A0A087WRU8_MOUSE Loading...

Potassium voltage-gated channel, subfamily Q, member 1

AlphaFold DB , UniProt , Accession A0A087WRU8, Species MOUSE (Mus musculus, Mouse), Gene Kcnq1, Length 30 aa.

						>A0A087WRU8_MOUSE|A0A087WRU8|Kcnq1
MHQLPTSILIPKNMPGGFLIVLVCLIFSVL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.4	Very low	58	Low	223 Å²	223	147.3 Å²	147.3	100%	1.099	79%	0.794	S	S	*	*				0	92.4	0	-79.4	-72.2	-168.1	0	109.1
2	H	48.9	Very low	58.3	Low	197 Å²	197	150.9 Å²	150.9	91%	0.912	80%	0.797	S	S	*	*			trans	-156.8	103.4	145.1	-127.5	-86.9	0	0	106.9
3	Q	52.8	Low	58.6	Low	157 Å²	157	150.5 Å²	150.5	73%	0.734	80%	0.796	S	S	*	*			trans	-73.7	141.4	176.3	-72.3	160.3	-73.7	0	109.7
4	L	58.1	Low	59	Low	153 Å²	153	152 Å²	152	80%	0.801	80%	0.799	S	S	*	*				-161.3	102.6	126.4	-130.3	93.4	0	0	108.5	T6	L4-T6 PolarHBondContact O-N 3.24Å
5	P	59.2	Low	59.2	Low	116 Å²	116	149.1 Å²	149.1	75%	0.753	79%	0.793	S	S	*	*			trans	-73.6	105.3	157.4	29.1	-26.1	0	0	105.9	S7	P5-S7 VanDerWaalsContact C-N 3.34Å; P5-S7 PolarHBondContact O-N 2.93Å
6	T	64.1	Low	59.7	Low	115 Å²	115	142.4 Å²	142.4	71%	0.706	77%	0.77	S	S	*	*			trans	-57.5	107.1	165.6	42.4	0	0	0	106.5	L4 I8	L4-T6 PolarHBondContact O-N 3.24Å; T6-I8 PolarHBondContact O-N 2.88Å
7	S	61.7	Low	60.8	Low	98 Å²	98	136.6 Å²	136.6	69%	0.685	75%	0.752	S	S	*	*			trans	-30.2	106.8	171.5	-173.5	0	0	0	109.6	P5 L9	P5-S7 VanDerWaalsContact C-N 3.34Å; P5-S7 PolarHBondContact O-N 2.93Å; S7-L9 PolarHBondContact O-N 2.84Å
8	I	62.3	Low	61.9	Low	152 Å²	152	137.9 Å²	137.9	78%	0.779	75%	0.749	S	S	*	*			trans	-62.5	98.2	166.9	-65.5	168.5	0	0	103.2	T6 I10	T6-I8 PolarHBondContact O-N 2.88Å; I8-I10 PolarHBondContact O-N 2.82Å
9	L	63.6	Low	63.1	Low	158 Å²	158	136.7 Å²	136.7	83%	0.827	74%	0.741	S	S	*	*			trans	-47.2	106.5	173	-102.6	132.6	0	0	106.6	S7 P11	S7-L9 PolarHBondContact O-N 2.84Å; L9-P11 VanDerWaalsContact O-N 3.09Å
10	I	64.8	Low	64.4	Low	141 Å²	141	135.7 Å²	135.7	72%	0.723	73%	0.734	S	S	*	*			trans	-32.1	115.4	172.9	-60.5	159.5	0	0	107.2	I8 K12	I8-I10 PolarHBondContact O-N 2.82Å; I10-K12 VanDerWaalsContact C-N 3.27Å; I10-K12 PolarHBondContact O-N 2.74Å
11	P	60.1	Low	65.5	Low	110 Å²	110	133.4 Å²	133.4	71%	0.714	72%	0.724	S	S	*	*			trans	-59	108.4	164.7	24	-28.1	0	0	103.9	L9 N13	L9-P11 VanDerWaalsContact O-N 3.09Å; P11-N13 PolarHBondContact O-N 2.68Å
12	K	62.2	Low	67.9	Low	191 Å²	191	126.6 Å²	126.6	83%	0.83	69%	0.692	S	S	*	*			trans	-55.8	95.8	173.1	-108.4	-174.2	167	168	104.7	I10 M14	I10-K12 VanDerWaalsContact C-N 3.27Å; I10-K12 PolarHBondContact O-N 2.74Å; K12-M14 PolarHBondContact O-N 2.79Å
13	N	62	Low	70	Confident	146 Å²	146	121.5 Å²	121.5	78%	0.781	68%	0.675	S	S	*	*			trans	-52	95.7	173.9	-173.2	51.2	0	0	105.3	P11 P15	P11-N13 PolarHBondContact O-N 2.68Å; N13-P15 WeakPolarHBondContact O-CD 3.35Å
14	M	63.6	Low	72	Confident	171 Å²	171	118.1 Å²	118.1	84%	0.842	67%	0.667	S	S	*	*			trans	-64.5	100.1	-170.4	-85.1	171.8	125.3	0	107.2	K12 G16	K12-M14 PolarHBondContact O-N 2.79Å; M14-G16 PolarHBondContact O-N 3.35Å
15	P	62.5	Low	73.7	Confident	109 Å²	109	116.3 Å²	116.3	71%	0.708	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.8	1.7	-173.8	26.5	-15.4	0	0	111.5	N13	N13-P15 WeakPolarHBondContact O-CD 3.35Å
16	G	67.4	Low	75.4	Confident	41 Å²	41	115.3 Å²	115.3	42%	0.423	65%	0.645	S	S	.	*	H	α-helix	trans	-77.5	-23.2	-176.1	0	0	0	0	114.7	M14 I20	M14-G16 PolarHBondContact O-N 3.35Å; G16-I20 WeakPolarHBondContact O-CD1 3.38Å; G16-I20 WeakPolarHBondContact O-CG1 3.42Å
17	G	77.6	Confident	76.6	Confident	45 Å²	45	117.7 Å²	117.7	46%	0.464	65%	0.646	S	S	.	*	H	α-helix	trans	-69.1	-42.9	-176.9	0	0	0	0	113.1	L19 I20 V21	G17-L19 PolarHBondContact O-N 3.44Å; G17-I20 PolarHBondContact O-N 3.05Å; G17-V21 WeakPolarHBondContact O-CG2 3.48Å; G17-V21 PolarHBondContact O-N 3.02Å
18	F	80.9	Confident	78.1	Confident	159 Å²	159	117.8 Å²	117.8	70%	0.697	65%	0.646	S	S	*	*	H	α-helix	trans	-68.2	-37.8	-175.2	-175.8	-101.1	0	0	112.9	I20 V21 L22	F18-I20 VanDerWaalsContact C-N 3.35Å; F18-I20 PolarHBondContact O-N 3.47Å; F18-V21 PolarHBondContact O-N 3.11Å; F18-L22 WeakPolarHBondContact O-CB 2.95Å; F18-L22 PolarHBondContact O-N 3.25Å
19	L	85.1	Confident	79.5	Confident	115 Å²	115	116.6 Å²	116.6	60%	0.602	65%	0.646	S	S	*	*	H	α-helix	trans	-63.5	-41.4	179.4	-170.9	69.7	0	0	111.7	G17 L22 V23	G17-L19 PolarHBondContact O-N 3.44Å; L19-L22 PolarHBondContact O-N 3.48Å; L19-V23 WeakPolarHBondContact O-CG2 3.43Å; L19-V23 PolarHBondContact O-N 3.23Å; L19-V23 VanDerWaalsContact O-N 3.17Å
20	I	89.1	Confident	80.8	Confident	117 Å²	117	118.2 Å²	118.2	60%	0.6	66%	0.655	S	S	*	*	H	α-helix	trans	-66.7	-44.6	179.4	-62.5	167.4	0	0	110.5	G16 G17 F18 L22 V23 C24	G16-I20 WeakPolarHBondContact O-CD1 3.38Å; G16-I20 WeakPolarHBondContact O-CG1 3.42Å; G17-I20 PolarHBondContact O-N 3.05Å; F18-I20 VanDerWaalsContact C-N 3.35Å; F18-I20 PolarHBondContact O-N 3.47Å; I20-L22 PolarHBondContact O-N 3.44Å; I20-L22 VanDerWaalsContact C-N 3.32Å; I20-V23 PolarHBondContact O-N 3.18Å; I20-C24 PolarHBondContact O-N 3.46Å
21	V	87.6	Confident	81.6	Confident	87 Å²	87	117.1 Å²	117.1	53%	0.527	65%	0.651	S	S	.	*	H	α-helix	trans	-61.4	-42.4	178.5	174.6	0	0	0	111.1	G17 F18 C24 L25	G17-V21 WeakPolarHBondContact O-CG2 3.48Å; G17-V21 PolarHBondContact O-N 3.02Å; F18-V21 PolarHBondContact O-N 3.11Å; V21-C24 PolarHBondContact O-N 3.41Å; V21-L25 HydrophobicContact CG1-CD1 4.22Å; V21-L25 WeakPolarHBondContact O-CG 3.45Å; V21-L25 PolarHBondContact O-N 3.41Å; V21-L25 VanDerWaalsContact O-N 3.11Å
22	L	91.4	Very high	82.8	Confident	80 Å²	80	117.5 Å²	117.5	42%	0.419	65%	0.648	S	S	.	*	H	α-helix	trans	-61.7	-45.4	178.8	-174	67.4	0	0	112.1	F18 L19 I20 L25 I26	F18-L22 WeakPolarHBondContact O-CB 2.95Å; F18-L22 PolarHBondContact O-N 3.25Å; L19-L22 PolarHBondContact O-N 3.48Å; I20-L22 PolarHBondContact O-N 3.44Å; I20-L22 VanDerWaalsContact C-N 3.32Å; L22-L25 PolarHBondContact O-N 3.41Å; L22-I26 HydrophobicContact CG-CD1 4.41Å; L22-I26 WeakPolarHBondContact O-CG1 3.38Å; L22-I26 PolarHBondContact O-N 3.49Å
23	V	93.9	Very high	83.9	Confident	91 Å²	91	113.4 Å²	113.4	55%	0.552	64%	0.638	S	S	*	*	H	α-helix	trans	-66.8	-40.5	179.5	175.6	0	0	0	111.4	L19 I20 L25 I26 F27	L19-V23 WeakPolarHBondContact O-CG2 3.43Å; L19-V23 PolarHBondContact O-N 3.23Å; L19-V23 VanDerWaalsContact O-N 3.17Å; I20-V23 PolarHBondContact O-N 3.18Å; V23-L25 VanDerWaalsContact C-N 3.34Å; V23-L25 PolarHBondContact O-N 3.12Å; V23-I26 PolarHBondContact O-N 3.13Å; V23-F27 PolarHBondContact O-N 3.28Å; V23-F27 VanDerWaalsContact O-N 3.13Å
24	C	93.9	Very high	85.2	Confident	86 Å²	86	111.5 Å²	111.5	58%	0.581	63%	0.629	S	S	*	*	H	α-helix	trans	-60.5	-40.4	175.9	-89.9	0	0	0	112.9	I20 V21 I26 F27 S28	I20-C24 PolarHBondContact O-N 3.46Å; V21-C24 PolarHBondContact O-N 3.41Å; C24-I26 VanDerWaalsContact C-N 3.32Å; C24-I26 PolarHBondContact O-N 3.46Å; C24-F27 PolarHBondContact O-N 3.33Å; C24-S28 PolarHBondContact O-N 3.4Å; C24-S28 VanDerWaalsContact O-N 3.12Å
25	L	94.1	Very high	86.5	Confident	114 Å²	114	107.8 Å²	107.8	60%	0.597	62%	0.616	S	S	*	*	H	α-helix	trans	-64	-37.4	178.2	-77.5	169.1	0	0	112.4	V21 L22 V23 V29	V21-L25 HydrophobicContact CG1-CD1 4.22Å; V21-L25 WeakPolarHBondContact O-CG 3.45Å; V21-L25 PolarHBondContact O-N 3.41Å; V21-L25 VanDerWaalsContact O-N 3.11Å; L22-L25 PolarHBondContact O-N 3.41Å; V23-L25 VanDerWaalsContact C-N 3.34Å; V23-L25 PolarHBondContact O-N 3.12Å; L25-V29 WeakPolarHBondContact O-CG2 3.41Å
26	I	94.7	Very high	88.1	Confident	95 Å²	95	107.7 Å²	107.7	49%	0.487	61%	0.61	S	S	.	*	H	α-helix	trans	-70.8	-43.8	179.6	-63.3	165.4	0	0	110.9	L22 V23 C24 S28 V29 L30	L22-I26 HydrophobicContact CG-CD1 4.41Å; L22-I26 WeakPolarHBondContact O-CG1 3.38Å; L22-I26 PolarHBondContact O-N 3.49Å; V23-I26 PolarHBondContact O-N 3.13Å; C24-I26 VanDerWaalsContact C-N 3.32Å; C24-I26 PolarHBondContact O-N 3.46Å; I26-S28 VanDerWaalsContact C-N 3.29Å; I26-S28 PolarHBondContact O-N 3.17Å; I26-V29 PolarHBondContact O-N 3.36Å; I26-L30 HydrophobicContact CG2-CD1 4.31Å; I26-L30 PolarHBondContact O-N 3.41Å
27	F	91	Very high	89.6	Confident	166 Å²	166	112.4 Å²	112.4	73%	0.728	62%	0.623	S	S	*	*	H	α-helix	trans	-66.3	-30.5	178.7	-173.7	-95.3	0	0	112.8	V23 C24 V29	V23-F27 PolarHBondContact O-N 3.28Å; V23-F27 VanDerWaalsContact O-N 3.13Å; C24-F27 PolarHBondContact O-N 3.33Å; F27-V29 PolarHBondContact O-N 3.43Å
28	S	91.6	Very high	90.5	Very high	99 Å²	99	117.6 Å²	117.6	69%	0.692	64%	0.636	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.5	-16.9	176.8	-173.4	0	0	0	114	C24 I26	C24-S28 PolarHBondContact O-N 3.4Å; C24-S28 VanDerWaalsContact O-N 3.12Å; I26-S28 VanDerWaalsContact C-N 3.29Å; I26-S28 PolarHBondContact O-N 3.17Å
29	V	92.3	Very high	91.3	Very high	127 Å²	127	114.2 Å²	114.2	77%	0.77	63%	0.63	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.9	-30.1	-177.7	173.9	0	0	0	112.5	L25 I26 F27	L25-V29 WeakPolarHBondContact O-CG2 3.41Å; I26-V29 PolarHBondContact O-N 3.36Å; F27-V29 PolarHBondContact O-N 3.43Å
30	L	91.4	Very high	91.9	Very high	193 Å²	193	114.1 Å²	114.1	100%	1.01	63%	0.633	S	S	*	*			trans	-76.2	0	175.3	-79	165	0	0	111.7	I26	I26-L30 HydrophobicContact CG2-CD1 4.31Å; I26-L30 PolarHBondContact O-N 3.41Å

Retrieved 30 of 30 residues in 32.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).