A0A087WRX0_MOUSE Loading...

Lymphocyte antigen 6 family member G6G

AlphaFold DB , UniProt , Accession A0A087WRX0, Species MOUSE (Mus musculus, Mouse), Gene Ly6g6g, Length 87 aa.

						>A0A087WRX0_MOUSE|A0A087WRX0|Ly6g6g
MMRPLLVLLLLAVVCASLANPGGILVMKSCAPTCPNSTVSSDGRALSVSCCQGSQCNRSAASGLTGSLGAIWASASISLLWALLRAA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	61.1	Low	77.9	Confident	224 Å²	224	125.5 Å²	125.5	100%	1.103	64%	0.638	S	S	*	*				0	-6.1	0	-52.3	171.8	-171.1	0	0	113.8	P4	M1-P4 WeakPolarHBondContact O-CD 3.2Å
2	M	69.9	Low	78.4	Confident	163 Å²	163	120 Å²	120	80%	0.803	63%	0.625	S	S	*	*			trans	-87	-19.1	-176	-69.6	166.2	153.6	0	0	115.2	L5 L6	M2-L5 WeakPolarHBondContact O-CB 2.97Å; M2-L5 PolarHBondContact O-N 3.13Å; M2-L6 PolarHBondContact O-N 3.34Å
3	R	72.7	Confident	78.8	Confident	175 Å²	175	117.8 Å²	117.8	66%	0.66	62%	0.62	S	S	*	*	H	α-helix	trans	-55.5	-46.6	179.7	-74.3	175.8	135.2	-161	-4.4	114.9	L5 L6 V7	R3-L5 VanDerWaalsContact C-N 3.3Å; R3-L5 PolarHBondContact O-N 3.38Å; R3-L6 PolarHBondContact O-N 3.37Å; R3-V7 WeakPolarHBondContact O-CG2 3.31Å; R3-V7 PolarHBondContact O-N 3.18Å; R3-V7 VanDerWaalsContact O-N 3.16Å
4	P	75.1	Confident	79	Confident	90 Å²	90	113 Å²	113	58%	0.584	60%	0.598	S	S	*	*	H	α-helix	trans	-66.3	-33.7	-179.7	25.7	-34.8	0	0	0	112.5	M1 V7 L8	M1-P4 WeakPolarHBondContact O-CD 3.2Å; P4-V7 PolarHBondContact O-N 3.16Å; P4-L8 WeakPolarHBondContact O-CB 3.03Å; P4-L8 PolarHBondContact O-N 3.2Å
5	L	79.5	Confident	79.1	Confident	122 Å²	122	110.7 Å²	110.7	64%	0.639	59%	0.593	S	S	*	*	H	α-helix	trans	-63.5	-43.6	175.7	-99.4	159.4	0	0	0	111.8	M2 R3 L8 L9	M2-L5 WeakPolarHBondContact O-CB 2.97Å; M2-L5 PolarHBondContact O-N 3.13Å; R3-L5 VanDerWaalsContact C-N 3.3Å; R3-L5 PolarHBondContact O-N 3.38Å; L5-L8 PolarHBondContact O-N 3.28Å; L5-L9 WeakPolarHBondContact O-CB 2.95Å; L5-L9 PolarHBondContact O-N 2Å
6	L	81.2	Confident	79	Confident	113 Å²	113	107.7 Å²	107.7	59%	0.592	59%	0.588	S	S	*	*	H	α-helix	trans	-62.3	-43.9	176.6	-165.3	95.9	0	0	0	111.5	M2 R3 L9 L10	M2-L6 PolarHBondContact O-N 3.34Å; R3-L6 PolarHBondContact O-N 3.37Å; L6-L9 PolarHBondContact O-N 3.15Å; L6-L10 HydrophobicContact CD2-CD1 4.32Å; L6-L10 HydrophobicContact CG-CD1 4.43Å; L6-L10 WeakPolarHBondContact O-CG 3.24Å; L6-L10 PolarHBondContact O-N 3.01Å
7	V	82.3	Confident	78.6	Confident	61 Å²	61	105.9 Å²	105.9	37%	0.37	59%	0.585	S	S	.	*	H	α-helix	trans	-63.4	-43.5	178.6	173.9	0	0	0	0	111.1	R3 P4 L9 L10 L11	R3-V7 WeakPolarHBondContact O-CG2 3.31Å; R3-V7 PolarHBondContact O-N 3.18Å; R3-V7 VanDerWaalsContact O-N 3.16Å; P4-V7 PolarHBondContact O-N 3.16Å; V7-L9 PolarHBondContact O-N 2.85Å; V7-L10 PolarHBondContact O-N 3.33Å; V7-L11 HydrophobicContact CG1-CD1 4.16Å; V7-L11 PolarHBondContact O-N 2.03Å
8	L	82.4	Confident	78.1	Confident	120 Å²	120	107.8 Å²	107.8	63%	0.628	59%	0.594	S	S	*	*	H	α-helix	trans	-63.7	-41	177.5	-169.4	71.6	0	0	0	111.8	P4 L5 L11 A12	P4-L8 WeakPolarHBondContact O-CB 3.03Å; P4-L8 PolarHBondContact O-N 3.2Å; L5-L8 PolarHBondContact O-N 3.28Å; L8-L11 PolarHBondContact O-N 3.12Å; L8-A12 PolarHBondContact O-N 3.45Å
9	L	83.6	Confident	77.5	Confident	118 Å²	118	106.4 Å²	106.4	62%	0.618	60%	0.598	S	S	*	*	H	α-helix	trans	-62.9	-44.9	177.5	-162	92.8	0	0	0	111.4	L5 L6 V7 A12 V13	L5-L9 WeakPolarHBondContact O-CB 2.95Å; L5-L9 PolarHBondContact O-N 2Å; L6-L9 PolarHBondContact O-N 3.15Å; V7-L9 PolarHBondContact O-N 2.85Å; L9-A12 PolarHBondContact O-N 3.48Å; L9-V13 WeakPolarHBondContact O-CG2 3.01Å; L9-V13 PolarHBondContact O-N 3.24Å
10	L	84.1	Confident	76.7	Confident	105 Å²	105	107.4 Å²	107.4	55%	0.55	60%	0.602	S	S	.	*	H	α-helix	trans	-62.4	-43.6	177.2	-71.5	170.3	0	0	0	111.6	L6 V7 A12 V13 V14	L6-L10 HydrophobicContact CD2-CD1 4.32Å; L6-L10 HydrophobicContact CG-CD1 4.43Å; L6-L10 WeakPolarHBondContact O-CG 3.24Å; L6-L10 PolarHBondContact O-N 3.01Å; V7-L10 PolarHBondContact O-N 3.33Å; L10-A12 PolarHBondContact O-N 2.93Å; L10-V13 PolarHBondContact O-N 3.02Å; L10-V14 VanDerWaalsContact O-CG2 3.3Å; L10-V14 WeakPolarHBondContact O-CG2 2.98Å; L10-V14 PolarHBondContact O-N 2.85Å
11	L	85.1	Confident	75.7	Confident	90 Å²	90	107 Å²	107	47%	0.471	60%	0.604	S	S	.	*	H	α-helix	trans	-58.4	-46.6	174.6	-96.2	156.4	0	0	0	112	V7 L8 V13 V14 C15	V7-L11 HydrophobicContact CG1-CD1 4.16Å; V7-L11 PolarHBondContact O-N 2.03Å; L8-L11 PolarHBondContact O-N 3.12Å; L11-V13 PolarHBondContact O-N 2.8Å; L11-V14 PolarHBondContact O-N 3.05Å; L11-C15 PolarHBondContact O-N 3.19Å; L11-C15 PolarHBondContact O-SG 3.22Å
12	A	84.3	Confident	75.8	Confident	59 Å²	59	100.1 Å²	100.1	49%	0.488	59%	0.59	S	S	.	*	H	α-helix	trans	-61.3	-42.4	179.2	0	0	0	0	0	112.3	L8 L9 L10 C15 A16	L8-A12 PolarHBondContact O-N 3.45Å; L9-A12 PolarHBondContact O-N 3.48Å; L10-A12 PolarHBondContact O-N 2.93Å; A12-C15 PolarHBondContact O-N 3.39Å; A12-A16 WeakPolarHBondContact O-CB 3.34Å; A12-A16 PolarHBondContact O-N 3.06Å
13	V	83.3	Confident	75.3	Confident	92 Å²	92	95 Å²	95	56%	0.558	58%	0.579	S	S	*	*	H	α-helix	trans	-63.3	-42.7	176.6	172	0	0	0	0	111.3	L9 L10 L11 A16 S17	L9-V13 WeakPolarHBondContact O-CG2 3.01Å; L9-V13 PolarHBondContact O-N 3.24Å; L10-V13 PolarHBondContact O-N 3.02Å; L11-V13 PolarHBondContact O-N 2.8Å; V13-A16 PolarHBondContact O-N 3.46Å; V13-S17 PolarHBondContact O-N 3.27Å; V13-S17 PolarHBondContact O-OG 3.43Å
14	V	82	Confident	74.9	Confident	50 Å²	50	93.9 Å²	93.9	30%	0.303	59%	0.585	S	S	.	*	H	α-helix	trans	-64.8	-43	176.8	172.2	0	0	0	0	111.3	L10 L11 A16 S17 L18 W72	L10-V14 VanDerWaalsContact O-CG2 3.3Å; L10-V14 WeakPolarHBondContact O-CG2 2.98Å; L10-V14 PolarHBondContact O-N 2.85Å; L11-V14 PolarHBondContact O-N 3.05Å; V14-A16 VanDerWaalsContact C-N 3.33Å; V14-A16 PolarHBondContact O-N 3.38Å; V14-S17 PolarHBondContact O-N 3.36Å; V14-S17 PolarHBondContact O-OG 3.29Å; V14-L18 PolarHBondContact O-N 3.05Å; V14-L18 VanDerWaalsContact O-N 3.08Å; V14-W72 HydrophobicContact CG1-CZ3 4.39Å; V14-W72 HydrophobicContact CG2-CH2 4.38Å; V14-W72 HydrophobicContact CG2-CZ3 4.12Å
15	C	80.8	Confident	74.6	Confident	79 Å²	79	97.5 Å²	97.5	53%	0.534	60%	0.598	S	S	.	*	H	α-helix	trans	-62.9	-40.7	176.1	-69.3	0	0	0	0	111.8	L11 A12 L18 A19	L11-C15 PolarHBondContact O-N 3.19Å; L11-C15 PolarHBondContact O-SG 3.22Å; A12-C15 PolarHBondContact O-N 3.39Å; C15-L18 PolarHBondContact O-N 3.33Å; C15-A19 WeakPolarHBondContact O-CB 3.03Å; C15-A19 PolarHBondContact O-N 3.13Å
16	A	76.6	Confident	74.3	Confident	62 Å²	62	96.1 Å²	96.1	51%	0.512	60%	0.595	S	S	.	*	H	α-helix	trans	-64.9	-38.8	178.5	0	0	0	0	0	112.7	A12 V13 V14 A19 N20	A12-A16 WeakPolarHBondContact O-CB 3.34Å; A12-A16 PolarHBondContact O-N 3.06Å; V13-A16 PolarHBondContact O-N 3.46Å; V14-A16 VanDerWaalsContact C-N 3.33Å; V14-A16 PolarHBondContact O-N 3.38Å; A16-A19 PolarHBondContact O-N 3.22Å; A16-N20 PolarHBondContact O-N 3.43Å
17	S	71.9	Confident	74.1	Confident	77 Å²	77	99.4 Å²	99.4	54%	0.538	61%	0.609	S	S	.	*	H	α-helix	trans	-71.1	-34.6	177	63	0	0	0	0	112.5	V13 V14	V13-S17 PolarHBondContact O-N 3.27Å; V13-S17 PolarHBondContact O-OG 3.43Å; V14-S17 PolarHBondContact O-N 3.36Å; V14-S17 PolarHBondContact O-OG 3.29Å
18	L	70.2	Confident	74	Confident	140 Å²	140	101.2 Å²	101.2	73%	0.733	61%	0.612	S	S	*	*	H	α-helix	trans	-70.4	-33.6	174.7	-127.5	70.1	0	0	0	112.6	V14 C15 N20	V14-L18 PolarHBondContact O-N 3.05Å; V14-L18 VanDerWaalsContact O-N 3.08Å; C15-L18 PolarHBondContact O-N 3.33Å; L18-N20 VanDerWaalsContact C-N 3.26Å; L18-N20 PolarHBondContact O-N 3.49Å
19	A	66.4	Low	74.1	Confident	82 Å²	82	100.1 Å²	100.1	68%	0.678	62%	0.615	S	S	*	*	H	α-helix	trans	-71.9	-20.2	-180	0	0	0	0	0	113.4	C15 A16 P21	C15-A19 WeakPolarHBondContact O-CB 3.03Å; C15-A19 PolarHBondContact O-N 3.13Å; A16-A19 PolarHBondContact O-N 3.22Å; A19-P21 WeakPolarHBondContact O-CD 3.33Å
20	N	61.5	Low	74.2	Confident	125 Å²	125	100.7 Å²	100.7	67%	0.668	63%	0.627	S	S	*	*	S	Bend	trans	-106.6	76.7	174	-154.8	-18.8	0	0	0	108.9	A16 L18 G22	A16-N20 PolarHBondContact O-N 3.43Å; L18-N20 VanDerWaalsContact C-N 3.26Å; L18-N20 PolarHBondContact O-N 3.49Å; N20-G22 VanDerWaalsContact C-N 3.27Å; N20-G22 PolarHBondContact O-N 3.46Å
21	P	55.6	Low	74.4	Confident	100 Å²	100	98.8 Å²	98.8	65%	0.649	63%	0.626	S	S	*	*			trans	-63.8	101.5	169.6	29	-31.1	0	0	0	105.3	A19 G23	A19-P21 WeakPolarHBondContact O-CD 3.33Å; P21-G23 PolarHBondContact O-N 3.05Å
22	G	62.8	Low	74.4	Confident	79 Å²	79	101 Å²	101	81%	0.814	65%	0.646	S	S	*	*			trans	-63.7	26.3	167.4	0	0	0	0	0	112.5	N20	N20-G22 VanDerWaalsContact C-N 3.27Å; N20-G22 PolarHBondContact O-N 3.46Å
23	G	60.7	Low	74.6	Confident	55 Å²	55	103.5 Å²	103.5	57%	0.567	66%	0.655	S	S	*	*			trans	-77.9	125.8	-180	0	0	0	0	0	109.9	P21 L25	P21-G23 PolarHBondContact O-N 3.05Å; G23-L25 PolarHBondContact O-N 3.34Å
24	I	64.4	Low	74.6	Confident	153 Å²	153	102.2 Å²	102.2	79%	0.785	65%	0.65	S	S	*	*			trans	-62.4	122.8	167.2	-59.2	170.4	0	0	0	107.4	V26	I24-V26 HydrophobicContact CG2-CG2 4.22Å; I24-V26 PolarHBondContact O-N 3.12Å
25	L	68.3	Low	74.5	Confident	166 Å²	166	103 Å²	103	87%	0.869	66%	0.656	S	S	*	*			trans	-69	102.7	172.6	-71.8	164.9	0	0	0	108.6	G23	G23-L25 PolarHBondContact O-N 3.34Å
26	V	72.4	Confident	74.2	Confident	93 Å²	93	106.4 Å²	106.4	56%	0.564	67%	0.669	S	S	*	*			trans	-96.2	103.1	174.9	-178.5	0	0	0	0	108.6	I24	I24-V26 HydrophobicContact CG2-CG2 4.22Å; I24-V26 PolarHBondContact O-N 3.12Å
27	M	76.7	Confident	74	Confident	182 Å²	182	107.7 Å²	107.7	90%	0.897	67%	0.674	S	S	*	*			trans	-67.6	141.5	171.9	-68.7	-176.8	104.6	0	0	110.4
28	K	81.7	Confident	74	Confident	98 Å²	98	106.7 Å²	106.7	43%	0.426	67%	0.665	S	S	.	*			trans	-132.2	129.9	179.6	-66.4	-179	177.7	70.9	0	108.9	N57 S59	K28-N57 WeakPolarHBondContact CD-O 3.33Å; K28-N57 WeakPolarHBondContact CE-O 3.34Å; K28-S59 WeakPolarHBondContact CE-OG 2.99Å; K28-S59 PolarHBondContact NZ-OG 2.95Å
29	S	83.2	Confident	74.1	Confident	98 Å²	98	105.1 Å²	105.1	69%	0.685	66%	0.661	S	S	*	*			trans	-146.9	158.7	178.1	53.9	0	0	0	0	110.4
30	C	86.7	Confident	74.4	Confident	130 Å²	130	102.9 Å²	102.9	88%	0.878	64%	0.64	S	S	*	*			trans	-94.9	132.4	166.7	-61.9	0	0	0	0	108.1
31	A	87.2	Confident	75.1	Confident	64 Å²	64	103.2 Å²	103.2	53%	0.529	65%	0.652	S	S	.	*			trans	-140.5	146.7	177.3	0	0	0	0	0	109.9	T33	A31-T33 WeakPolarHBondContact CB-O 3.48Å; A31-T33 PolarHBondContact O-N 3.42Å
32	P	86	Confident	76.2	Confident	137 Å²	137	104.8 Å²	104.8	89%	0.89	66%	0.655	S	S	*	*	S	Bend	trans	-66.7	-25.7	177.5	27.8	-34.6	0	0	0	112.2
33	T	87.5	Confident	77	Confident	112 Å²	112	103.8 Å²	103.8	69%	0.687	65%	0.645	S	S	*	*	S	Bend	trans	-126	142.7	173.2	52.5	0	0	0	0	109	A31	A31-T33 WeakPolarHBondContact CB-O 3.48Å; A31-T33 PolarHBondContact O-N 3.42Å
34	C	84.1	Confident	77.8	Confident	65 Å²	65	110.2 Å²	110.2	44%	0.439	65%	0.652	S	S	.	*			trans	-124.1	107.7	179.8	-165.6	0	0	0	0	109.1	C50	C34-C50 HydrophobicContact CB-CB 3.63Å; C34-C50 WeakPolarHBondContact CB-SG 3.48Å; C34-C50 VanDerWaalsContact SG-CA 3.57Å; C34-C50 WeakPolarHBondContact SG-CB 3.42Å; C34-C50 CovalentContact SG-SG 2Å; C34-C50 PolarHBondContact SG-SG 3.5Å
35	P	80.7	Confident	78.5	Confident	66 Å²	66	107.2 Å²	107.2	43%	0.429	65%	0.65	S	S	.	*			trans	-75.4	145.7	-179.9	31.4	-35.5	0	0	0	110.8	S37 T38 V48	P35-S37 PolarHBondContact O-N 3.3Å; P35-T38 HydrophobicContact CG-CG2 3.68Å; P35-V48 WeakPolarHBondContact O-CB 3Å; P35-V48 VanDerWaalsContact O-CG1 3.24Å; P35-V48 WeakPolarHBondContact O-CG1 3.46Å
36	N	73.9	Confident	79	Confident	150 Å²	150	103.2 Å²	103.2	80%	0.802	63%	0.629	S	S	*	*	S	Bend	trans	-68.1	-13.4	176.7	-79.7	-5.7	0	0	0	113.5
37	S	71.2	Confident	79.4	Confident	89 Å²	89	105 Å²	105	62%	0.622	65%	0.646	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-151.7	140.7	177.8	48.4	0	0	0	0	110	P35	P35-S37 PolarHBondContact O-N 3.3Å
38	T	72.2	Confident	79.8	Confident	56 Å²	56	98.2 Å²	98.2	34%	0.344	61%	0.614	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-125	148.4	169	42.8	0	0	0	0	109.3	P35 L46 V48	P35-T38 HydrophobicContact CG-CG2 3.68Å; T38-L46 PolarHBondContact N-O 2.94Å; T38-L46 WeakPolarHBondContact O-CB 3.29Å; T38-L46 PolarHBondContact O-N 3.04Å; T38-V48 HydrophobicContact CG2-CG2 3.88Å; T38-V48 WeakPolarHBondContact OG1-CG2 3.24Å
39	V	72.7	Confident	80	Confident	107 Å²	107	98.9 Å²	98.9	65%	0.648	63%	0.631	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-101.9	125.1	172.8	-176.2	0	0	0	0	107.1	R44	V39-R44 WeakPolarHBondContact CA-O 3.44Å
40	S	72.8	Confident	80.1	Confident	35 Å²	35	96.9 Å²	96.9	25%	0.245	62%	0.617	C	S	.	*			trans	-63.1	160.2	172	-167.6	0	0	0	0	110	D42 G43 R44	S40-D42 PolarHBondContact O-N 2.99Å; S40-G43 PolarHBondContact O-N 2.95Å; S40-R44 PolarHBondContact N-O 3.04Å
41	S	75.5	Confident	80.2	Confident	132 Å²	132	93.9 Å²	93.9	92%	0.923	60%	0.596	S	S	*	*	T	Hydrogen-bonded Turn	trans	-52.6	-26.7	172.6	-57.6	0	0	0	0	113.2	G43	S41-G43 VanDerWaalsContact C-N 3.26Å; S41-G43 PolarHBondContact O-N 2.72Å
42	D	80.5	Confident	80.4	Confident	133 Å²	133	100.3 Å²	100.3	71%	0.711	62%	0.616	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.6	8.7	176.3	-48.9	-58.6	0	0	0	114.5	S40 R44	S40-D42 PolarHBondContact O-N 2.99Å; D42-R44 PolarHBondContact O-N 3.44Å
43	G	78	Confident	80.4	Confident	58 Å²	58	96.4 Å²	96.4	60%	0.598	60%	0.601	S	S	*	*	S	Bend	trans	75.8	3.6	-178.3	0	0	0	0	0	114.9	S40 S41	S40-G43 PolarHBondContact O-N 2.95Å; S41-G43 VanDerWaalsContact C-N 3.26Å; S41-G43 PolarHBondContact O-N 2.72Å
44	R	79.1	Confident	80.4	Confident	190 Å²	190	96.3 Å²	96.3	72%	0.717	60%	0.604	S	S	*	*	P	Polyproline II helix	trans	-80.1	133.7	178.6	-65	-171.7	179.2	-143.3	0.5	111.3	V39 S40 D42 L46	V39-R44 WeakPolarHBondContact CA-O 3.44Å; S40-R44 PolarHBondContact N-O 3.04Å; D42-R44 PolarHBondContact O-N 3.44Å; R44-L46 PolarHBondContact O-N 2.8Å
45	A	78.2	Confident	80.4	Confident	91 Å²	91	99.3 Å²	99.3	75%	0.752	61%	0.612	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-66.9	123.2	170.1	0	0	0	0	0	110.1
46	L	78.9	Confident	80.7	Confident	82 Å²	82	98.8 Å²	98.8	43%	0.429	61%	0.609	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-101.9	133.2	174.6	-67.9	166.1	0	0	0	108.7	T38 R44 V48	T38-L46 PolarHBondContact N-O 2.94Å; T38-L46 WeakPolarHBondContact O-CB 3.29Å; T38-L46 PolarHBondContact O-N 3.04Å; R44-L46 PolarHBondContact O-N 2.8Å; L46-V48 PolarHBondContact O-N 3.33Å
47	S	80.4	Confident	81.1	Confident	130 Å²	130	94.5 Å²	94.5	91%	0.909	59%	0.586	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-73.4	122.6	171.8	-173.3	0	0	0	0	109.3
48	V	84.9	Confident	81.5	Confident	39 Å²	39	99.3 Å²	99.3	24%	0.236	59%	0.591	C	S	.	*			trans	-108.3	129.2	179.4	-174.9	0	0	0	0	108.6	P35 T38 L46	P35-V48 WeakPolarHBondContact O-CB 3Å; P35-V48 VanDerWaalsContact O-CG1 3.24Å; P35-V48 WeakPolarHBondContact O-CG1 3.46Å; T38-V48 HydrophobicContact CG2-CG2 3.88Å; T38-V48 WeakPolarHBondContact OG1-CG2 3.24Å; L46-V48 PolarHBondContact O-N 3.33Å
49	S	85.6	Confident	81.3	Confident	112 Å²	112	99 Å²	99	78%	0.783	59%	0.591	S	S	*	*			trans	-116.5	124.8	173.1	-173.6	0	0	0	0	109.4
50	C	86.9	Confident	80.7	Confident	56 Å²	56	98 Å²	98	38%	0.378	59%	0.594	S	S	.	*			trans	-106.6	141.2	-176.1	-53.2	0	0	0	0	109.6	C34	C34-C50 HydrophobicContact CB-CB 3.63Å; C34-C50 WeakPolarHBondContact CB-SG 3.48Å; C34-C50 VanDerWaalsContact SG-CA 3.57Å; C34-C50 WeakPolarHBondContact SG-CB 3.42Å; C34-C50 CovalentContact SG-SG 2Å; C34-C50 PolarHBondContact SG-SG 3.5Å
51	C	88.3	Confident	79.9	Confident	67 Å²	67	99.3 Å²	99.3	45%	0.453	61%	0.607	S	S	.	*			trans	-144.8	156.3	172.9	60.4	0	0	0	0	109.4	C56 N57	C51-C56 HydrophobicContact CB-CB 3.61Å; C51-C56 WeakPolarHBondContact CB-SG 3.37Å; C51-C56 PolarHBondContact O-SG 3.44Å; C51-C56 WeakPolarHBondContact SG-CB 3.48Å; C51-C56 CovalentContact SG-SG 2.03Å; C51-C56 PolarHBondContact SG-SG 3Å; C51-N57 PolarHBondContact SG-N 3.39Å
52	Q	90.4	Very high	78.9	Confident	199 Å²	199	97.7 Å²	97.7	93%	0.93	60%	0.595	S	S	*	*			trans	-107.6	143.1	177.7	-163	174.4	29.6	0	0	110.1
53	G	86.4	Confident	77.7	Confident	56 Å²	56	93.8 Å²	93.8	58%	0.577	59%	0.586	S	S	*	*	S	Bend	trans	108	165.1	179.2	0	0	0	0	0	113.7	C56	G53-C56 PolarHBondContact O-SG 2.96Å; G53-C56 VanDerWaalsContact O-SG 3.38Å
54	S	87.1	Confident	76.7	Confident	109 Å²	109	96.6 Å²	96.6	76%	0.762	59%	0.587	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.8	132.1	179.1	57.3	0	0	0	0	111.1	C56	S54-C56 PolarHBondContact O-N 2.7Å; S54-C56 VanDerWaalsContact O-N 3.13Å
55	Q	85.5	Confident	75.8	Confident	129 Å²	129	92.4 Å²	92.4	60%	0.603	58%	0.583	S	S	*	*	T	Hydrogen-bonded Turn	trans	58.6	21.2	176.5	-54.6	175.9	76.7	0	0	114.5	N57 R58	Q55-N57 PolarHBondContact O-N 2.76Å; Q55-R58 VanDerWaalsContact O-CB 3.31Å; Q55-R58 WeakPolarHBondContact O-CB 3.27Å; Q55-R58 PolarHBondContact O-N 2.93Å
56	C	85.8	Confident	74.9	Confident	54 Å²	54	90.2 Å²	90.2	37%	0.365	57%	0.57	S	S	.	*	T	Hydrogen-bonded Turn	trans	-66.3	-28.8	-179.7	67.5	0	0	0	0	112.5	C51 G53 S54 R58	C51-C56 HydrophobicContact CB-CB 3.61Å; C51-C56 WeakPolarHBondContact CB-SG 3.37Å; C51-C56 PolarHBondContact O-SG 3.44Å; C51-C56 WeakPolarHBondContact SG-CB 3.48Å; C51-C56 CovalentContact SG-SG 2.03Å; C51-C56 PolarHBondContact SG-SG 3Å; G53-C56 PolarHBondContact O-SG 2.96Å; G53-C56 VanDerWaalsContact O-SG 3.38Å; S54-C56 PolarHBondContact O-N 2.7Å; S54-C56 VanDerWaalsContact O-N 3.13Å; C56-R58 PolarHBondContact O-N 3.39Å; C56-R58 VanDerWaalsContact O-N 3.16Å
57	N	83.6	Confident	74.3	Confident	60 Å²	60	89.1 Å²	89.1	32%	0.321	57%	0.568	S	S	.	*	T	Hydrogen-bonded Turn	trans	-83.3	20.3	-179.3	66.1	-6.7	0	0	0	112.7	K28 C51 Q55 S59	K28-N57 WeakPolarHBondContact CD-O 3.33Å; K28-N57 WeakPolarHBondContact CE-O 3.34Å; C51-N57 PolarHBondContact SG-N 3.39Å; Q55-N57 PolarHBondContact O-N 2.76Å; N57-S59 PolarHBondContact O-N 2.96Å; N57-S59 VanDerWaalsContact O-N 3.12Å
58	R	78.8	Confident	74	Confident	190 Å²	190	87.6 Å²	87.6	72%	0.717	55%	0.55	S	S	*	.			trans	-72	106.8	178.8	-161.3	-179.1	-143.6	173.1	7.3	109.1	Q55 C56 A60	Q55-R58 VanDerWaalsContact O-CB 3.31Å; Q55-R58 WeakPolarHBondContact O-CB 3.27Å; Q55-R58 PolarHBondContact O-N 2.93Å; C56-R58 PolarHBondContact O-N 3.39Å; C56-R58 VanDerWaalsContact O-N 3.16Å; R58-A60 PolarHBondContact O-N 2.96Å; R58-A60 VanDerWaalsContact O-N 3.15Å
59	S	68.9	Low	73.3	Confident	49 Å²	49	87.8 Å²	87.8	34%	0.343	56%	0.559	S	S	.	*			trans	-66.8	113.3	169.5	-58.1	0	0	0	0	108.7	K28 N57 A61 S62	K28-S59 WeakPolarHBondContact CE-OG 2.99Å; K28-S59 PolarHBondContact NZ-OG 2.95Å; N57-S59 PolarHBondContact O-N 2.96Å; N57-S59 VanDerWaalsContact O-N 3.12Å; S59-A61 PolarHBondContact O-N 3.42Å; S59-S62 PolarHBondContact O-N 3.46Å
60	A	58.4	Low	72.8	Confident	87 Å²	87	85.3 Å²	85.3	72%	0.719	55%	0.546	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.1	-17.9	172	0	0	0	0	0	112.8	R58 S62 G63	R58-A60 PolarHBondContact O-N 2.96Å; R58-A60 VanDerWaalsContact O-N 3.15Å; A60-S62 PolarHBondContact O-N 2.97Å; A60-G63 PolarHBondContact O-N 3.38Å
61	A	55.8	Low	72.4	Confident	62 Å²	62	87.8 Å²	87.8	51%	0.512	55%	0.554	S	S	.	*	H	α-helix	trans	-54.3	-33.6	178.4	0	0	0	0	0	113.8	S59 G63 L64 T65	S59-A61 PolarHBondContact O-N 3.42Å; A61-G63 PolarHBondContact O-N 2.9Å; A61-L64 PolarHBondContact O-N 3.31Å; A61-T65 PolarHBondContact O-N 3.36Å; A61-T65 VanDerWaalsContact O-N 3.13Å; A61-T65 PolarHBondContact O-OG1 2.95Å
62	S	55.5	Low	72	Confident	98 Å²	98	92 Å²	92	69%	0.685	56%	0.56	S	S	*	*	H	α-helix	trans	-62.1	-29.6	177.9	-57.1	0	0	0	0	112.7	S59 A60 G66	S59-S62 PolarHBondContact O-N 3.46Å; A60-S62 PolarHBondContact O-N 2.97Å; S62-G66 PolarHBondContact O-N 3.38Å
63	G	55.7	Low	71.3	Confident	51 Å²	51	84.8 Å²	84.8	53%	0.526	54%	0.535	S	S	.	.	H	α-helix	trans	-75.5	-39	176.7	0	0	0	0	0	113.1	A60 A61 G66 S67	A60-G63 PolarHBondContact O-N 3.38Å; A61-G63 PolarHBondContact O-N 2.9Å; G63-G66 PolarHBondContact O-N 3.47Å; G63-S67 PolarHBondContact O-N 3.05Å; G63-S67 VanDerWaalsContact O-N 3.12Å; G63-S67 PolarHBondContact O-OG 3.41Å
64	L	55.9	Low	71	Confident	117 Å²	117	85.2 Å²	85.2	61%	0.613	53%	0.529	S	S	*	.	H	α-helix	trans	-69.4	-43.9	-179.7	-119.8	82.5	0	0	0	112	A61 G66 S67 L68	A61-L64 PolarHBondContact O-N 3.31Å; L64-G66 VanDerWaalsContact C-N 3.28Å; L64-G66 PolarHBondContact O-N 3.08Å; L64-S67 PolarHBondContact O-N 3.39Å; L64-S67 PolarHBondContact O-OG 2.91Å; L64-L68 WeakPolarHBondContact O-CB 3.41Å; L64-L68 WeakPolarHBondContact O-CD1 3.41Å; L64-L68 PolarHBondContact O-N 3.43Å
65	T	60.1	Low	70.8	Confident	102 Å²	102	82.6 Å²	82.6	63%	0.626	51%	0.514	S	S	*	.	H	α-helix	trans	-63.8	-37.5	177.7	-56.3	0	0	0	0	111.4	A61 G69	A61-T65 PolarHBondContact O-N 3.36Å; A61-T65 VanDerWaalsContact O-N 3.13Å; A61-T65 PolarHBondContact O-OG1 2.95Å; T65-G69 PolarHBondContact O-N 3.48Å
66	G	60.4	Low	70.6	Confident	46 Å²	46	78.6 Å²	78.6	47%	0.474	50%	0.501	S	S	.	.	H	α-helix	trans	-63.8	-43.6	175.6	0	0	0	0	0	113.1	S62 G63 L64 G69 A70	S62-G66 PolarHBondContact O-N 3.38Å; G63-G66 PolarHBondContact O-N 3.47Å; L64-G66 VanDerWaalsContact C-N 3.28Å; L64-G66 PolarHBondContact O-N 3.08Å; G66-G69 PolarHBondContact O-N 2.92Å; G66-A70 PolarHBondContact O-N 3.39Å
67	S	65.8	Low	70.4	Confident	58 Å²	58	81 Å²	81	41%	0.406	51%	0.509	S	S	.	.	H	α-helix	trans	-69.4	-40.7	179.4	64.1	0	0	0	0	112.5	G63 L64 G69 A70 I71	G63-S67 PolarHBondContact O-N 3.05Å; G63-S67 VanDerWaalsContact O-N 3.12Å; G63-S67 PolarHBondContact O-OG 3.41Å; L64-S67 PolarHBondContact O-N 3.39Å; L64-S67 PolarHBondContact O-OG 2.91Å; S67-G69 VanDerWaalsContact C-N 3.34Å; S67-G69 PolarHBondContact O-N 3.27Å; S67-A70 PolarHBondContact O-N 2.91Å; S67-I71 VanDerWaalsContact O-CG1 3.29Å; S67-I71 WeakPolarHBondContact O-CG1 3.45Å; S67-I71 PolarHBondContact O-N 2.92Å
68	L	73.3	Confident	70.3	Confident	99 Å²	99	81.8 Å²	81.8	52%	0.518	52%	0.519	S	S	.	.	H	α-helix	trans	-58.9	-44.2	173.3	-87	149	0	0	0	111.7	L64 A70 I71 W72	L64-L68 WeakPolarHBondContact O-CB 3.41Å; L64-L68 WeakPolarHBondContact O-CD1 3.41Å; L64-L68 PolarHBondContact O-N 3.43Å; L68-A70 PolarHBondContact O-N 3.49Å; L68-I71 PolarHBondContact O-N 3.5Å; L68-W72 PolarHBondContact O-N 3.35Å
69	G	72.1	Confident	70.4	Confident	42 Å²	42	78.1 Å²	78.1	43%	0.433	51%	0.513	S	S	.	.	H	α-helix	trans	-61.1	-42	175	0	0	0	0	0	112.9	T65 G66 S67 W72 A73	T65-G69 PolarHBondContact O-N 3.48Å; G66-G69 PolarHBondContact O-N 2.92Å; S67-G69 VanDerWaalsContact C-N 3.34Å; S67-G69 PolarHBondContact O-N 3.27Å; G69-W72 PolarHBondContact O-N 3.14Å; G69-A73 WeakPolarHBondContact O-CB 3.41Å; G69-A73 PolarHBondContact O-N 3.32Å
70	A	74.3	Confident	70.9	Confident	61 Å²	61	80.2 Å²	80.2	50%	0.504	52%	0.52	S	S	.	.	H	α-helix	trans	-65.1	-40.9	177.8	0	0	0	0	0	112.8	G66 S67 L68 A73 S74	G66-A70 PolarHBondContact O-N 3.39Å; S67-A70 PolarHBondContact O-N 2.91Å; L68-A70 PolarHBondContact O-N 3.49Å; A70-A73 PolarHBondContact O-N 3.49Å; A70-S74 PolarHBondContact O-N 3.5Å; A70-S74 PolarHBondContact O-OG 2.9Å
71	I	78.9	Confident	72	Confident	107 Å²	107	82.7 Å²	82.7	55%	0.549	51%	0.511	S	S	.	.	H	α-helix	trans	-65.4	-42.5	176.4	-64.8	164.1	0	0	0	110.6	S67 L68 S74 A75	S67-I71 VanDerWaalsContact O-CG1 3.29Å; S67-I71 WeakPolarHBondContact O-CG1 3.45Å; S67-I71 PolarHBondContact O-N 2.92Å; L68-I71 PolarHBondContact O-N 3.5Å; I71-S74 PolarHBondContact O-N 3.39Å; I71-S74 PolarHBondContact O-OG 3.06Å; I71-A75 WeakPolarHBondContact O-CB 3.47Å; I71-A75 PolarHBondContact O-N 3.36Å
72	W	79.2	Confident	73.1	Confident	155 Å²	155	82.5 Å²	82.5	59%	0.587	51%	0.51	S	S	*	.	H	α-helix	trans	-64.2	-41.3	177.3	-111.3	86.1	0	0	0	112.4	V14 L68 G69 S76	V14-W72 HydrophobicContact CG1-CZ3 4.39Å; V14-W72 HydrophobicContact CG2-CH2 4.38Å; V14-W72 HydrophobicContact CG2-CZ3 4.12Å; L68-W72 PolarHBondContact O-N 3.35Å; G69-W72 PolarHBondContact O-N 3.14Å; W72-S76 VanDerWaalsContact O-CB 3.27Å; W72-S76 WeakPolarHBondContact O-CB 3.38Å; W72-S76 PolarHBondContact O-N 3.31Å; W72-S76 PolarHBondContact O-OG 2.97Å
73	A	76.7	Confident	74.2	Confident	49 Å²	49	81.7 Å²	81.7	41%	0.405	50%	0.497	S	S	.	.	H	α-helix	trans	-62.9	-46	176.7	0	0	0	0	0	111.5	G69 A70 S76 I77	G69-A73 WeakPolarHBondContact O-CB 3.41Å; G69-A73 PolarHBondContact O-N 3.32Å; A70-A73 PolarHBondContact O-N 3.49Å; A73-S76 PolarHBondContact O-N 3.26Å; A73-I77 WeakPolarHBondContact O-CD1 3.3Å; A73-I77 VanDerWaalsContact O-CG1 3.24Å; A73-I77 WeakPolarHBondContact O-CG1 3.48Å; A73-I77 PolarHBondContact O-N 3.44Å
74	S	79.8	Confident	75.3	Confident	64 Å²	64	85.2 Å²	85.2	45%	0.448	50%	0.503	S	S	.	.	H	α-helix	trans	-66.9	-40.4	179.4	65	0	0	0	0	112.8	A70 I71 S76 I77 S78	A70-S74 PolarHBondContact O-N 3.5Å; A70-S74 PolarHBondContact O-OG 2.9Å; I71-S74 PolarHBondContact O-N 3.39Å; I71-S74 PolarHBondContact O-OG 3.06Å; S74-S76 VanDerWaalsContact C-N 3.35Å; S74-I77 PolarHBondContact O-N 3.01Å; S74-S78 WeakPolarHBondContact O-CB 3.3Å; S74-S78 PolarHBondContact O-N 3.41Å; S74-S78 PolarHBondContact O-OG 3.33Å
75	A	81.9	Confident	76.5	Confident	54 Å²	54	88.4 Å²	88.4	45%	0.446	51%	0.507	S	S	.	.	H	α-helix	trans	-62	-43	173.6	0	0	0	0	0	111.5	I71 S78 L79	I71-A75 WeakPolarHBondContact O-CB 3.47Å; I71-A75 PolarHBondContact O-N 3.36Å; A75-S78 PolarHBondContact O-N 3.45Å; A75-L79 WeakPolarHBondContact O-CB 3.29Å; A75-L79 PolarHBondContact O-N 3.47Å
76	S	81.3	Confident	76.8	Confident	46 Å²	46	87.1 Å²	87.1	32%	0.322	51%	0.507	S	S	.	.	H	α-helix	trans	-64.8	-45.2	179.4	-59.8	0	0	0	0	111.8	W72 A73 S74 S78 L79 L80	W72-S76 VanDerWaalsContact O-CB 3.27Å; W72-S76 WeakPolarHBondContact O-CB 3.38Å; W72-S76 PolarHBondContact O-N 3.31Å; W72-S76 PolarHBondContact O-OG 2.97Å; A73-S76 PolarHBondContact O-N 3.26Å; S74-S76 VanDerWaalsContact C-N 3.35Å; S76-S78 VanDerWaalsContact C-N 3.32Å; S76-S78 PolarHBondContact O-N 3.39Å; S76-L79 PolarHBondContact O-N 3.01Å; S76-L80 WeakPolarHBondContact O-CB 3.4Å; S76-L80 PolarHBondContact O-N 3.39Å
77	I	82.9	Confident	76.4	Confident	105 Å²	105	90.9 Å²	90.9	54%	0.538	53%	0.533	S	S	.	.	H	α-helix	trans	-60.6	-44	175.1	-68.8	163.5	0	0	0	110.4	A73 S74 L79 L80 W81	A73-I77 WeakPolarHBondContact O-CD1 3.3Å; A73-I77 VanDerWaalsContact O-CG1 3.24Å; A73-I77 WeakPolarHBondContact O-CG1 3.48Å; A73-I77 PolarHBondContact O-N 3.44Å; S74-I77 PolarHBondContact O-N 3.01Å; I77-L79 PolarHBondContact O-N 2.95Å; I77-L80 PolarHBondContact O-N 3.1Å; I77-W81 WeakPolarHBondContact O-CB 3.43Å; I77-W81 PolarHBondContact O-N 2.9Å
78	S	79.8	Confident	76.9	Confident	76 Å²	76	92.5 Å²	92.5	53%	0.531	54%	0.54	S	S	.	.	H	α-helix	trans	-63.9	-41.5	179.4	-57.9	0	0	0	0	111.9	S74 A75 S76 W81 A82	S74-S78 WeakPolarHBondContact O-CB 3.3Å; S74-S78 PolarHBondContact O-N 3.41Å; S74-S78 PolarHBondContact O-OG 3.33Å; A75-S78 PolarHBondContact O-N 3.45Å; S76-S78 VanDerWaalsContact C-N 3.32Å; S76-S78 PolarHBondContact O-N 3.39Å; S78-W81 PolarHBondContact O-N 3.4Å; S78-A82 WeakPolarHBondContact O-CB 3.45Å; S78-A82 PolarHBondContact O-N 3.41Å
79	L	81.3	Confident	77.1	Confident	113 Å²	113	92.2 Å²	92.2	59%	0.592	54%	0.541	S	S	*	.	H	α-helix	trans	-68	-42.8	177.8	-166.3	120.8	0	0	0	111.8	A75 S76 I77 W81 A82 L83	A75-L79 WeakPolarHBondContact O-CB 3.29Å; A75-L79 PolarHBondContact O-N 3.47Å; S76-L79 PolarHBondContact O-N 3.01Å; I77-L79 PolarHBondContact O-N 2.95Å; L79-W81 VanDerWaalsContact C-N 3.34Å; L79-W81 PolarHBondContact O-N 2.97Å; L79-A82 PolarHBondContact O-N 3.35Å; L79-L83 HydrophobicContact CD2-CD1 3.76Å; L79-L83 HydrophobicContact CG-CD1 4.42Å; L79-L83 WeakPolarHBondContact O-CB 3.43Å; L79-L83 VanDerWaalsContact O-CG 3.3Å; L79-L83 WeakPolarHBondContact O-CG 3.35Å; L79-L83 PolarHBondContact O-N 3.5Å
80	L	80.6	Confident	77.4	Confident	93 Å²	93	94.9 Å²	94.9	49%	0.487	55%	0.547	S	S	.	.	H	α-helix	trans	-58	-46.3	171.9	-103.7	141	0	0	0	111.3	S76 I77 A82 L83 L84	S76-L80 WeakPolarHBondContact O-CB 3.4Å; S76-L80 PolarHBondContact O-N 3.39Å; I77-L80 PolarHBondContact O-N 3.1Å; L80-A82 PolarHBondContact O-N 3.32Å; L80-L83 PolarHBondContact O-N 3.32Å; L80-L84 WeakPolarHBondContact O-CB 3.47Å; L80-L84 VanDerWaalsContact O-CG 3.29Å; L80-L84 WeakPolarHBondContact O-CG 3.4Å; L80-L84 PolarHBondContact O-N 3.38Å
81	W	79.9	Confident	77.6	Confident	138 Å²	138	96.9 Å²	96.9	52%	0.523	55%	0.549	S	S	.	.	H	α-helix	trans	-60.7	-43.2	176.2	-115.1	101.3	0	0	0	112.3	I77 S78 L79 L84 R85	I77-W81 WeakPolarHBondContact O-CB 3.43Å; I77-W81 PolarHBondContact O-N 2.9Å; S78-W81 PolarHBondContact O-N 3.4Å; L79-W81 VanDerWaalsContact C-N 3.34Å; L79-W81 PolarHBondContact O-N 2.97Å; W81-L84 PolarHBondContact O-N 3.16Å; W81-R85 HydrophobicContact CE3-CG 3.89Å; W81-R85 HydrophobicContact CZ3-CG 3.98Å; W81-R85 WeakPolarHBondContact O-CG 3.44Å; W81-R85 PolarHBondContact O-N 3.3Å; W81-R85 VanDerWaalsContact O-N 3.14Å
82	A	80.2	Confident	77.5	Confident	59 Å²	59	96.3 Å²	96.3	49%	0.488	55%	0.549	S	S	.	.	H	α-helix	trans	-64.8	-42	177.5	0	0	0	0	0	111.9	S78 L79 L80 R85 A86	S78-A82 WeakPolarHBondContact O-CB 3.45Å; S78-A82 PolarHBondContact O-N 3.41Å; L79-A82 PolarHBondContact O-N 3.35Å; L80-A82 PolarHBondContact O-N 3.32Å; A82-R85 PolarHBondContact O-N 3.31Å; A82-A86 WeakPolarHBondContact O-CB 3.36Å; A82-A86 PolarHBondContact O-N 3.02Å; A82-A86 VanDerWaalsContact O-N 3.1Å
83	L	77.8	Confident	77.4	Confident	81 Å²	81	92.4 Å²	92.4	42%	0.424	55%	0.547	S	S	.	.	H	α-helix	trans	-65.3	-38.7	177.2	-73.3	171.8	0	0	0	112.5	L79 L80 R85 A86 A87	L79-L83 HydrophobicContact CD2-CD1 3.76Å; L79-L83 HydrophobicContact CG-CD1 4.42Å; L79-L83 WeakPolarHBondContact O-CB 3.43Å; L79-L83 VanDerWaalsContact O-CG 3.3Å; L79-L83 WeakPolarHBondContact O-CG 3.35Å; L79-L83 PolarHBondContact O-N 3.5Å; L80-L83 PolarHBondContact O-N 3.32Å; L83-R85 VanDerWaalsContact C-N 3.34Å; L83-A86 PolarHBondContact O-N 3.18Å; L83-A87 PolarHBondContact O-N 2.96Å
84	L	79.7	Confident	77.4	Confident	125 Å²	125	95.5 Å²	95.5	65%	0.654	56%	0.557	S	S	*	*	H	α-helix	trans	-68.7	-29.9	176.3	-72.4	169.7	0	0	0	112.8	L80 W81	L80-L84 WeakPolarHBondContact O-CB 3.47Å; L80-L84 VanDerWaalsContact O-CG 3.29Å; L80-L84 WeakPolarHBondContact O-CG 3.4Å; L80-L84 PolarHBondContact O-N 3.38Å; W81-L84 PolarHBondContact O-N 3.16Å
85	R	80.7	Confident	77.3	Confident	183 Å²	183	97.9 Å²	97.9	69%	0.691	57%	0.565	S	S	*	*	H	α-helix	trans	-79.5	-24.7	174.4	-69.2	-173.5	-155	-110	4.9	113.7	W81 A82 L83	W81-R85 HydrophobicContact CE3-CG 3.89Å; W81-R85 HydrophobicContact CZ3-CG 3.98Å; W81-R85 WeakPolarHBondContact O-CG 3.44Å; W81-R85 PolarHBondContact O-N 3.3Å; W81-R85 VanDerWaalsContact O-N 3.14Å; A82-R85 PolarHBondContact O-N 3.31Å; L83-R85 VanDerWaalsContact C-N 3.34Å
86	A	67.4	Low	76.9	Confident	76 Å²	76	101.6 Å²	101.6	63%	0.628	58%	0.575	S	S	*	*			trans	-94.6	1.3	-177.1	0	0	0	0	0	113.7	A82 L83	A82-A86 WeakPolarHBondContact O-CB 3.36Å; A82-A86 PolarHBondContact O-N 3.02Å; A82-A86 VanDerWaalsContact O-N 3.1Å; L83-A86 PolarHBondContact O-N 3.18Å
87	A	50.9	Low	76.5	Confident	124 Å²	124	106.6 Å²	106.6	100%	1.025	60%	0.598	S	S	*	*			trans	-104.7	0	173.8	0	0	0	0	0	109.8	L83	L83-A87 PolarHBondContact O-N 2.96Å

Retrieved 87 of 87 residues in 43.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).