A0A087WRZ2_MOUSE Loading...

Lymphocyte antigen 6 family member E

AlphaFold DB , UniProt , Accession A0A087WRZ2, Species MOUSE (Mus musculus, Mouse), Gene Ly6e, Length 117 aa.

						>A0A087WRZ2_MOUSE|A0A087WRZ2|Ly6e
MAWTVRLLWLANLQQMSATSNMRVFLPVLLAALLGMEQVHSLMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.9	Very low	45.5	Very low	211 Å²	211	131.3 Å²	131.3	100%	1.039	66%	0.656	S	S	*	*				0	-24.3	0	-141.4	165.8	-94.1	0	0	113.5	T4	M1-T4 PolarHBondContact O-OG1 3.46Å
2	A	40.7	Very low	45.7	Very low	72 Å²	72	127.9 Å²	127.9	60%	0.595	64%	0.642	S	S	*	*	H	α-helix	trans	-75	-24.2	177.3	0	0	0	0	0	115.6	R6	A2-R6 PolarHBondContact O-N 3.01Å
3	W	35	Very low	46	Very low	212 Å²	212	127 Å²	127	80%	0.803	64%	0.639	S	S	*	*	H	α-helix	trans	-73	-33.4	-177.2	-74	80.4	0	0	0	113.6	V5 R6 L7	W3-V5 VanDerWaalsContact C-N 3.33Å; W3-R6 PolarHBondContact O-N 3.11Å; W3-L7 PolarHBondContact O-N 3Å
4	T	40	Very low	46.1	Very low	88 Å²	88	129.7 Å²	129.7	54%	0.54	65%	0.649	S	S	.	*	H	α-helix	trans	-68.4	-34.6	176.7	43.6	0	0	0	0	111.6	M1 L7 L8	M1-T4 PolarHBondContact O-OG1 3.46Å; T4-L7 PolarHBondContact O-N 3.39Å; T4-L8 WeakPolarHBondContact O-CD1 3.4Å; T4-L8 PolarHBondContact O-N 3.4Å; T4-L8 VanDerWaalsContact O-N 3.11Å
5	V	51.6	Low	46.1	Very low	87 Å²	87	131.7 Å²	131.7	53%	0.527	66%	0.655	S	S	.	*	H	α-helix	trans	-67.3	-38.8	176.6	-174.2	0	0	0	0	111.3	W3 L8 W9	W3-V5 VanDerWaalsContact C-N 3.33Å; V5-L8 PolarHBondContact O-N 3.43Å; V5-W9 WeakPolarHBondContact O-CB 3.46Å; V5-W9 PolarHBondContact O-N 3.44Å
6	R	50.4	Low	45.9	Very low	189 Å²	189	132.8 Å²	132.8	71%	0.713	66%	0.66	S	S	*	*	H	α-helix	trans	-62.2	-41.1	175.4	-90.6	-177.9	173.2	-114.5	0.9	113.3	A2 W3 W9 L10	A2-R6 PolarHBondContact O-N 3.01Å; W3-R6 PolarHBondContact O-N 3.11Å; R6-W9 PolarHBondContact O-N 3Å; R6-L10 WeakPolarHBondContact O-CG 3.31Å; R6-L10 PolarHBondContact O-N 3.34Å
7	L	46.2	Very low	46.2	Very low	120 Å²	120	131.9 Å²	131.9	63%	0.628	67%	0.67	S	S	*	*	H	α-helix	trans	-71	-39.1	178.1	-82.1	150.6	0	0	0	112.3	W3 T4 W9 L10 A11	W3-L7 PolarHBondContact O-N 3Å; T4-L7 PolarHBondContact O-N 3.39Å; L7-W9 VanDerWaalsContact C-N 3.27Å; L7-W9 PolarHBondContact O-N 3.22Å; L7-L10 PolarHBondContact O-N 3.05Å; L7-A11 WeakPolarHBondContact O-CB 3.48Å; L7-A11 PolarHBondContact O-N 3.4Å
8	L	48.6	Very low	46.6	Very low	114 Å²	114	128.6 Å²	128.6	60%	0.597	67%	0.666	S	S	*	*	H	α-helix	trans	-63.6	-32.4	172.5	-83.2	154.9	0	0	0	112.5	T4 V5 N12	T4-L8 WeakPolarHBondContact O-CD1 3.4Å; T4-L8 PolarHBondContact O-N 3.4Å; T4-L8 VanDerWaalsContact O-N 3.11Å; V5-L8 PolarHBondContact O-N 3.43Å; L8-N12 PolarHBondContact O-N 3.21Å; L8-N12 PolarHBondContact O-ND2 2.94Å
9	W	47.5	Very low	46.8	Very low	173 Å²	173	128.3 Å²	128.3	66%	0.655	67%	0.671	S	S	*	*	H	α-helix	trans	-71.5	-44.7	174.5	-118.2	82.7	0	0	0	112.7	V5 R6 L7 A11 N12 L13	V5-W9 WeakPolarHBondContact O-CB 3.46Å; V5-W9 PolarHBondContact O-N 3.44Å; R6-W9 PolarHBondContact O-N 3Å; L7-W9 VanDerWaalsContact C-N 3.27Å; L7-W9 PolarHBondContact O-N 3.22Å; W9-A11 PolarHBondContact O-N 3.26Å; W9-N12 PolarHBondContact O-N 3.4Å; W9-L13 HydrophobicContact CE3-CD1 4.46Å; W9-L13 HydrophobicContact CZ3-CD1 4.25Å; W9-L13 PolarHBondContact O-N 3.2Å
10	L	48.5	Very low	47.2	Very low	116 Å²	116	127 Å²	127	61%	0.607	67%	0.672	S	S	*	*	H	α-helix	trans	-63.4	-40.2	176.2	-74.7	163.4	0	0	0	111.9	R6 L7 N12 L13	R6-L10 WeakPolarHBondContact O-CG 3.31Å; R6-L10 PolarHBondContact O-N 3.34Å; L7-L10 PolarHBondContact O-N 3.05Å; L10-N12 VanDerWaalsContact C-N 3.34Å; L10-N12 PolarHBondContact O-N 3.32Å; L10-L13 PolarHBondContact O-N 3.48Å
11	A	48.2	Very low	47.8	Very low	62 Å²	62	126 Å²	126	51%	0.512	67%	0.668	S	S	.	*	H	α-helix	trans	-66.7	-32.8	177.1	0	0	0	0	0	113	L7 W9	L7-A11 WeakPolarHBondContact O-CB 3.48Å; L7-A11 PolarHBondContact O-N 3.4Å; W9-A11 PolarHBondContact O-N 3.26Å
12	N	48.2	Very low	48.5	Very low	91 Å²	91	124.1 Å²	124.1	49%	0.487	66%	0.658	S	S	.	*	H	α-helix	trans	-75.1	-24.4	175.9	-91.9	-77.4	0	0	0	113.5	L8 W9 L10 Q14 Q15 M16	L8-N12 PolarHBondContact O-N 3.21Å; L8-N12 PolarHBondContact O-ND2 2.94Å; W9-N12 PolarHBondContact O-N 3.4Å; L10-N12 VanDerWaalsContact C-N 3.34Å; L10-N12 PolarHBondContact O-N 3.32Å; N12-Q14 VanDerWaalsContact C-N 3.25Å; N12-Q14 PolarHBondContact O-N 3.31Å; N12-Q15 PolarHBondContact O-N 3.49Å; N12-M16 WeakPolarHBondContact O-CG 3.36Å
13	L	48.5	Very low	49.4	Very low	116 Å²	116	131.8 Å²	131.8	61%	0.607	67%	0.672	S	S	*	*	H	α-helix	trans	-66.7	-27.4	179.9	-143.4	80.1	0	0	0	112.6	W9 L10	W9-L13 HydrophobicContact CE3-CD1 4.46Å; W9-L13 HydrophobicContact CZ3-CD1 4.25Å; W9-L13 PolarHBondContact O-N 3.2Å; L10-L13 PolarHBondContact O-N 3.48Å
14	Q	47.8	Very low	50.8	Low	165 Å²	165	125.7 Å²	125.7	77%	0.771	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.6	-15.2	178.6	-68.4	-177.4	-100.8	0	0	113.7	N12	N12-Q14 VanDerWaalsContact C-N 3.25Å; N12-Q14 PolarHBondContact O-N 3.31Å
15	Q	45.6	Very low	52	Low	159 Å²	159	127.2 Å²	127.2	74%	0.743	66%	0.657	S	S	*	*	T	Hydrogen-bonded Turn	trans	-97.8	-14.6	-175.8	-153.1	74.4	42.9	0	0	113.8	N12 S17	N12-Q15 PolarHBondContact O-N 3.49Å; Q15-S17 PolarHBondContact O-N 3.26Å
16	M	44.2	Very low	52.9	Low	150 Å²	150	128.8 Å²	128.8	74%	0.739	66%	0.662	S	S	*	*			trans	-92.2	15.4	-171.5	-62.2	176.8	110.3	0	0	114.5	N12 A18	N12-M16 WeakPolarHBondContact O-CG 3.36Å; M16-A18 PolarHBondContact O-N 3.33Å
17	S	49.5	Very low	53.9	Low	117 Å²	117	123.3 Å²	123.3	82%	0.818	65%	0.651	S	S	*	*			trans	-80.1	10.3	-179.9	67.1	0	0	0	0	114.9	Q15	Q15-S17 PolarHBondContact O-N 3.26Å
18	A	55	Low	55.3	Low	73 Å²	73	121.9 Å²	121.9	60%	0.603	65%	0.647	S	S	*	*	S	Bend	trans	-121.3	126.3	179.4	0	0	0	0	0	112.4	M16	M16-A18 PolarHBondContact O-N 3.33Å
19	T	49.3	Very low	56.6	Low	123 Å²	123	121.4 Å²	121.4	76%	0.755	64%	0.644	S	S	*	*			trans	91.1	88.4	174.6	74.5	0	0	0	0	116.1	N21	T19-N21 PolarHBondContact O-N 3.43Å
20	S	56.1	Low	57.9	Low	101 Å²	101	117.7 Å²	117.7	71%	0.706	64%	0.637	S	S	*	*			trans	-72.7	102.6	172.8	-178.2	0	0	0	0	110.9
21	N	58.6	Low	59.2	Low	107 Å²	107	115 Å²	115	57%	0.572	63%	0.632	S	S	*	*			trans	-108.8	98.3	162.3	-83.5	-56.1	0	0	0	108.9	T19 R23 V24 F25	T19-N21 PolarHBondContact O-N 3.43Å; N21-R23 PolarHBondContact O-N 2.8Å; N21-V24 HydrophobicContact CB-CG2 4.27Å; N21-V24 PolarHBondContact O-N 3.37Å; N21-F25 VanDerWaalsContact O-CD2 3.23Å; N21-F25 WeakPolarHBondContact O-CD2 3.39Å
22	M	58.4	Low	60.5	Low	171 Å²	171	113.9 Å²	113.9	84%	0.842	62%	0.622	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.8	-15.9	-172.4	-152.2	176.5	-165.1	0	0	115.1
23	R	60.6	Low	61.6	Low	233 Å²	233	114.9 Å²	114.9	88%	0.879	63%	0.627	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.8	-19.5	-179.1	-64.7	-177	169.6	-170.6	-3.9	114.4	N21 P27	N21-R23 PolarHBondContact O-N 2.8Å; R23-P27 WeakPolarHBondContact O-CD 3.44Å
24	V	63.8	Low	62.7	Low	84 Å²	84	116.3 Å²	116.3	51%	0.509	64%	0.635	S	S	.	*	T	Hydrogen-bonded Turn	trans	-99.5	-22.9	-174.4	-169.2	0	0	0	0	111.8	N21 L26 P27 V28	N21-V24 HydrophobicContact CB-CG2 4.27Å; N21-V24 PolarHBondContact O-N 3.37Å; V24-L26 PolarHBondContact O-N 2.92Å; V24-P27 VanDerWaalsContact O-CD 3.26Å; V24-P27 WeakPolarHBondContact O-CD 3.47Å; V24-P27 VanDerWaalsContact O-CG 3.31Å; V24-P27 WeakPolarHBondContact O-CG 3.18Å; V24-V28 HydrophobicContact CG1-CG2 3.98Å; V24-V28 WeakPolarHBondContact O-CB 3.27Å; V24-V28 WeakPolarHBondContact O-CG2 3.26Å; V24-V28 PolarHBondContact O-N 3.45Å
25	F	64.6	Low	63.7	Low	121 Å²	121	111.5 Å²	111.5	53%	0.531	63%	0.629	S	S	.	*	H	α-helix	trans	-63.4	-40.1	179.4	-71.8	-79.6	0	0	0	113.4	N21 V28 L29	N21-F25 VanDerWaalsContact O-CD2 3.23Å; N21-F25 WeakPolarHBondContact O-CD2 3.39Å; F25-V28 PolarHBondContact O-N 2.94Å; F25-L29 VanDerWaalsContact O-CB 3.22Å; F25-L29 WeakPolarHBondContact O-CB 3.41Å; F25-L29 PolarHBondContact O-N 3.02Å
26	L	72	Confident	64.6	Low	119 Å²	119	109.8 Å²	109.8	62%	0.623	62%	0.623	S	S	*	*	H	α-helix	trans	-64.5	-50.3	-177.8	-161.9	75.5	0	0	0	112.7	V24 V28 L29 L30	V24-L26 PolarHBondContact O-N 2.92Å; L26-V28 VanDerWaalsContact C-N 3.34Å; L26-V28 PolarHBondContact O-N 3.3Å; L26-L29 PolarHBondContact O-N 3.45Å; L26-L30 PolarHBondContact O-N 3.34Å
27	P	71.1	Confident	65.1	Low	74 Å²	74	111.1 Å²	111.1	48%	0.481	63%	0.627	S	S	.	*	H	α-helix	trans	-66.9	-33.7	176.2	23.6	-32.4	0	0	0	112.8	R23 V24 L30 A31	R23-P27 WeakPolarHBondContact O-CD 3.44Å; V24-P27 VanDerWaalsContact O-CD 3.26Å; V24-P27 WeakPolarHBondContact O-CD 3.47Å; V24-P27 VanDerWaalsContact O-CG 3.31Å; V24-P27 WeakPolarHBondContact O-CG 3.18Å; P27-L30 PolarHBondContact O-N 2.94Å; P27-A31 WeakPolarHBondContact O-CB 3.48Å; P27-A31 PolarHBondContact O-N 3.41Å
28	V	76.3	Confident	65.4	Low	90 Å²	90	113.9 Å²	113.9	55%	0.545	63%	0.627	S	S	.	*	H	α-helix	trans	-66.1	-41.5	175.4	170.5	0	0	0	0	111.5	V24 F25 L26 A31 A32	V24-V28 HydrophobicContact CG1-CG2 3.98Å; V24-V28 WeakPolarHBondContact O-CB 3.27Å; V24-V28 WeakPolarHBondContact O-CG2 3.26Å; V24-V28 PolarHBondContact O-N 3.45Å; F25-V28 PolarHBondContact O-N 2.94Å; L26-V28 VanDerWaalsContact C-N 3.34Å; L26-V28 PolarHBondContact O-N 3.3Å; V28-A31 PolarHBondContact O-N 2.93Å; V28-A32 WeakPolarHBondContact O-CB 3.38Å; V28-A32 PolarHBondContact O-N 3.46Å
29	L	74.8	Confident	65.6	Low	104 Å²	104	114.6 Å²	114.6	55%	0.545	62%	0.624	S	S	.	*	H	α-helix	trans	-67.1	-40.3	176.7	-173.8	67.1	0	0	0	111.8	F25 L26 A32 L33	F25-L29 VanDerWaalsContact O-CB 3.22Å; F25-L29 WeakPolarHBondContact O-CB 3.41Å; F25-L29 PolarHBondContact O-N 3.02Å; L26-L29 PolarHBondContact O-N 3.45Å; L29-A32 PolarHBondContact O-N 3Å; L29-L33 HydrophobicContact CG-CD1 4.44Å; L29-L33 WeakPolarHBondContact O-CG 3.38Å; L29-L33 PolarHBondContact O-N 2.85Å
30	L	74.7	Confident	66.5	Low	95 Å²	95	116.6 Å²	116.6	50%	0.497	62%	0.624	S	S	.	*	H	α-helix	trans	-61.9	-45.5	173.6	-110.2	72.1	0	0	0	111.6	L26 P27 A32 L33 L34	L26-L30 PolarHBondContact O-N 3.34Å; P27-L30 PolarHBondContact O-N 2.94Å; L30-A32 VanDerWaalsContact C-N 3.31Å; L30-A32 PolarHBondContact O-N 3.39Å; L30-L33 PolarHBondContact O-N 3.48Å; L30-L34 WeakPolarHBondContact O-CB 3.45Å; L30-L34 VanDerWaalsContact O-CG 3.27Å; L30-L34 WeakPolarHBondContact O-CG 3.23Å; L30-L34 PolarHBondContact O-N 3.18Å
31	A	76.8	Confident	67.6	Low	61 Å²	61	113.7 Å²	113.7	50%	0.504	60%	0.604	S	S	.	*	H	α-helix	trans	-63.1	-37.9	177.2	0	0	0	0	0	111.9	P27 V28 G35	P27-A31 WeakPolarHBondContact O-CB 3.48Å; P27-A31 PolarHBondContact O-N 3.41Å; V28-A31 PolarHBondContact O-N 2.93Å; A31-G35 PolarHBondContact O-N 3.43Å
32	A	74.7	Confident	69.1	Low	37 Å²	37	110 Å²	110	31%	0.306	58%	0.584	S	S	.	*	H	α-helix	trans	-63.9	-44.4	175	0	0	0	0	0	112	V28 L29 L30 G35 M36	V28-A32 WeakPolarHBondContact O-CB 3.38Å; V28-A32 PolarHBondContact O-N 3.46Å; L29-A32 PolarHBondContact O-N 3Å; L30-A32 VanDerWaalsContact C-N 3.31Å; L30-A32 PolarHBondContact O-N 3.39Å; A32-G35 PolarHBondContact O-N 3.02Å; A32-M36 WeakPolarHBondContact O-CE 3.46Å; A32-M36 WeakPolarHBondContact O-CG 3.06Å
33	L	72.2	Confident	70.8	Confident	112 Å²	112	106.7 Å²	106.7	59%	0.586	57%	0.567	S	S	*	*	H	α-helix	trans	-67.8	-37.9	178.3	-73	166.9	0	0	0	112.8	L29 L30 G35 M36	L29-L33 HydrophobicContact CG-CD1 4.44Å; L29-L33 WeakPolarHBondContact O-CG 3.38Å; L29-L33 PolarHBondContact O-N 2.85Å; L30-L33 PolarHBondContact O-N 3.48Å; L33-G35 VanDerWaalsContact C-N 3.32Å; L33-M36 WeakPolarHBondContact O-CB 3.46Å; L33-M36 WeakPolarHBondContact O-CG 3.22Å; L33-M36 PolarHBondContact O-N 3.44Å
34	L	71.8	Confident	72.4	Confident	147 Å²	147	95.7 Å²	95.7	77%	0.77	53%	0.527	S	S	*	.	H	α-helix	trans	-74.9	-22.4	176.8	-68	169.5	0	0	0	112.8	L30 M36	L30-L34 WeakPolarHBondContact O-CB 3.45Å; L30-L34 VanDerWaalsContact O-CG 3.27Å; L30-L34 WeakPolarHBondContact O-CG 3.23Å; L30-L34 PolarHBondContact O-N 3.18Å; L34-M36 VanDerWaalsContact C-N 3.27Å
35	G	68.4	Low	73.9	Confident	64 Å²	64	95 Å²	95	66%	0.66	52%	0.516	S	S	*	.	T	Hydrogen-bonded Turn	trans	-81.8	-0.2	174.8	0	0	0	0	0	114.3	A31 A32 L33 E37	A31-G35 PolarHBondContact O-N 3.43Å; A32-G35 PolarHBondContact O-N 3.02Å; L33-G35 VanDerWaalsContact C-N 3.32Å; G35-E37 PolarHBondContact O-N 2.85Å
36	M	62.8	Low	75.4	Confident	123 Å²	123	91.1 Å²	91.1	61%	0.606	51%	0.505	S	S	*	.	S	Bend	trans	-79.4	102	172.2	-52.6	-79.4	154.5	0	0	107.7	A32 L33 L34 Q38	A32-M36 WeakPolarHBondContact O-CE 3.46Å; A32-M36 WeakPolarHBondContact O-CG 3.06Å; L33-M36 WeakPolarHBondContact O-CB 3.46Å; L33-M36 WeakPolarHBondContact O-CG 3.22Å; L33-M36 PolarHBondContact O-N 3.44Å; L34-M36 VanDerWaalsContact C-N 3.27Å; M36-Q38 PolarHBondContact O-N 3.42Å
37	E	55.4	Low	76.5	Confident	178 Å²	178	86 Å²	86	83%	0.832	48%	0.479	S	S	*	.			trans	-62.2	111.8	169.1	-165.2	137.4	69.6	0	0	107.9	G35 V39	G35-E37 PolarHBondContact O-N 2.85Å; E37-V39 VanDerWaalsContact C-N 3.28Å; E37-V39 PolarHBondContact O-N 3.45Å
38	Q	56	Low	77.7	Confident	174 Å²	174	86.9 Å²	86.9	81%	0.813	48%	0.483	S	S	*	.			trans	-71.1	90.9	173	-75.3	-178.4	43.5	0	0	107.4	M36 H40	M36-Q38 PolarHBondContact O-N 3.42Å; Q38-H40 PolarHBondContact O-N 2.65Å
39	V	60.1	Low	78.5	Confident	88 Å²	88	87.8 Å²	87.8	53%	0.533	49%	0.485	S	S	.	.			trans	-71.5	85.7	166	-171	0	0	0	0	106.4	E37 S41 E64	E37-V39 VanDerWaalsContact C-N 3.28Å; E37-V39 PolarHBondContact O-N 3.45Å; V39-S41 PolarHBondContact O-N 3.17Å; V39-E64 HydrophobicContact CG1-CG 3.95Å; V39-E64 WeakPolarHBondContact CG1-OE1 3.45Å
40	H	67.7	Low	79.6	Confident	166 Å²	166	85.7 Å²	85.7	77%	0.769	47%	0.472	S	S	*	.			trans	-69.3	107.1	173.8	-151.3	80.3	0	0	0	107.1	Q38 L42	Q38-H40 PolarHBondContact O-N 2.65Å; H40-L42 PolarHBondContact O-N 3.18Å
41	S	79.3	Confident	80.5	Confident	39 Å²	39	88.5 Å²	88.5	27%	0.273	48%	0.48	S	S	.	.			trans	-68	130	173.5	-167.6	0	0	0	0	108.7	V39 M43 S61 C62	V39-S41 PolarHBondContact O-N 3.17Å; S41-M43 PolarHBondContact O-N 3.04Å; S41-S61 WeakPolarHBondContact CB-OG 3.38Å; S41-S61 PolarHBondContact OG-OG 3.34Å; S41-C62 PolarHBondContact OG-O 3.08Å
42	L	90.6	Very high	81.1	Confident	31 Å²	31	90.1 Å²	90.1	16%	0.162	48%	0.481	C	S	.	.			trans	-59.6	132.3	173.2	177.7	65.7	0	0	0	108.8	H40 C62 Q115	H40-L42 PolarHBondContact O-N 3.18Å; L42-C62 HydrophobicContact CB-CB 4.14Å; L42-C62 VanDerWaalsContact O-CB 3.23Å; L42-C62 WeakPolarHBondContact O-CB 3.12Å; L42-C62 PolarHBondContact O-N 2.92Å; L42-C62 PolarHBondContact O-SG 2.87Å; L42-Q115 VanDerWaalsContact CD1-O 3.24Å; L42-Q115 WeakPolarHBondContact CD1-O 3.45Å
43	M	93.2	Very high	81.8	Confident	100 Å²	100	92.2 Å²	92.2	49%	0.493	49%	0.486	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.8	133.2	172.9	-70.3	-68.8	-134.6	0	0	108.9	S41 V60 S61 S117	S41-M43 PolarHBondContact O-N 3.04Å; M43-V60 WeakPolarHBondContact CA-O 3.3Å; M43-S61 WeakPolarHBondContact SD-CA 3.25Å; M43-S117 WeakPolarHBondContact O-CB 3.04Å
44	C	95.1	Very high	82.8	Confident	3 Å²	3	92.4 Å²	92.4	2%	0.02	49%	0.487	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.2	161.2	178.4	-62.9	0	0	0	0	111.1	P59 V60 C62 C69	C44-P59 CarbonylContact O-C 3.55Å; C44-P59 WeakPolarHBondContact O-CA 3.35Å; C44-V60 PolarHBondContact N-O 3.29Å; C44-V60 WeakPolarHBondContact O-CG2 3.36Å; C44-V60 PolarHBondContact O-N 3.28Å; C44-C62 PolarHBondContact SG-SG 2.86Å; C44-C69 VanDerWaalsContact CA-SG 3.56Å; C44-C69 HydrophobicContact CB-CB 3.76Å; C44-C69 WeakPolarHBondContact CB-SG 3.4Å; C44-C69 WeakPolarHBondContact SG-CA 3.41Å; C44-C69 WeakPolarHBondContact SG-CB 3.04Å; C44-C69 CovalentContact SG-SG 2.02Å; C44-C69 PolarHBondContact SG-SG 2.79Å
45	F	95.2	Very high	83.8	Confident	68 Å²	68	89.5 Å²	89.5	30%	0.298	47%	0.472	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.9	141.1	165.4	-75.1	-55.6	0	0	0	111.2	C56 L57 W58 K89 G90	F45-C56 VanDerWaalsContact CB-O 3.28Å; F45-C56 WeakPolarHBondContact CB-O 3.31Å; F45-L57 VanDerWaalsContact CD1-CA 3.49Å; F45-L57 HydrophobicContact CD1-CB 4.44Å; F45-L57 HydrophobicContact CD1-CD2 4.44Å; F45-L57 HydrophobicContact CE1-CB 4.25Å; F45-L57 HydrophobicContact CE1-CD2 4.12Å; F45-L57 WeakPolarHBondContact CE1-O 3.42Å; F45-L57 HydrophobicContact CE2-CD2 4.34Å; F45-L57 HydrophobicContact CZ-CD2 4.06Å; F45-W58 CarbonylContact C-O 3.5Å; F45-W58 WeakPolarHBondContact CA-O 3.42Å; F45-K89 HydrophobicContact CB-CD 4.06Å; F45-K89 CarbonylContact O-C 3.55Å; F45-K89 WeakPolarHBondContact O-CB 3.23Å; F45-G90 PolarHBondContact O-N 2.79Å
46	S	94.5	Very high	85.1	Confident	40 Å²	40	86.5 Å²	86.5	28%	0.28	44%	0.441	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.6	138.2	-177.1	-175.4	0	0	0	0	112.6	W58 K89	S46-W58 PolarHBondContact N-O 3.11Å; S46-K89 WeakPolarHBondContact CA-O 3.33Å
47	C	96.1	Very high	86.6	Confident	13 Å²	13	84.6 Å²	84.6	9%	0.088	43%	0.433	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-167.3	160	168.2	62.4	0	0	0	0	111.2	Q50 C56 N88 K89	C47-Q50 HydrophobicContact CB-CB 4.49Å; C47-Q50 HydrophobicContact CB-CG 3.71Å; C47-C56 HydrophobicContact CB-CB 3.64Å; C47-C56 WeakPolarHBondContact CB-SG 3.23Å; C47-C56 WeakPolarHBondContact SG-CB 3.22Å; C47-C56 CovalentContact SG-SG 2.02Å; C47-C56 PolarHBondContact SG-SG 3.33Å; C47-N88 VanDerWaalsContact O-CA 3.31Å; C47-N88 WeakPolarHBondContact O-CA 3.41Å; C47-K89 PolarHBondContact N-O 2.71Å; C47-K89 PolarHBondContact O-N 2.85Å
48	T	95.8	Very high	88.4	Confident	91 Å²	91	85.3 Å²	85.3	56%	0.558	43%	0.428	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-129.4	135.1	174.1	-51.9	0	0	0	0	108.9	Q50	T48-Q50 VanDerWaalsContact C-N 3.28Å; T48-Q50 PolarHBondContact O-N 3.45Å; T48-Q50 PolarHBondContact O-NE2 3.09Å; T48-Q50 VanDerWaalsContact O-NE2 3.09Å
49	D	94.4	Very high	90.2	Very high	109 Å²	109	81.2 Å²	81.2	58%	0.583	42%	0.416	S	S	*	.	E	Extended strand (participates in β ladder)	trans	53.7	39.5	171.3	-57.1	-32.2	0	0	0	114.8	T86 N88	D49-T86 HydrophobicContact CB-CG2 4.05Å; D49-T86 WeakPolarHBondContact OD1-CG2 3.01Å; D49-N88 PolarHBondContact N-OD1 2.76Å; D49-N88 PolarHBondContact OD1-ND2 2.03Å; D49-N88 PolarHBondContact OD1-OD1 3.43Å
50	Q	96.3	Very high	91.8	Very high	61 Å²	61	79.3 Å²	79.3	29%	0.285	41%	0.405	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93	150.9	177.4	-63.1	-55.7	-48.7	0	0	111.3	C47 T48 N55 T86 L87	C47-Q50 HydrophobicContact CB-CB 4.49Å; C47-Q50 HydrophobicContact CB-CG 3.71Å; T48-Q50 VanDerWaalsContact C-N 3.28Å; T48-Q50 PolarHBondContact O-N 3.45Å; T48-Q50 PolarHBondContact O-NE2 3.09Å; T48-Q50 VanDerWaalsContact O-NE2 3.09Å; Q50-N55 HydrophobicContact CB-CB 4.27Å; Q50-N55 HydrophobicContact CG-CB 3.96Å; Q50-N55 VanDerWaalsContact OE1-CB 3.29Å; Q50-N55 PolarHBondContact OE1-ND2 2.86Å; Q50-T86 CarbonylContact O-C 3.57Å; Q50-L87 PolarHBondContact N-O 3.32Å; Q50-L87 VanDerWaalsContact N-O 3.07Å; Q50-L87 WeakPolarHBondContact O-CA 3.39Å; Q50-L87 VanDerWaalsContact O-CB 3.27Å; Q50-L87 WeakPolarHBondContact O-CB 3.42Å; Q50-L87 PolarHBondContact O-N 2.86Å
51	K	93.4	Very high	93	Very high	154 Å²	154	75.2 Å²	75.2	67%	0.67	40%	0.395	S	S	*	.	S	Bend	trans	-95.6	-17.6	174	-63.1	-170.3	176	177	0	113.2	Y85	K51-Y85 WeakPolarHBondContact O-CD1 3.29Å; K51-Y85 WeakPolarHBondContact O-CE1 3.06Å
52	N	89.9	Confident	93.7	Very high	95 Å²	95	73.7 Å²	73.7	51%	0.508	38%	0.384	S	S	.	.	S	Bend	trans	-128.4	137.6	-171.8	-119.6	43.9	0	0	0	110.8	I54 N55	N52-I54 PolarHBondContact O-N 2.96Å; N52-N55 PolarHBondContact O-N 2.92Å
53	N	89.8	Confident	93.7	Very high	80 Å²	80	77.7 Å²	77.7	43%	0.428	40%	0.402	S	S	.	.	G	3₁₀ helix	trans	-62.4	-30.4	180	-176.3	67.3	0	0	0	113.4	N55 C56 L87 K89	N53-N55 PolarHBondContact O-N 3.48Å; N53-C56 WeakPolarHBondContact O-CA 3.39Å; N53-C56 WeakPolarHBondContact O-CB 2.82Å; N53-C56 PolarHBondContact O-N 2.77Å; N53-L87 HydrophobicContact CB-CD2 4.25Å; N53-K89 WeakPolarHBondContact OD1-CE 3.35Å
54	I	92.8	Very high	93.5	Very high	117 Å²	117	80 Å²	80	60%	0.6	41%	0.412	S	S	*	.	G	3₁₀ helix	trans	-60.1	-37.9	-179.9	-60.4	176.9	0	0	0	111.1	N52 C56 L57	N52-I54 PolarHBondContact O-N 2.96Å; I54-C56 PolarHBondContact O-N 2.87Å; I54-C56 VanDerWaalsContact O-N 3.16Å; I54-L57 HydrophobicContact CG2-CD1 4.35Å; I54-L57 PolarHBondContact O-N 2.83Å
55	N	93.6	Very high	93.2	Very high	86 Å²	86	85.6 Å²	85.6	46%	0.46	44%	0.436	S	S	.	.	G	3₁₀ helix	trans	-71.8	-7.9	177.8	-62.1	2.7	0	0	0	112.6	Q50 N52 N53	Q50-N55 HydrophobicContact CB-CB 4.27Å; Q50-N55 HydrophobicContact CG-CB 3.96Å; Q50-N55 VanDerWaalsContact OE1-CB 3.29Å; Q50-N55 PolarHBondContact OE1-ND2 2.86Å; N52-N55 PolarHBondContact O-N 2.92Å; N53-N55 PolarHBondContact O-N 3.48Å
56	C	94.8	Very high	93.1	Very high	0 Å²	0	83 Å²	83	0%	0	43%	0.425	C	S	.	.	G	3₁₀ helix	trans	-102.3	7.3	177.3	-61.9	0	0	0	0	113.6	F45 C47 N53 I54 W58 K89	F45-C56 VanDerWaalsContact CB-O 3.28Å; F45-C56 WeakPolarHBondContact CB-O 3.31Å; C47-C56 HydrophobicContact CB-CB 3.64Å; C47-C56 WeakPolarHBondContact CB-SG 3.23Å; C47-C56 WeakPolarHBondContact SG-CB 3.22Å; C47-C56 CovalentContact SG-SG 2.02Å; C47-C56 PolarHBondContact SG-SG 3.33Å; N53-C56 WeakPolarHBondContact O-CA 3.39Å; N53-C56 WeakPolarHBondContact O-CB 2.82Å; N53-C56 PolarHBondContact O-N 2.77Å; I54-C56 PolarHBondContact O-N 2.87Å; I54-C56 VanDerWaalsContact O-N 3.16Å; C56-W58 PolarHBondContact O-N 2.03Å; C56-W58 VanDerWaalsContact O-N 3.09Å; C56-K89 HydrophobicContact CB-CD 3.88Å; C56-K89 HydrophobicContact CB-CG 4.36Å
57	L	94.2	Very high	92.9	Very high	84 Å²	84	85.6 Å²	85.6	44%	0.44	43%	0.433	S	S	.	.			trans	-80.8	24.8	179.6	-65.3	170	0	0	0	113.4	F45 I54 P59	F45-L57 VanDerWaalsContact CD1-CA 3.49Å; F45-L57 HydrophobicContact CD1-CB 4.44Å; F45-L57 HydrophobicContact CD1-CD2 4.44Å; F45-L57 HydrophobicContact CE1-CB 4.25Å; F45-L57 HydrophobicContact CE1-CD2 4.12Å; F45-L57 WeakPolarHBondContact CE1-O 3.42Å; F45-L57 HydrophobicContact CE2-CD2 4.34Å; F45-L57 HydrophobicContact CZ-CD2 4.06Å; I54-L57 HydrophobicContact CG2-CD1 4.35Å; I54-L57 PolarHBondContact O-N 2.83Å; L57-P59 VanDerWaalsContact O-CD 3.26Å; L57-P59 WeakPolarHBondContact O-CD 3.44Å
58	W	94.2	Very high	92.7	Very high	192 Å²	192	88.8 Å²	88.8	73%	0.727	44%	0.443	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-86.4	110.5	177.2	-84.6	85.6	0	0	0	110.6	F45 S46 C56	F45-W58 CarbonylContact C-O 3.5Å; F45-W58 WeakPolarHBondContact CA-O 3.42Å; S46-W58 PolarHBondContact N-O 3.11Å; C56-W58 PolarHBondContact O-N 2.03Å; C56-W58 VanDerWaalsContact O-N 3.09Å
59	P	93.6	Very high	92.6	Very high	88 Å²	88	84.9 Å²	84.9	57%	0.571	42%	0.419	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-73.7	139	179.9	30.9	-34.5	0	0	0	110.9	C44 L57	C44-P59 CarbonylContact O-C 3.55Å; C44-P59 WeakPolarHBondContact O-CA 3.35Å; L57-P59 VanDerWaalsContact O-CD 3.26Å; L57-P59 WeakPolarHBondContact O-CD 3.44Å
60	V	93.7	Very high	92.6	Very high	49 Å²	49	81 Å²	81	30%	0.297	40%	0.398	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.7	144.8	175.2	-60.7	0	0	0	0	110.4	M43 C44	M43-V60 WeakPolarHBondContact CA-O 3.3Å; C44-V60 PolarHBondContact N-O 3.29Å; C44-V60 WeakPolarHBondContact O-CG2 3.36Å; C44-V60 PolarHBondContact O-N 3.28Å
61	S	93.3	Very high	92.5	Very high	79 Å²	79	79 Å²	79	55%	0.552	39%	0.391	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-82	126.3	169.8	-175.9	0	0	0	0	109.4	S41 M43	S41-S61 WeakPolarHBondContact CB-OG 3.38Å; S41-S61 PolarHBondContact OG-OG 3.34Å; M43-S61 WeakPolarHBondContact SD-CA 3.25Å
62	C	92.5	Very high	92.5	Very high	8 Å²	8	75.3 Å²	75.3	5%	0.054	38%	0.378	C	S	.	.	P	Polyproline II helix	trans	-79.6	167.1	179.2	-59.8	0	0	0	0	112.1	S41 L42 C44 D66 C91	S41-C62 PolarHBondContact OG-O 3.08Å; L42-C62 HydrophobicContact CB-CB 4.14Å; L42-C62 VanDerWaalsContact O-CB 3.23Å; L42-C62 WeakPolarHBondContact O-CB 3.12Å; L42-C62 PolarHBondContact O-N 2.92Å; L42-C62 PolarHBondContact O-SG 2.87Å; C44-C62 PolarHBondContact SG-SG 2.86Å; C62-D66 HydrophobicContact CB-CB 3.88Å; C62-C91 WeakPolarHBondContact CA-SG 3.24Å; C62-C91 HydrophobicContact CB-CB 3.6Å; C62-C91 WeakPolarHBondContact CB-SG 3.15Å; C62-C91 WeakPolarHBondContact SG-CB 3.28Å; C62-C91 CovalentContact SG-SG 2.03Å; C62-C91 PolarHBondContact SG-SG 2.87Å
63	Q	91.4	Very high	92.7	Very high	115 Å²	115	71.9 Å²	71.9	54%	0.537	36%	0.361	S	S	.	.	P	Polyproline II helix	trans	-77	159.9	171.7	-67.7	167.1	81.4	0	0	110.3	K65 D66	Q63-K65 HydrophobicContact CB-CG 3.97Å; Q63-K65 PolarHBondContact O-N 3.45Å; Q63-K65 VanDerWaalsContact O-N 3.11Å; Q63-D66 WeakPolarHBondContact CB-OD2 3.03Å; Q63-D66 PolarHBondContact N-OD2 3.17Å; Q63-D66 WeakPolarHBondContact O-CB 3.45Å; Q63-D66 PolarHBondContact O-N 3.07Å
64	E	88.4	Confident	92.8	Very high	149 Å²	149	70 Å²	70	70%	0.696	36%	0.356	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.9	-27.6	-179.7	-151.8	176.6	-163.9	0	0	113.4	V39 H67	V39-E64 HydrophobicContact CG1-CG 3.95Å; V39-E64 WeakPolarHBondContact CG1-OE1 3.45Å; E64-H67 PolarHBondContact O-CE1 3.12Å
65	K	89.3	Confident	92.7	Very high	120 Å²	120	66 Å²	66	52%	0.522	34%	0.341	S	S	.	.	T	Hydrogen-bonded Turn	trans	-79.9	-14.7	175.2	64.1	177.5	179	-173.7	0	114.1	Q63 H67 P93	Q63-K65 HydrophobicContact CB-CG 3.97Å; Q63-K65 PolarHBondContact O-N 3.45Å; Q63-K65 VanDerWaalsContact O-N 3.11Å; K65-H67 PolarHBondContact O-CD2 2.9Å; K65-H67 PolarHBondContact O-NE2 2.92Å; K65-P93 WeakPolarHBondContact O-CA 3.21Å; K65-P93 VanDerWaalsContact O-CB 3.25Å; K65-P93 WeakPolarHBondContact O-CB 3.19Å
66	D	92.3	Very high	92.6	Very high	12 Å²	12	63.5 Å²	63.5	6%	0.064	33%	0.332	C	S	.	.			trans	-91.7	112	-175.7	-63.1	-28.3	0	0	0	108.5	C62 Q63 C91 P93	C62-D66 HydrophobicContact CB-CB 3.88Å; Q63-D66 WeakPolarHBondContact CB-OD2 3.03Å; Q63-D66 PolarHBondContact N-OD2 3.17Å; Q63-D66 WeakPolarHBondContact O-CB 3.45Å; Q63-D66 PolarHBondContact O-N 3.07Å; D66-C91 HydrophobicContact CB-CB 3.92Å; D66-P93 VanDerWaalsContact OD1-CD 3.3Å; D66-P93 WeakPolarHBondContact OD1-CD 3.28Å
67	H	90.5	Very high	92.2	Very high	96 Å²	96	64.5 Å²	64.5	44%	0.444	34%	0.343	S	S	.	.			trans	-107.5	-1.1	-174.2	-56.8	-54.6	0	0	0	113.1	E64 K65 S92 Q115	E64-H67 PolarHBondContact O-CE1 3.12Å; K65-H67 PolarHBondContact O-CD2 2.9Å; K65-H67 PolarHBondContact O-NE2 2.92Å; H67-S92 PolarHBondContact N-O 2.85Å; H67-Q115 WeakPolarHBondContact O-CG 3.27Å
68	Y	92.6	Very high	91.8	Very high	80 Å²	80	67.6 Å²	67.6	31%	0.314	35%	0.353	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.7	138.9	-176.5	-54.6	-80.8	0	0	0	111.7	C91 S92 C95 C114	Y68-C91 CarbonylContact O-C 3.57Å; Y68-S92 PolarHBondContact N-O 2.77Å; Y68-S92 VanDerWaalsContact N-O 3.08Å; Y68-S92 PolarHBondContact O-N 2.84Å; Y68-C95 HydrophobicContact CD1-CB 4.12Å; Y68-C95 HydrophobicContact CD2-CB 4.15Å; Y68-C95 HydrophobicContact CE1-CB 4.43Å; Y68-C95 HydrophobicContact CE2-CB 4.46Å; Y68-C95 HydrophobicContact CG-CB 3.97Å; Y68-C114 CarbonylContact C-O 3.59Å; Y68-C114 WeakPolarHBondContact CA-O 3.46Å
69	C	94.4	Very high	91.2	Very high	8 Å²	8	62.4 Å²	62.4	5%	0.054	36%	0.359	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.1	126	157.8	-52	0	0	0	0	107.9	C44 G90 C113 C114	C44-C69 VanDerWaalsContact CA-SG 3.56Å; C44-C69 HydrophobicContact CB-CB 3.76Å; C44-C69 WeakPolarHBondContact CB-SG 3.4Å; C44-C69 WeakPolarHBondContact SG-CA 3.41Å; C44-C69 WeakPolarHBondContact SG-CB 3.04Å; C44-C69 CovalentContact SG-SG 2.02Å; C44-C69 PolarHBondContact SG-SG 2.79Å; C69-G90 CarbonylContact C-O 3.5Å; C69-G90 WeakPolarHBondContact CA-O 3.4Å; C69-C113 CarbonylContact O-C 3.56Å; C69-C113 VanDerWaalsContact O-CA 3.23Å; C69-C113 WeakPolarHBondContact O-CA 3.41Å; C69-C114 PolarHBondContact N-O 3.16Å; C69-C114 PolarHBondContact O-N 3.27Å
70	I	94.1	Very high	90.7	Very high	27 Å²	27	65.8 Å²	65.8	14%	0.138	37%	0.372	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.8	139.2	176.3	-165.4	168.3	0	0	0	110.2	L72 K89 G90 Y112	I70-L72 HydrophobicContact CD1-CD1 3.78Å; I70-L72 HydrophobicContact CG1-CD1 3.93Å; I70-L72 HydrophobicContact CG2-CD1 4.45Å; I70-K89 CarbonylContact O-C 3.58Å; I70-K89 VanDerWaalsContact O-CA 3.29Å; I70-K89 WeakPolarHBondContact O-CA 3.41Å; I70-G90 PolarHBondContact N-O 2.84Å; I70-G90 PolarHBondContact O-N 3.37Å; I70-Y112 CarbonylContact C-O 3.46Å; I70-Y112 WeakPolarHBondContact CA-O 3.39Å
71	T	94	Very high	90.3	Very high	21 Å²	21	67.8 Å²	67.8	13%	0.129	38%	0.384	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.5	123.4	168.5	-60.9	0	0	0	0	108	L87 N88 K89 S111 Y112	T71-L87 HydrophobicContact CG2-CD1 3.51Å; T71-N88 CarbonylContact C-O 3.53Å; T71-N88 WeakPolarHBondContact CA-O 3.4Å; T71-K89 HydrophobicContact CG2-CG 4.01Å; T71-K89 PolarHBondContact OG1-NZ 2.84Å; T71-S111 CarbonylContact O-C 3.52Å; T71-S111 VanDerWaalsContact O-CA 3.32Å; T71-S111 WeakPolarHBondContact O-CA 3.33Å; T71-Y112 PolarHBondContact N-O 3.21Å; T71-Y112 PolarHBondContact O-N 3.24Å
72	L	93.4	Very high	90.1	Very high	76 Å²	76	71 Å²	71	40%	0.398	40%	0.395	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.3	131.9	167.1	-82.4	105.7	0	0	0	109.3	I70 L87 N88 V109 N110	I70-L72 HydrophobicContact CD1-CD1 3.78Å; I70-L72 HydrophobicContact CG1-CD1 3.93Å; I70-L72 HydrophobicContact CG2-CD1 4.45Å; L72-L87 WeakPolarHBondContact O-CA 3.33Å; L72-N88 PolarHBondContact N-O 2.83Å; L72-N88 PolarHBondContact O-N 3.4Å; L72-V109 HydrophobicContact CD2-CG1 4.49Å; L72-N110 WeakPolarHBondContact CA-O 3.44Å
73	S	93.1	Very high	89.9	Confident	23 Å²	23	76.6 Å²	76.6	16%	0.161	42%	0.424	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.3	139.1	169.1	57.5	0	0	0	0	109.5	T86 V109 N110	S73-T86 CarbonylContact C-O 3.5Å; S73-T86 WeakPolarHBondContact CA-O 3.46Å; S73-V109 CarbonylContact O-C 3.54Å; S73-V109 WeakPolarHBondContact O-CA 3.45Å; S73-N110 PolarHBondContact N-O 3.19Å; S73-N110 PolarHBondContact O-N 3.09Å; S73-N110 WeakPolarHBondContact OG-CB 3.04Å; S73-N110 PolarHBondContact OG-O 2.78Å
74	A	92.3	Very high	89.8	Confident	39 Å²	39	72.8 Å²	72.8	32%	0.322	42%	0.416	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.7	133.4	175.5	0	0	0	0	0	108.3	Y85 T86 S108 V109	A74-Y85 CarbonylContact O-C 3.54Å; A74-Y85 VanDerWaalsContact O-CA 3.28Å; A74-Y85 WeakPolarHBondContact O-CA 3.48Å; A74-T86 PolarHBondContact N-O 2.82Å; A74-T86 PolarHBondContact O-N 2.77Å; A74-S108 CarbonylContact C-O 3.47Å; A74-S108 VanDerWaalsContact CA-O 3.28Å; A74-S108 WeakPolarHBondContact CA-O 3.33Å; A74-V109 HydrophobicContact CB-CG2 4.3Å
75	A	92	Very high	90.1	Very high	33 Å²	33	70.3 Å²	70.3	27%	0.273	40%	0.401	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.5	143.1	175.5	0	0	0	0	0	109.5	G84 Y85 A107 S108	A75-G84 CarbonylContact C-O 3.54Å; A75-G84 WeakPolarHBondContact CA-O 3.1Å; A75-Y85 HydrophobicContact CB-CD2 3.95Å; A75-A107 CarbonylContact O-C 3.58Å; A75-A107 WeakPolarHBondContact O-CA 3.35Å; A75-S108 PolarHBondContact N-O 3.3Å; A75-S108 PolarHBondContact O-N 3Å; A75-S108 PolarHBondContact O-OG 2.9Å
76	A	90.8	Very high	90.3	Very high	34 Å²	34	67 Å²	67	28%	0.281	39%	0.391	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.4	138.7	172.6	0	0	0	0	0	109.7	L83 G84 V106	A76-L83 HydrophobicContact CB-CB 3.99Å; A76-L83 WeakPolarHBondContact O-CA 3.4Å; A76-L83 WeakPolarHBondContact O-CB 3.36Å; A76-L83 PolarHBondContact O-N 3.01Å; A76-G84 PolarHBondContact N-O 2.98Å; A76-G84 PolarHBondContact O-N 3.38Å; A76-V106 CarbonylContact C-O 3.53Å; A76-V106 WeakPolarHBondContact CA-O 2.96Å
77	G	86.9	Confident	90.5	Very high	22 Å²	22	66.9 Å²	66.9	23%	0.227	39%	0.39	C	S	.	.	E	Extended strand (participates in β ladder)	trans	178	162.4	-178.4	0	0	0	0	0	112.8	V81 V106	G77-V81 CarbonylContact C-O 3.54Å; G77-V81 WeakPolarHBondContact CA-O 3.49Å; G77-V106 PolarHBondContact N-O 3.01Å; G77-V106 CarbonylContact O-C 3.45Å; G77-V106 WeakPolarHBondContact O-CA 3.48Å
78	F	84.2	Confident	90.7	Very high	148 Å²	148	64.6 Å²	64.6	65%	0.649	38%	0.381	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-143.4	127.4	176.1	-178.7	-94.3	0	0	0	109.4	N80 V81 V106	F78-N80 PolarHBondContact O-N 2.82Å; F78-V81 PolarHBondContact N-O 3.29Å; F78-V81 WeakPolarHBondContact O-CB 3.36Å; F78-V81 WeakPolarHBondContact O-CG2 3.32Å; F78-V81 PolarHBondContact O-N 2.02Å; F78-V106 HydrophobicContact CD2-CG1 4.22Å
79	G	83	Confident	90.8	Very high	83 Å²	83	62.8 Å²	62.8	86%	0.856	38%	0.375	S	S	*	.	T	Hydrogen-bonded Turn	trans	55.8	-122.1	-173.5	0	0	0	0	0	111.4
80	N	82.4	Confident	90.8	Very high	159 Å²	159	63 Å²	63	85%	0.85	38%	0.378	S	S	*	.	T	Hydrogen-bonded Turn	trans	-93.5	8.1	179.9	-142.8	6.2	0	0	0	113.5	F78	F78-N80 PolarHBondContact O-N 2.82Å
81	V	86.2	Confident	90.9	Very high	91 Å²	91	63.6 Å²	63.6	55%	0.552	38%	0.384	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-100.6	118	-175.3	-153.1	0	0	0	0	109.5	G77 F78	G77-V81 CarbonylContact C-O 3.54Å; G77-V81 WeakPolarHBondContact CA-O 3.49Å; F78-V81 PolarHBondContact N-O 3.29Å; F78-V81 WeakPolarHBondContact O-CB 3.36Å; F78-V81 WeakPolarHBondContact O-CG2 3.32Å; F78-V81 PolarHBondContact O-N 2.02Å
82	N	87.5	Confident	90.9	Very high	146 Å²	146	63.7 Å²	63.7	78%	0.781	39%	0.386	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-94.9	114.7	175.5	-66.2	-77.7	0	0	0	109.6
83	L	88.6	Confident	90.8	Very high	127 Å²	127	63 Å²	63	67%	0.665	39%	0.386	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-91.4	-19.3	-179.5	-66.1	165	0	0	0	112.5	A76	A76-L83 HydrophobicContact CB-CB 3.99Å; A76-L83 WeakPolarHBondContact O-CA 3.4Å; A76-L83 WeakPolarHBondContact O-CB 3.36Å; A76-L83 PolarHBondContact O-N 3.01Å
84	G	90.6	Very high	90.6	Very high	34 Å²	34	67.7 Å²	67.7	35%	0.351	41%	0.408	S	S	.	.	E	Extended strand (participates in β ladder)	trans	168	156.6	175.1	0	0	0	0	0	112.8	A75 A76	A75-G84 CarbonylContact C-O 3.54Å; A75-G84 WeakPolarHBondContact CA-O 3.1Å; A76-G84 PolarHBondContact N-O 2.98Å; A76-G84 PolarHBondContact O-N 3.38Å
85	Y	93.1	Very high	90.4	Very high	98 Å²	98	67.4 Å²	67.4	38%	0.384	40%	0.403	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.5	138.8	169.5	175.9	-100.1	0	0	0	108.4	K51 A74 A75 L87	K51-Y85 WeakPolarHBondContact O-CD1 3.29Å; K51-Y85 WeakPolarHBondContact O-CE1 3.06Å; A74-Y85 CarbonylContact O-C 3.54Å; A74-Y85 VanDerWaalsContact O-CA 3.28Å; A74-Y85 WeakPolarHBondContact O-CA 3.48Å; A75-Y85 HydrophobicContact CB-CD2 3.95Å; Y85-L87 HydrophobicContact CE1-CB 4.02Å
86	T	94.9	Very high	89.8	Confident	51 Å²	51	68 Å²	68	31%	0.313	40%	0.404	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.5	140	-177.9	-37.3	0	0	0	0	109.2	D49 Q50 S73 A74	D49-T86 HydrophobicContact CB-CG2 4.05Å; D49-T86 WeakPolarHBondContact OD1-CG2 3.01Å; Q50-T86 CarbonylContact O-C 3.57Å; S73-T86 CarbonylContact C-O 3.5Å; S73-T86 WeakPolarHBondContact CA-O 3.46Å; A74-T86 PolarHBondContact N-O 2.82Å; A74-T86 PolarHBondContact O-N 2.77Å
87	L	95.6	Very high	88.5	Confident	9 Å²	9	72.1 Å²	72.1	5%	0.047	43%	0.431	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.7	125.5	-178.4	179.9	68.3	0	0	0	109.6	Q50 N53 T71 L72 Y85	Q50-L87 PolarHBondContact N-O 3.32Å; Q50-L87 VanDerWaalsContact N-O 3.07Å; Q50-L87 WeakPolarHBondContact O-CA 3.39Å; Q50-L87 VanDerWaalsContact O-CB 3.27Å; Q50-L87 WeakPolarHBondContact O-CB 3.42Å; Q50-L87 PolarHBondContact O-N 2.86Å; N53-L87 HydrophobicContact CB-CD2 4.25Å; T71-L87 HydrophobicContact CG2-CD1 3.51Å; L72-L87 WeakPolarHBondContact O-CA 3.33Å; Y85-L87 HydrophobicContact CE1-CB 4.02Å
88	N	95.1	Very high	87.5	Confident	47 Å²	47	78.4 Å²	78.4	25%	0.251	45%	0.454	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.5	138.5	178.2	-63.1	25.1	0	0	0	108.3	C47 D49 T71 L72	C47-N88 VanDerWaalsContact O-CA 3.31Å; C47-N88 WeakPolarHBondContact O-CA 3.41Å; D49-N88 PolarHBondContact N-OD1 2.76Å; D49-N88 PolarHBondContact OD1-ND2 2.03Å; D49-N88 PolarHBondContact OD1-OD1 3.43Å; T71-N88 CarbonylContact C-O 3.53Å; T71-N88 WeakPolarHBondContact CA-O 3.4Å; L72-N88 PolarHBondContact N-O 2.83Å; L72-N88 PolarHBondContact O-N 3.4Å
89	K	95.3	Very high	86.4	Confident	43 Å²	43	75.5 Å²	75.5	19%	0.187	45%	0.446	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.6	149.1	175.1	-63	-172.2	179.6	-82.1	0	110	F45 S46 C47 N53 C56 I70 T71	F45-K89 HydrophobicContact CB-CD 4.06Å; F45-K89 CarbonylContact O-C 3.55Å; F45-K89 WeakPolarHBondContact O-CB 3.23Å; S46-K89 WeakPolarHBondContact CA-O 3.33Å; C47-K89 PolarHBondContact N-O 2.71Å; C47-K89 PolarHBondContact O-N 2.85Å; N53-K89 WeakPolarHBondContact OD1-CE 3.35Å; C56-K89 HydrophobicContact CB-CD 3.88Å; C56-K89 HydrophobicContact CB-CG 4.36Å; I70-K89 CarbonylContact O-C 3.58Å; I70-K89 VanDerWaalsContact O-CA 3.29Å; I70-K89 WeakPolarHBondContact O-CA 3.41Å; T71-K89 HydrophobicContact CG2-CG 4.01Å; T71-K89 PolarHBondContact OG1-NZ 2.84Å
90	G	94.8	Very high	85.9	Confident	13 Å²	13	74.8 Å²	74.8	13%	0.134	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	176.9	-169.8	174.9	0	0	0	0	0	114	F45 C69 I70	F45-G90 PolarHBondContact O-N 2.79Å; C69-G90 CarbonylContact C-O 3.5Å; C69-G90 WeakPolarHBondContact CA-O 3.4Å; I70-G90 PolarHBondContact N-O 2.84Å; I70-G90 PolarHBondContact O-N 3.37Å
91	C	94.8	Very high	85.5	Confident	38 Å²	38	72.7 Å²	72.7	26%	0.257	41%	0.413	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91	146.1	178.1	-51.2	0	0	0	0	111	C62 D66 Y68	C62-C91 WeakPolarHBondContact CA-SG 3.24Å; C62-C91 HydrophobicContact CB-CB 3.6Å; C62-C91 WeakPolarHBondContact CB-SG 3.15Å; C62-C91 WeakPolarHBondContact SG-CB 3.28Å; C62-C91 CovalentContact SG-SG 2.03Å; C62-C91 PolarHBondContact SG-SG 2.87Å; D66-C91 HydrophobicContact CB-CB 3.92Å; Y68-C91 CarbonylContact O-C 3.57Å
92	S	93.5	Very high	85.2	Confident	24 Å²	24	73.3 Å²	73.3	17%	0.168	41%	0.413	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.5	143.3	175.2	-174.3	0	0	0	0	111.8	H67 Y68 I94	H67-S92 PolarHBondContact N-O 2.85Å; Y68-S92 PolarHBondContact N-O 2.77Å; Y68-S92 VanDerWaalsContact N-O 3.08Å; Y68-S92 PolarHBondContact O-N 2.84Å; S92-I94 VanDerWaalsContact C-N 3.28Å; S92-I94 WeakPolarHBondContact CB-O 3.43Å; S92-I94 PolarHBondContact OG-N 2.86Å; S92-I94 PolarHBondContact OG-O 2.82Å
93	P	92.3	Very high	84.8	Confident	60 Å²	60	71.6 Å²	71.6	39%	0.39	40%	0.404	S	S	.	.	S	Bend	trans	-74.7	-21.9	171.8	31.2	-34.7	0	0	0	112.5	K65 D66	K65-P93 WeakPolarHBondContact O-CA 3.21Å; K65-P93 VanDerWaalsContact O-CB 3.25Å; K65-P93 WeakPolarHBondContact O-CB 3.19Å; D66-P93 VanDerWaalsContact OD1-CD 3.3Å; D66-P93 WeakPolarHBondContact OD1-CD 3.28Å
94	I	89.4	Confident	84.5	Confident	123 Å²	123	72.1 Å²	72.1	63%	0.631	41%	0.406	S	S	*	.			trans	-128.4	133.2	-174.5	-58.4	168.3	0	0	0	108.4	S92	S92-I94 VanDerWaalsContact C-N 3.28Å; S92-I94 WeakPolarHBondContact CB-O 3.43Å; S92-I94 PolarHBondContact OG-N 2.86Å; S92-I94 PolarHBondContact OG-O 2.82Å
95	C	88	Confident	84	Confident	32 Å²	32	73.2 Å²	73.2	22%	0.216	42%	0.418	C	S	.	.			trans	-99.9	132.2	162.5	-178.3	0	0	0	0	108.8	Y68 S97 C113	Y68-C95 HydrophobicContact CD1-CB 4.12Å; Y68-C95 HydrophobicContact CD2-CB 4.15Å; Y68-C95 HydrophobicContact CE1-CB 4.43Å; Y68-C95 HydrophobicContact CE2-CB 4.46Å; Y68-C95 HydrophobicContact CG-CB 3.97Å; C95-S97 PolarHBondContact O-N 2.87Å; C95-C113 HydrophobicContact CB-CB 3.72Å; C95-C113 WeakPolarHBondContact CB-SG 3.39Å; C95-C113 WeakPolarHBondContact SG-CB 3.26Å; C95-C113 CovalentContact SG-SG 2.03Å; C95-C113 PolarHBondContact SG-SG 3.09Å
96	P	79.3	Confident	83.6	Confident	47 Å²	47	72.4 Å²	72.4	31%	0.305	42%	0.423	S	S	.	.			trans	-55.7	136.9	167.2	23.6	-31.6	0	0	0	109.2	E98 V100	P96-E98 PolarHBondContact O-N 3.45Å; P96-V100 HydrophobicContact CB-CG2 4.13Å; P96-V100 HydrophobicContact CG-CG2 4.43Å
97	S	63.2	Low	83.3	Confident	120 Å²	120	72 Å²	72	84%	0.839	43%	0.425	S	S	*	.	S	Bend	trans	-55.4	-13.4	-160.7	-45.2	0	0	0	0	116.6	C95	C95-S97 PolarHBondContact O-N 2.87Å
98	E	65.1	Low	83	Confident	153 Å²	153	73.2 Å²	73.2	72%	0.715	43%	0.434	S	S	*	.	S	Bend	trans	-148.8	155.5	173.5	-60.4	-68.1	160.7	0	0	107.9	P96 V100	P96-E98 PolarHBondContact O-N 3.45Å; E98-V100 WeakPolarHBondContact O-CG2 3.44Å; E98-V100 PolarHBondContact O-N 2.8Å
99	N	62.2	Low	82.7	Confident	88 Å²	88	73.8 Å²	73.8	47%	0.471	44%	0.439	S	S	.	.			trans	-57.3	107.5	170.7	-62.6	-47.8	0	0	0	109	N101 S111 Y112 C113	N99-N101 PolarHBondContact O-N 2.02Å; N99-S111 CarbonylContact C-O 3.57Å; N99-S111 WeakPolarHBondContact CA-O 3.21Å; N99-S111 VanDerWaalsContact CB-O 3.31Å; N99-S111 WeakPolarHBondContact CB-O 3.34Å; N99-Y112 WeakPolarHBondContact OD1-CA 3.33Å; N99-Y112 WeakPolarHBondContact OD1-CD2 3.28Å; N99-C113 PolarHBondContact OD1-N 2.95Å
100	V	72.4	Confident	82.4	Confident	68 Å²	68	74.5 Å²	74.5	41%	0.412	45%	0.445	S	S	.	.			trans	-80.9	115.3	-174.4	-178.5	0	0	0	0	107.9	P96 E98 L102 N110 S111	P96-V100 HydrophobicContact CB-CG2 4.13Å; P96-V100 HydrophobicContact CG-CG2 4.43Å; E98-V100 WeakPolarHBondContact O-CG2 3.44Å; E98-V100 PolarHBondContact O-N 2.8Å; V100-L102 HydrophobicContact CG1-CB 4.37Å; V100-N110 CarbonylContact O-C 3.57Å; V100-N110 WeakPolarHBondContact O-CA 3.45Å; V100-S111 WeakPolarHBondContact CB-OG 3.46Å; V100-S111 PolarHBondContact N-O 2.73Å; V100-S111 PolarHBondContact N-OG 2.95Å; V100-S111 VanDerWaalsContact N-OG 3.09Å; V100-S111 PolarHBondContact O-N 3.07Å
101	N	74.4	Confident	82.3	Confident	114 Å²	114	74.2 Å²	74.2	61%	0.61	44%	0.441	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-109.9	94	165.5	-178.4	13.8	0	0	0	108.5	N99 V109 N110	N99-N101 PolarHBondContact O-N 2.02Å; N101-V109 WeakPolarHBondContact CA-O 3.21Å; N101-N110 WeakPolarHBondContact CB-OD1 3.38Å
102	L	79.3	Confident	82.1	Confident	104 Å²	104	78 Å²	78	55%	0.545	45%	0.451	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.6	119	175	-179.5	63.2	0	0	0	108.6	V100 S108 V109	V100-L102 HydrophobicContact CG1-CB 4.37Å; L102-S108 CarbonylContact O-C 3.5Å; L102-S108 WeakPolarHBondContact O-CA 3.46Å; L102-V109 PolarHBondContact N-O 3.06Å; L102-V109 PolarHBondContact O-N 3.23Å
103	N	79.4	Confident	82.1	Confident	110 Å²	110	77.7 Å²	77.7	59%	0.588	45%	0.448	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-116.4	116	171.7	-172.1	-54.2	0	0	0	109.4	G105	N103-G105 WeakPolarHBondContact OD1-CA 3.31Å; N103-G105 PolarHBondContact OD1-N 3.48Å
104	L	81.8	Confident	82	Confident	138 Å²	138	76.4 Å²	76.4	72%	0.723	44%	0.441	S	S	*	.			trans	-108	41.7	178.7	-164	65.8	0	0	0	110.7	V106 A107	L104-V106 PolarHBondContact O-N 3.2Å; L104-A107 PolarHBondContact N-O 2.86Å
105	G	81.3	Confident	81.9	Confident	58 Å²	58	77.2 Å²	77.2	60%	0.598	44%	0.441	S	S	*	.	S	Bend	trans	72.7	-57.4	176.1	0	0	0	0	0	114.5	N103	N103-G105 WeakPolarHBondContact OD1-CA 3.31Å; N103-G105 PolarHBondContact OD1-N 3.48Å
106	V	83.8	Confident	81.1	Confident	81 Å²	81	79.6 Å²	79.6	49%	0.491	46%	0.459	S	S	.	.	S	Bend	trans	-100.9	-11.9	-179.8	-62.5	0	0	0	0	113.5	A76 G77 F78 L104	A76-V106 CarbonylContact C-O 3.53Å; A76-V106 WeakPolarHBondContact CA-O 2.96Å; G77-V106 PolarHBondContact N-O 3.01Å; G77-V106 CarbonylContact O-C 3.45Å; G77-V106 WeakPolarHBondContact O-CA 3.48Å; F78-V106 HydrophobicContact CD2-CG1 4.22Å; L104-V106 PolarHBondContact O-N 3.2Å
107	A	88.2	Confident	80.1	Confident	42 Å²	42	82.3 Å²	82.3	35%	0.347	48%	0.479	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.6	147.5	-179.5	0	0	0	0	0	110.3	A75 L104	A75-A107 CarbonylContact O-C 3.58Å; A75-A107 WeakPolarHBondContact O-CA 3.35Å; L104-A107 PolarHBondContact N-O 2.86Å
108	S	88.7	Confident	81	Confident	34 Å²	34	80.5 Å²	80.5	24%	0.238	46%	0.461	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136	143.2	173.6	59.9	0	0	0	0	110.8	A74 A75 L102	A74-S108 CarbonylContact C-O 3.47Å; A74-S108 VanDerWaalsContact CA-O 3.28Å; A74-S108 WeakPolarHBondContact CA-O 3.33Å; A75-S108 PolarHBondContact N-O 3.3Å; A75-S108 PolarHBondContact O-N 3Å; A75-S108 PolarHBondContact O-OG 2.9Å; L102-S108 CarbonylContact O-C 3.5Å; L102-S108 WeakPolarHBondContact O-CA 3.46Å
109	V	89.7	Confident	81.8	Confident	59 Å²	59	76.6 Å²	76.6	36%	0.358	45%	0.448	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129	125.4	173.9	-179.5	0	0	0	0	107.8	L72 S73 A74 N101 L102	L72-V109 HydrophobicContact CD2-CG1 4.49Å; S73-V109 CarbonylContact O-C 3.54Å; S73-V109 WeakPolarHBondContact O-CA 3.45Å; A74-V109 HydrophobicContact CB-CG2 4.3Å; N101-V109 WeakPolarHBondContact CA-O 3.21Å; L102-V109 PolarHBondContact N-O 3.06Å; L102-V109 PolarHBondContact O-N 3.23Å
110	N	89.7	Confident	82.9	Confident	58 Å²	58	76 Å²	76	31%	0.31	45%	0.446	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.1	124.8	176.8	-163.3	85.7	0	0	0	110.7	L72 S73 V100 N101	L72-N110 WeakPolarHBondContact CA-O 3.44Å; S73-N110 PolarHBondContact N-O 3.19Å; S73-N110 PolarHBondContact O-N 3.09Å; S73-N110 WeakPolarHBondContact OG-CB 3.04Å; S73-N110 PolarHBondContact OG-O 2.78Å; V100-N110 CarbonylContact O-C 3.57Å; V100-N110 WeakPolarHBondContact O-CA 3.45Å; N101-N110 WeakPolarHBondContact CB-OD1 3.38Å
111	S	91.9	Very high	83.5	Confident	7 Å²	7	76.5 Å²	76.5	5%	0.049	45%	0.448	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.6	136.2	171.7	73.1	0	0	0	0	111	T71 N99 V100	T71-S111 CarbonylContact O-C 3.52Å; T71-S111 VanDerWaalsContact O-CA 3.32Å; T71-S111 WeakPolarHBondContact O-CA 3.33Å; N99-S111 CarbonylContact C-O 3.57Å; N99-S111 WeakPolarHBondContact CA-O 3.21Å; N99-S111 VanDerWaalsContact CB-O 3.31Å; N99-S111 WeakPolarHBondContact CB-O 3.34Å; V100-S111 WeakPolarHBondContact CB-OG 3.46Å; V100-S111 PolarHBondContact N-O 2.73Å; V100-S111 PolarHBondContact N-OG 2.95Å; V100-S111 VanDerWaalsContact N-OG 3.09Å; V100-S111 PolarHBondContact O-N 3.07Å
112	Y	90.9	Very high	84.1	Confident	118 Å²	118	74.1 Å²	74.1	46%	0.463	44%	0.438	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.4	137.6	174.7	179	-96.2	0	0	0	110.4	I70 T71 N99 C114	I70-Y112 CarbonylContact C-O 3.46Å; I70-Y112 WeakPolarHBondContact CA-O 3.39Å; T71-Y112 PolarHBondContact N-O 3.21Å; T71-Y112 PolarHBondContact O-N 3.24Å; N99-Y112 WeakPolarHBondContact OD1-CA 3.33Å; N99-Y112 WeakPolarHBondContact OD1-CD2 3.28Å; Y112-C114 HydrophobicContact CE1-CB 4Å
113	C	92.6	Very high	84.4	Confident	18 Å²	18	72.1 Å²	72.1	12%	0.122	43%	0.431	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.6	149.3	175.3	-51.2	0	0	0	0	112.4	C69 C95 N99	C69-C113 CarbonylContact O-C 3.56Å; C69-C113 VanDerWaalsContact O-CA 3.23Å; C69-C113 WeakPolarHBondContact O-CA 3.41Å; C95-C113 HydrophobicContact CB-CB 3.72Å; C95-C113 WeakPolarHBondContact CB-SG 3.39Å; C95-C113 WeakPolarHBondContact SG-CB 3.26Å; C95-C113 CovalentContact SG-SG 2.03Å; C95-C113 PolarHBondContact SG-SG 3.09Å; N99-C113 PolarHBondContact OD1-N 2.95Å
114	C	90.9	Very high	84.7	Confident	33 Å²	33	69.4 Å²	69.4	22%	0.223	42%	0.42	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.7	155.1	169.5	49.1	0	0	0	0	110.3	Y68 C69 Y112 S116	Y68-C114 CarbonylContact C-O 3.59Å; Y68-C114 WeakPolarHBondContact CA-O 3.46Å; C69-C114 PolarHBondContact N-O 3.16Å; C69-C114 PolarHBondContact O-N 3.27Å; Y112-C114 HydrophobicContact CE1-CB 4Å; C114-S116 VanDerWaalsContact C-N 3.34Å; C114-S116 PolarHBondContact SG-O 3.02Å
115	Q	86.4	Confident	85	Confident	139 Å²	139	64.2 Å²	64.2	65%	0.65	40%	0.397	S	S	*	.	S	Bend	trans	-96.7	8.3	176.4	-167.2	163.9	26	0	0	111.9	L42 H67	L42-Q115 VanDerWaalsContact CD1-O 3.24Å; L42-Q115 WeakPolarHBondContact CD1-O 3.45Å; H67-Q115 WeakPolarHBondContact O-CG 3.27Å
116	S	71.8	Confident	85.3	Confident	83 Å²	83	64.7 Å²	64.7	58%	0.58	38%	0.38	S	S	*	.			trans	-140.5	155.7	179.7	-164.1	0	0	0	0	109.5	C114	C114-S116 VanDerWaalsContact C-N 3.34Å; C114-S116 PolarHBondContact SG-O 3.02Å
117	S	58.7	Low	85.4	Confident	104 Å²	104	63.2 Å²	63.2	73%	0.727	37%	0.37	S	S	*	.			trans	-67.8	0	-175.1	62.3	0	0	0	0	113.7	M43	M43-S117 WeakPolarHBondContact O-CB 3.04Å

Retrieved 117 of 117 residues in 41.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).