68.5	-31	-179.7	-14.1	0	0	0	0	113.3	M1 L7	M1-T3 PolarHBondContact O-N 2.62Å; T3-L7 WeakPolarHBondContact O-CB 3.34Å; T3-L7 PolarHBondContact O-N 3.42Å; T3-L7 VanDerWaalsContact O-N 3.16Å
4	A	72.4	Confident	79.1	Confident	55 Å²	55	114.4 Å²	114.4	46%	0.455	60%	0.596	S	S	.	*	H	α-helix	trans	-70.5	-43	177.3	0	0	0	0	0	110.8	M1 A2 Y6 L7 E8	M1-A4 PolarHBondContact O-N 3.39Å; A2-A4 VanDerWaalsContact C-N 3.34Å; A2-A4 PolarHBondContact O-N 2.92Å; A4-Y6 PolarHBondContact O-N 3.39Å; A4-L7 WeakPolarHBondContact O-CB 3.22Å; A4-L7 PolarHBondContact O-N 3.29Å; A4-E8 WeakPolarHBondContact O-CG 3.22Å; A4-E8 PolarHBondContact O-N 2.72Å
5	M	75.4	Confident	79.8	Confident	110 Å²	110	116.7 Å²	116.7	54%	0.542	60%	0.603	S	S	.	*	H	α-helix	trans	-64.1	-40.6	175.8	-64.4	-165.9	-66	0	0	112.3	A2 L7 E8 H9	A2-M5 PolarHBondContact O-N 2.92Å; M5-L7 VanDerWaalsContact C-N 3.28Å; M5-L7 PolarHBondContact O-N 3.09Å; M5-E8 PolarHBondContact O-N 3.5Å; M5-H9 PolarHBondContact O-CD2 3.25Å; M5-H9 PolarHBondContact O-N 3.35Å
6	Y	81.9	Confident	80.1	Confident	181 Å²	181	114.6 Å²	114.6	71%	0.71	59%	0.593	S	S	*	*	H	α-helix	trans	-63.8	-36.6	176.4	-160.2	-87.8	0	0	0	111.9	A2 A4 Y10	A2-Y6 PolarHBondContact O-N 3.33Å; A2-Y6 VanDerWaalsContact O-N 3.13Å; A4-Y6 PolarHBondContact O-N 3.39Å; Y6-Y10 VanDerWaalsContact O-CB 3.25Å; Y6-Y10 WeakPolarHBondContact O-CB 3.14Å; Y6-Y10 PolarHBondContact O-N 2.9Å
7	L	85.1	Confident	80.7	Confident	107 Å²	107	112.8 Å²	112.8	56%	0.56	58%	0.584	S	S	*	*	H	α-helix	trans	-68.6	-43.5	177.1	-156.5	88.5	0	0	0	111.5	T3 A4 M5 Y10 L11	T3-L7 WeakPolarHBondContact O-CB 3.34Å; T3-L7 PolarHBondContact O-N 3.42Å; T3-L7 VanDerWaalsContact O-N 3.16Å; A4-L7 WeakPolarHBondContact O-CB 3.22Å; A4-L7 PolarHBondContact O-N 3.29Å; M5-L7 VanDerWaalsContact C-N 3.28Å; M5-L7 PolarHBondContact O-N 3.09Å; L7-Y10 PolarHBondContact O-N 3.33Å; L7-L11 HydrophobicContact CD2-CD1 4.32Å; L7-L11 HydrophobicContact CG-CD1 4.34Å; L7-L11 WeakPolarHBondContact O-CB 3.44Å; L7-L11 VanDerWaalsContact O-CG 3.25Å; L7-L11 WeakPolarHBondContact O-CG 3.42Å; L7-L11 PolarHBondContact O-N 2.89Å
8	E	84.9	Confident	81.1	Confident	129 Å²	129	110.9 Å²	110.9	60%	0.603	58%	0.58	S	S	*	*	H	α-helix	trans	-60.9	-48.2	175.9	-75.3	172	-177	0	0	111.3	A4 M5 Y10 L11 D12	A4-E8 WeakPolarHBondContact O-CG 3.22Å; A4-E8 PolarHBondContact O-N 2.72Å; M5-E8 PolarHBondContact O-N 3.5Å; E8-Y10 VanDerWaalsContact C-N 3.29Å; E8-Y10 PolarHBondContact O-N 3.04Å; E8-L11 PolarHBondContact O-N 3.4Å; E8-D12 WeakPolarHBondContact O-CB 3.34Å; E8-D12 PolarHBondContact O-N 3.46Å
9	H	84.2	Confident	81.6	Confident	129 Å²	129	109.3 Å²	109.3	60%	0.597	58%	0.578	S	S	*	*	H	α-helix	trans	-62.1	-36.1	175.7	-78.1	-62.7	0	0	0	113.1	M5 S13	M5-H9 PolarHBondContact O-CD2 3.25Å; M5-H9 PolarHBondContact O-N 3.35Å; H9-S13 VanDerWaalsContact O-CB 3.32Å; H9-S13 WeakPolarHBondContact O-CB 3.35Å; H9-S13 PolarHBondContact O-N 3.14Å; H9-S13 PolarHBondContact O-OG 2.86Å
10	Y	86.8	Confident	82.1	Confident	139 Å²	139	109 Å²	109	55%	0.545	57%	0.573	S	S	.	*	H	α-helix	trans	-68.8	-40.7	176.8	-174.6	-107.5	0	0	0	111.8	Y6 L7 E8 S13 I14	Y6-Y10 VanDerWaalsContact O-CB 3.25Å; Y6-Y10 WeakPolarHBondContact O-CB 3.14Å; Y6-Y10 PolarHBondContact O-N 2.9Å; L7-Y10 PolarHBondContact O-N 3.33Å; E8-Y10 VanDerWaalsContact C-N 3.29Å; E8-Y10 PolarHBondContact O-N 3.04Å; Y10-S13 PolarHBondContact O-N 3.02Å; Y10-I14 HydrophobicContact CD1-CD1 3.64Å; Y10-I14 HydrophobicContact CE1-CD1 3.19Å; Y10-I14 HydrophobicContact CE1-CG1 4.32Å; Y10-I14 HydrophobicContact CE2-CD1 4.25Å; Y10-I14 HydrophobicContact CG-CD1 4.34Å; Y10-I14 WeakPolarHBondContact O-CG1 3.38Å; Y10-I14 PolarHBondContact O-N 3.48Å
11	L	87.5	Confident	82.6	Confident	98 Å²	98	107.4 Å²	107.4	51%	0.513	57%	0.565	S	S	.	*	H	α-helix	trans	-64.7	-45.3	175.9	-72.7	166.4	0	0	0	111.5	L7 E8 S13 I14 E15	L7-L11 HydrophobicContact CD2-CD1 4.32Å; L7-L11 HydrophobicContact CG-CD1 4.34Å; L7-L11 WeakPolarHBondContact O-CB 3.44Å; L7-L11 VanDerWaalsContact O-CG 3.25Å; L7-L11 WeakPolarHBondContact O-CG 3.42Å; L7-L11 PolarHBondContact O-N 2.89Å; E8-L11 PolarHBondContact O-N 3.4Å; L11-S13 VanDerWaalsContact C-N 3.33Å; L11-S13 PolarHBondContact O-N 3.41Å; L11-I14 PolarHBondContact O-N 2.88Å; L11-I14 VanDerWaalsContact O-N 3.16Å; L11-E15 PolarHBondContact O-N 2.94Å
12	D	83.2	Confident	84.2	Confident	99 Å²	99	103.5 Å²	103.5	53%	0.529	54%	0.544	S	S	.	.	H	α-helix	trans	-62	-41.5	176.7	-159.3	-5.6	0	0	0	110.9	E8 I14 E15 N16	E8-D12 WeakPolarHBondContact O-CB 3.34Å; E8-D12 PolarHBondContact O-N 3.46Å; D12-I14 VanDerWaalsContact C-N 3.35Å; D12-I14 PolarHBondContact O-N 2.92Å; D12-E15 PolarHBondContact O-N 3.37Å; D12-N16 PolarHBondContact O-N 2.9Å
13	S	83.3	Confident	85.6	Confident	78 Å²	78	108.4 Å²	108.4	55%	0.545	55%	0.547	S	S	.	.	H	α-helix	trans	-62.6	-38.7	174.1	-58.9	0	0	0	0	112.7	H9 Y10 L11 L17	H9-S13 VanDerWaalsContact O-CB 3.32Å; H9-S13 WeakPolarHBondContact O-CB 3.35Å; H9-S13 PolarHBondContact O-N 3.14Å; H9-S13 PolarHBondContact O-OG 2.86Å; Y10-S13 PolarHBondContact O-N 3.02Å; L11-S13 VanDerWaalsContact C-N 3.33Å; L11-S13 PolarHBondContact O-N 3.41Å; S13-L17 WeakPolarHBondContact O-CB 3.37Å; S13-L17 PolarHBondContact O-N 3.4Å; S13-L17 VanDerWaalsContact O-N 3.16Å
14	I	89.3	Confident	86.8	Confident	75 Å²	75	106.5 Å²	106.5	39%	0.385	53%	0.532	S	S	.	.	H	α-helix	trans	-71.5	-36.6	177.8	-73	170.6	0	0	0	111.5	Y10 L11 D12 N16 L17 P18	Y10-I14 HydrophobicContact CD1-CD1 3.64Å; Y10-I14 HydrophobicContact CE1-CD1 3.19Å; Y10-I14 HydrophobicContact CE1-CG1 4.32Å; Y10-I14 HydrophobicContact CE2-CD1 4.25Å; Y10-I14 HydrophobicContact CG-CD1 4.34Å; Y10-I14 WeakPolarHBondContact O-CG1 3.38Å; Y10-I14 PolarHBondContact O-N 3.48Å; L11-I14 PolarHBondContact O-N 2.88Å; L11-I14 VanDerWaalsContact O-N 3.16Å; D12-I14 VanDerWaalsContact C-N 3.35Å; D12-I14 PolarHBondContact O-N 2.92Å; I14-N16 VanDerWaalsContact C-N 3.28Å; I14-N16 PolarHBondContact O-N 3.36Å; I14-L17 WeakPolarHBondContact O-CB 3.28Å; I14-L17 PolarHBondContact O-N 3.25Å; I14-P18 WeakPolarHBondContact O-CD 3.41Å
15	E	89.5	Confident	87.9	Confident	149 Å²	149	109.6 Å²	109.6	70%	0.696	54%	0.536	S	S	*	.	H	α-helix	trans	-62.2	-39.3	179.2	-174	172.8	175.9	0	0	111.4	L11 D12 P18	L11-E15 PolarHBondContact O-N 2.94Å; D12-E15 PolarHBondContact O-N 3.37Å; E15-P18 WeakPolarHBondContact O-CD 3.25Å
16	N	85.4	Confident	88.8	Confident	84 Å²	84	108.9 Å²	108.9	45%	0.449	53%	0.531	S	S	.	.	H	α-helix	trans	-83.9	-23.3	-178.6	-134.1	75.7	0	0	0	113.6	D12 I14 C19 E20	D12-N16 PolarHBondContact O-N 2.9Å; I14-N16 VanDerWaalsContact C-N 3.28Å; I14-N16 PolarHBondContact O-N 3.36Å; N16-C19 WeakPolarHBondContact O-CB 3.49Å; N16-C19 PolarHBondContact O-N 2.85Å; N16-E20 PolarHBondContact ND2-OE1 3.26Å; N16-E20 VanDerWaalsContact ND2-OE1 3.08Å; N16-E20 PolarHBondContact O-N 3Å; N16-E20 VanDerWaalsContact O-N 3.16Å
17	L	89.7	Confident	89.3	Confident	84 Å²	84	104.2 Å²	104.2	44%	0.44	52%	0.518	S	S	.	.	H	α-helix	trans	-52.6	-48.5	-179.1	-168.3	68.3	0	0	0	115.4	S13 I14 C19 E20 L21	S13-L17 WeakPolarHBondContact O-CB 3.37Å; S13-L17 PolarHBondContact O-N 3.4Å; S13-L17 VanDerWaalsContact O-N 3.16Å; I14-L17 WeakPolarHBondContact O-CB 3.28Å; I14-L17 PolarHBondContact O-N 3.25Å; L17-C19 VanDerWaalsContact C-N 3.29Å; L17-C19 PolarHBondContact O-N 3.08Å; L17-E20 PolarHBondContact O-N 3.2Å; L17-L21 HydrophobicContact CG-CD1 4.08Å; L17-L21 HydrophobicContact CG-CG 4.41Å; L17-L21 WeakPolarHBondContact O-CB 3.48Å; L17-L21 WeakPolarHBondContact O-CG 3.44Å; L17-L21 PolarHBondContact O-N 3.37Å
18	P	88.4	Confident	89.7	Confident	79 Å²	79	104.8 Å²	104.8	51%	0.513	52%	0.519	S	S	.	.	H	α-helix	trans	-63.7	-33.8	-179.7	22.5	-32.5	0	0	0	112.7	I14 E15 Q22	I14-P18 WeakPolarHBondContact O-CD 3.41Å; E15-P18 WeakPolarHBondContact O-CD 3.25Å; P18-Q22 VanDerWaalsContact O-CB 3.25Å; P18-Q22 WeakPolarHBondContact O-CB 3.49Å; P18-Q22 PolarHBondContact O-N 3.37Å
19	C	90.1	Very high	90	Very high	80 Å²	80	107.1 Å²	107.1	54%	0.541	52%	0.523	S	S	.	.	H	α-helix	trans	-67.1	-44.3	176	-172.3	0	0	0	0	111.1	N16 L17 Q22 R23	N16-C19 WeakPolarHBondContact O-CB 3.49Å; N16-C19 PolarHBondContact O-N 2.85Å; L17-C19 VanDerWaalsContact C-N 3.29Å; L17-C19 PolarHBondContact O-N 3.08Å; C19-Q22 PolarHBondContact O-N 2.89Å; C19-R23 PolarHBondContact O-N 3.29Å
20	E	91.3	Very high	90.4	Very high	102 Å²	102	105.8 Å²	105.8	48%	0.477	52%	0.517	S	S	.	.	H	α-helix	trans	-64.7	-43.8	176.5	-71	176.4	-146.9	0	0	112.2	N16 L17 R23 N24	N16-E20 PolarHBondContact ND2-OE1 3.26Å; N16-E20 VanDerWaalsContact ND2-OE1 3.08Å; N16-E20 PolarHBondContact O-N 3Å; N16-E20 VanDerWaalsContact O-N 3.16Å; L17-E20 PolarHBondContact O-N 3.2Å; E20-R23 PolarHBondContact O-N 3.16Å; E20-N24 WeakPolarHBondContact O-CB 3.46Å; E20-N24 VanDerWaalsContact O-CG 3.25Å; E20-N24 PolarHBondContact O-N 3.36Å; E20-N24 PolarHBondContact O-ND2 2.96Å
21	L	93.4	Very high	90.7	Very high	77 Å²	77	104.1 Å²	104.1	40%	0.403	52%	0.517	S	S	.	.	H	α-helix	trans	-62.6	-43.8	174.8	-73.6	176.5	0	0	0	111.4	L17 R23 N24 F25	L17-L21 HydrophobicContact CG-CD1 4.08Å; L17-L21 HydrophobicContact CG-CG 4.41Å; L17-L21 WeakPolarHBondContact O-CB 3.48Å; L17-L21 WeakPolarHBondContact O-CG 3.44Å; L17-L21 PolarHBondContact O-N 3.37Å; L21-R23 VanDerWaalsContact C-N 3.31Å; L21-R23 PolarHBondContact O-N 2.84Å; L21-N24 PolarHBondContact O-N 2.95Å; L21-F25 HydrophobicContact CB-CD2 4.33Å; L21-F25 HydrophobicContact CB-CE2 4.26Å; L21-F25 WeakPolarHBondContact O-CD2 3.46Å; L21-F25 PolarHBondContact O-N 3.43Å
22	Q	93.4	Very high	90.8	Very high	125 Å²	125	103.9 Å²	103.9	58%	0.584	52%	0.516	S	S	*	.	H	α-helix	trans	-57.3	-46.2	177.1	-178.5	175.3	18.7	0	0	111.3	P18 C19 F25 Q26	P18-Q22 VanDerWaalsContact O-CB 3.25Å; P18-Q22 WeakPolarHBondContact O-CB 3.49Å; P18-Q22 PolarHBondContact O-N 3.37Å; C19-Q22 PolarHBondContact O-N 2.89Å; Q22-F25 PolarHBondContact O-N 2.89Å; Q22-Q26 WeakPolarHBondContact O-CG 3.4Å; Q22-Q26 PolarHBondContact O-N 3.46Å
23	R	94	Very high	90.9	Very high	178 Å²	178	105.1 Å²	105.1	67%	0.672	52%	0.518	S	S	*	.	H	α-helix	trans	-60.2	-46.7	175.4	-172.5	-173.7	-129.6	-162.9	3.4	111.6	C19 E20 L21 F25 Q26 L27	C19-R23 PolarHBondContact O-N 3.29Å; E20-R23 PolarHBondContact O-N 3.16Å; L21-R23 VanDerWaalsContact C-N 3.31Å; L21-R23 PolarHBondContact O-N 2.84Å; R23-F25 PolarHBondContact O-N 3.17Å; R23-Q26 PolarHBondContact O-N 3.23Å; R23-L27 HydrophobicContact CG-CD1 4.25Å; R23-L27 WeakPolarHBondContact O-CG 3.4Å; R23-L27 PolarHBondContact O-N 2.9Å
24	N	93.2	Very high	91	Very high	78 Å²	78	109.8 Å²	109.8	42%	0.417	52%	0.524	S	S	.	.	H	α-helix	trans	-61.7	-42	179	-71.6	-25.4	0	0	0	111.9	E20 L21 L27 M28	E20-N24 WeakPolarHBondContact O-CB 3.46Å; E20-N24 VanDerWaalsContact O-CG 3.25Å; E20-N24 PolarHBondContact O-N 3.36Å; E20-N24 PolarHBondContact O-ND2 2.96Å; L21-N24 PolarHBondContact O-N 2.95Å; N24-L27 PolarHBondContact O-N 3.4Å; N24-M28 WeakPolarHBondContact O-CG 3.38Å; N24-M28 PolarHBondContact O-N 3.44Å
25	F	95.4	Very high	90.6	Very high	121 Å²	121	110.6 Å²	110.6	53%	0.531	53%	0.532	S	S	.	.	H	α-helix	trans	-68.5	-35	175.5	-77.3	-62.8	0	0	0	113	L21 Q22 R23 R29	L21-F25 HydrophobicContact CB-CD2 4.33Å; L21-F25 HydrophobicContact CB-CE2 4.26Å; L21-F25 WeakPolarHBondContact O-CD2 3.46Å; L21-F25 PolarHBondContact O-N 3.43Å; Q22-F25 PolarHBondContact O-N 2.89Å; R23-F25 PolarHBondContact O-N 3.17Å; F25-R29 PolarHBondContact O-N 2.92Å
26	Q	94	Very high	89.9	Confident	94 Å²	94	109.8 Å²	109.8	44%	0.439	53%	0.529	S	S	.	.	H	α-helix	trans	-63.3	-48.4	171.8	-79.9	-178.1	-75	0	0	111	Q22 R23 M28 R29 E30	Q22-Q26 WeakPolarHBondContact O-CG 3.4Å; Q22-Q26 PolarHBondContact O-N 3.46Å; R23-Q26 PolarHBondContact O-N 3.23Å; Q26-M28 VanDerWaalsContact C-N 3.32Å; Q26-M28 PolarHBondContact O-N 3.3Å; Q26-R29 PolarHBondContact O-N 3.16Å; Q26-R29 VanDerWaalsContact O-N 3.14Å; Q26-E30 WeakPolarHBondContact O-CG 3.4Å; Q26-E30 PolarHBondContact O-N 2.99Å
27	L	94.5	Very high	89.1	Confident	84 Å²	84	111.1 Å²	111.1	44%	0.44	54%	0.54	S	S	.	.	H	α-helix	trans	-60	-41.9	176.9	-71.6	170.7	0	0	0	112	R23 N24 E30 L31	R23-L27 HydrophobicContact CG-CD1 4.25Å; R23-L27 WeakPolarHBondContact O-CG 3.4Å; R23-L27 PolarHBondContact O-N 2.9Å; N24-L27 PolarHBondContact O-N 3.4Å; L27-E30 PolarHBondContact O-N 2.92Å; L27-L31 WeakPolarHBondContact O-CB 3.08Å; L27-L31 PolarHBondContact O-N 3.16Å
28	M	92.4	Very high	87.7	Confident	119 Å²	119	112.4 Å²	112.4	59%	0.586	55%	0.551	S	S	*	*	H	α-helix	trans	-60.6	-44.2	174.4	-77.6	-174.5	-161	0	0	111.8	N24 Q26 L31 D32	N24-M28 WeakPolarHBondContact O-CG 3.38Å; N24-M28 PolarHBondContact O-N 3.44Å; Q26-M28 VanDerWaalsContact C-N 3.32Å; Q26-M28 PolarHBondContact O-N 3.3Å; M28-L31 PolarHBondContact O-N 3.41Å; M28-D32 VanDerWaalsContact O-CB 3.28Å; M28-D32 WeakPolarHBondContact O-CB 3.44Å; M28-D32 PolarHBondContact O-N 3.41Å
29	R	91.8	Very high	86.2	Confident	178 Å²	178	113 Å²	113	67%	0.672	56%	0.556	S	S	*	*	H	α-helix	trans	-64.6	-38.4	176.1	-92.9	-165.9	-71.8	-176.9	-4.6	113	F25 Q26 D32 Q33	F25-R29 PolarHBondContact O-N 2.92Å; Q26-R29 PolarHBondContact O-N 3.16Å; Q26-R29 VanDerWaalsContact O-N 3.14Å; R29-D32 PolarHBondContact O-N 2.97Å; R29-Q33 WeakPolarHBondContact O-CB 3.45Å; R29-Q33 PolarHBondContact O-N 3.36Å
30	E	92.8	Very high	84.5	Confident	101 Å²	101	114.4 Å²	114.4	47%	0.472	56%	0.564	S	S	.	*	H	α-helix	trans	-67	-40.4	176.3	-72.8	173	-171.2	0	0	111.7	Q26 L27 R34	Q26-E30 WeakPolarHBondContact O-CG 3.4Å; Q26-E30 PolarHBondContact O-N 2.99Å; L27-E30 PolarHBondContact O-N 2.92Å; E30-R34 WeakPolarHBondContact O-CB 3.46Å; E30-R34 WeakPolarHBondContact O-CG 3.25Å; E30-R34 PolarHBondContact O-N 3.36Å
31	L	92.2	Very high	82.9	Confident	104 Å²	104	122 Å²	122	55%	0.545	60%	0.599	S	S	.	*	H	α-helix	trans	-62	-47.5	173.4	-88.5	156.6	0	0	0	111.5	L27 M28 R34 T35	L27-L31 WeakPolarHBondContact O-CB 3.08Å; L27-L31 PolarHBondContact O-N 3.16Å; M28-L31 PolarHBondContact O-N 3.41Å; L31-R34 PolarHBondContact O-N 2.96Å; L31-T35 WeakPolarHBondContact O-CB 3.06Å; L31-T35 PolarHBondContact O-N 3.09Å; L31-T35 PolarHBondContact O-OG1 2.99Å
32	D	90.1	Very high	82.4	Confident	93 Å²	93	124.3 Å²	124.3	50%	0.497	61%	0.609	S	S	.	*	H	α-helix	trans	-59.4	-52.7	177.3	-171.8	-111.2	0	0	0	110.5	M28 R29 R34 T35 E36	M28-D32 VanDerWaalsContact O-CB 3.28Å; M28-D32 WeakPolarHBondContact O-CB 3.44Å; M28-D32 PolarHBondContact O-N 3.41Å; R29-D32 PolarHBondContact O-N 2.97Å; D32-R34 VanDerWaalsContact C-N 3.34Å; D32-R34 PolarHBondContact O-N 2.89Å; D32-T35 WeakPolarHBondContact O-CA 3.45Å; D32-T35 WeakPolarHBondContact O-CB 3.32Å; D32-T35 PolarHBondContact O-N 2.7Å; D32-E36 WeakPolarHBondContact O-CG 3.38Å; D32-E36 PolarHBondContact O-N 3.44Å
33	Q	85.4	Confident	81.8	Confident	125 Å²	125	124.2 Å²	124.2	58%	0.584	61%	0.61	S	S	*	*	H	α-helix	trans	-58.2	-42	177.3	-176.6	174	66.4	0	0	112.7	R29 T35 E36 V37	R29-Q33 WeakPolarHBondContact O-CB 3.45Å; R29-Q33 PolarHBondContact O-N 3.36Å; Q33-T35 VanDerWaalsContact C-N 3.32Å; Q33-E36 PolarHBondContact O-N 3.24Å; Q33-V37 HydrophobicContact CG-CG2 4.38Å; Q33-V37 WeakPolarHBondContact O-CB 3.25Å; Q33-V37 WeakPolarHBondContact O-CG2 3.33Å; Q33-V37 PolarHBondContact O-N 3.36Å
34	R	85.1	Confident	81.1	Confident	176 Å²	176	121.2 Å²	121.2	66%	0.664	61%	0.607	S	S	*	*	H	α-helix	trans	-65.5	-38	175.8	-76	176.6	64	-159.1	-3.5	111.9	E30 L31 D32 T38	E30-R34 WeakPolarHBondContact O-CB 3.46Å; E30-R34 WeakPolarHBondContact O-CG 3.25Å; E30-R34 PolarHBondContact O-N 3.36Å; L31-R34 PolarHBondContact O-N 2.96Å; D32-R34 VanDerWaalsContact C-N 3.34Å; D32-R34 PolarHBondContact O-N 2.89Å; R34-T38 WeakPolarHBondContact O-CB 3.48Å; R34-T38 PolarHBondContact O-N 3.28Å; R34-T38 VanDerWaalsContact O-N 3.09Å; R34-T38 PolarHBondContact O-OG1 3.49Å
35	T	80	Confident	80.4	Confident	91 Å²	91	123.8 Å²	123.8	56%	0.558	62%	0.618	S	S	*	*	H	α-helix	trans	-68.7	-42.4	179	-52.9	0	0	0	0	110.7	L31 D32 Q33 T38 C39	L31-T35 WeakPolarHBondContact O-CB 3.06Å; L31-T35 PolarHBondContact O-N 3.09Å; L31-T35 PolarHBondContact O-OG1 2.99Å; D32-T35 WeakPolarHBondContact O-CA 3.45Å; D32-T35 WeakPolarHBondContact O-CB 3.32Å; D32-T35 PolarHBondContact O-N 2.7Å; Q33-T35 VanDerWaalsContact C-N 3.32Å; T35-T38 PolarHBondContact O-N 3.33Å; T35-C39 PolarHBondContact O-N 3.46Å
36	E	75.4	Confident	79.5	Confident	132 Å²	132	123.9 Å²	123.9	62%	0.617	62%	0.623	S	S	*	*	H	α-helix	trans	-63.8	-43.6	174.3	-68.7	-166.6	146.8	0	0	112.4	D32 Q33 T38 C39	D32-E36 WeakPolarHBondContact O-CG 3.38Å; D32-E36 PolarHBondContact O-N 3.44Å; Q33-E36 PolarHBondContact O-N 3.24Å; E36-T38 VanDerWaalsContact C-N 3.3Å; E36-T38 PolarHBondContact O-N 3.13Å; E36-C39 CarbonylContact O-C 3.53Å; E36-C39 PolarHBondContact O-N 3.23Å
37	V	67.6	Low	78.5	Confident	112 Å²	112	125.9 Å²	125.9	68%	0.679	64%	0.636	S	S	*	*	H	α-helix	trans	-66.9	-30.4	179.3	169.7	0	0	0	0	112.4	Q33	Q33-V37 HydrophobicContact CG-CG2 4.38Å; Q33-V37 WeakPolarHBondContact O-CB 3.25Å; Q33-V37 WeakPolarHBondContact O-CG2 3.33Å; Q33-V37 PolarHBondContact O-N 3.36Å
38	T	62.1	Low	77.4	Confident	112 Å²	112	128.9 Å²	128.9	69%	0.687	65%	0.65	S	S	*	*	H	α-helix	trans	-82.8	-16.3	-178.3	-43	0	0	0	0	112.5	R34 T35 E36 P40	R34-T38 WeakPolarHBondContact O-CB 3.48Å; R34-T38 PolarHBondContact O-N 3.28Å; R34-T38 VanDerWaalsContact O-N 3.09Å; R34-T38 PolarHBondContact O-OG1 3.49Å; T35-T38 PolarHBondContact O-N 3.33Å; E36-T38 VanDerWaalsContact C-N 3.3Å; E36-T38 PolarHBondContact O-N 3.13Å; T38-P40 VanDerWaalsContact C-CD 3.46Å; T38-P40 WeakPolarHBondContact O-CD 3.48Å
39	C	54.9	Low	76.2	Confident	90 Å²	90	129.7 Å²	129.7	61%	0.608	66%	0.655	S	S	*	*			trans	-119	73.4	176.3	-74.1	0	0	0	0	111.3	T35 E36 H41	T35-C39 PolarHBondContact O-N 3.46Å; E36-C39 CarbonylContact O-C 3.53Å; E36-C39 PolarHBondContact O-N 3.23Å; C39-H41 PolarHBondContact O-N 3.16Å
40	P	55.3	Low	74.9	Confident	110 Å²	110	125.7 Å²	125.7	71%	0.714	65%	0.653	S	S	*	*			trans	-66.5	121.2	166	29.4	-29.8	0	0	0	108	T38	T38-P40 VanDerWaalsContact C-CD 3.46Å; T38-P40 WeakPolarHBondContact O-CD 3.48Å
41	H	58	Low	73.3	Confident	262 Å²	262	127.9 Å²	127.9	100%	1.213	67%	0.67	S	S	*	*			trans	-63.2	0	159.1	-85.9	41.5	0	0	0	109.7	C39	C39-H41 PolarHBondContact O-N 3.16Å

Retrieved 41 of 41 residues in 50.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).