A0A087WS35_MOUSE Loading...

Tubulin, alpha 4A

AlphaFold DB , UniProt , Accession A0A087WS35, Species MOUSE (Mus musculus, Mouse), Gene Tuba4a, Length 75 aa.

						>A0A087WS35_MOUSE|A0A087WS35|Tuba4a
RECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDLEPTVIV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	R	86.4	Confident	94.5	Very high	259 Å²	259	93 Å²	93	98%	0.977	50%	0.495	S	S	*	.				0	134.5	0	-73.3	-176.4	-176.7	-88.7	0	105.7	T50	R1-T50 WeakPolarHBondContact O-CB 3.31Å; R1-T50 VanDerWaalsContact O-CG2 3.26Å; R1-T50 WeakPolarHBondContact O-CG2 3.31Å; R1-T50 PolarHBondContact O-OG1 3.35Å
2	E	92.1	Very high	94.6	Very high	136 Å²	136	86.8 Å²	86.8	64%	0.636	47%	0.47	S	S	*	.			trans	-98.5	145.6	-170.1	-58.9	86.4	156.2	0	0	110.6
3	C	94.8	Very high	94.6	Very high	59 Å²	59	80.2 Å²	80.2	40%	0.399	43%	0.434	S	S	.	.			trans	-120.2	139.4	173.3	-70.3	0	0	0	0	109.4	T50 F51 R63	C3-T50 HydrophobicContact CB-CG2 3.94Å; C3-T50 PolarHBondContact N-O 3.35Å; C3-F51 HydrophobicContact CB-CD1 4.11Å; C3-F51 HydrophobicContact CB-CE1 3.84Å; C3-R63 VanDerWaalsContact O-CB 3.3Å; C3-R63 WeakPolarHBondContact O-CB 3.35Å
4	I	96.1	Very high	94.5	Very high	125 Å²	125	81.9 Å²	81.9	64%	0.641	44%	0.438	S	S	*	.			trans	-112.9	120.4	172.9	-59	176.5	0	0	0	107.6	V6 R63 V65	I4-V6 HydrophobicContact CG2-CG2 4.21Å; I4-R63 WeakPolarHBondContact CA-O 3.48Å; I4-V65 HydrophobicContact CG2-CG2 4.44Å
5	S	97.5	Very high	94.6	Very high	30 Å²	30	84.9 Å²	84.9	21%	0.21	45%	0.45	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.6	125.8	173.8	-60.6	0	0	0	0	109.7	R63 A64 V65	S5-R63 PolarHBondContact N-O 3.02Å; S5-A64 CarbonylContact O-C 3.54Å; S5-A64 VanDerWaalsContact O-CA 3.26Å; S5-A64 WeakPolarHBondContact O-CA 3.45Å; S5-V65 PolarHBondContact O-N 3.15Å
6	V	97.6	Very high	94.7	Very high	90 Å²	90	79.6 Å²	79.6	55%	0.545	42%	0.422	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.9	118.5	176.5	-174.4	0	0	0	0	108.8	I4 V8 V65	I4-V6 HydrophobicContact CG2-CG2 4.21Å; V6-V8 HydrophobicContact CG1-CG2 3.87Å; V6-V65 WeakPolarHBondContact CA-O 3.39Å
7	H	96.9	Very high	94.7	Very high	33 Å²	33	78.7 Å²	78.7	15%	0.153	42%	0.418	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.9	116.7	-176.6	-62.9	-67.8	0	0	0	109	G16 W20 V65 F66 V67	H7-G16 VanDerWaalsContact CE1-CA 3.41Å; H7-G16 WeakPolarHBondContact CE1-CA 3.49Å; H7-W20 AromaticContact CD2-NE1 3.95Å; H7-W20 AromaticContact NE2-CD1 3.84Å; H7-W20 AromaticContact NE2-NE1 3.38Å; H7-W20 PolarHBondContact NE2-NE1 2.9Å; H7-V65 PolarHBondContact N-O 3.47Å; H7-F66 HydrophobicContact CB-CD1 3.68Å; H7-F66 HydrophobicContact CB-CE1 3.98Å; H7-F66 HydrophobicContact CB-CG 4.36Å; H7-F66 AromaticContact CD2-CE1 3.62Å; H7-F66 AromaticContact CD2-CZ 3.75Å; H7-F66 AromaticContact CG-CE1 3.98Å; H7-F66 WeakPolarHBondContact O-CA 3.34Å; H7-V67 PolarHBondContact O-N 3.07Å
8	V	96.1	Very high	94.8	Very high	97 Å²	97	77.6 Å²	77.6	59%	0.588	42%	0.421	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-121.7	132.5	-170.9	-173	0	0	0	0	111.7	V6 V67	V6-V8 HydrophobicContact CG1-CG2 3.87Å; V8-V67 CarbonylContact C-O 3.52Å; V8-V67 WeakPolarHBondContact CA-O 3.3Å; V8-V67 HydrophobicContact CG2-CB 4.46Å
9	G	95.1	Very high	94.9	Very high	25 Å²	25	76.6 Å²	76.6	26%	0.258	42%	0.42	S	S	.	.	H	α-helix	trans	72.6	165.6	-179.5	0	0	0	0	0	113.1	A11 G12 V13 V67	G9-A11 VanDerWaalsContact C-N 3.32Å; G9-A11 PolarHBondContact O-N 3.21Å; G9-A11 VanDerWaalsContact O-N 3.15Å; G9-G12 PolarHBondContact O-N 3.45Å; G9-V13 WeakPolarHBondContact O-CG2 3.46Å; G9-V13 PolarHBondContact O-N 2.87Å; G9-V67 PolarHBondContact N-O 3.49Å
10	Q	92.4	Very high	94.9	Very high	100 Å²	100	73.6 Å²	73.6	47%	0.467	40%	0.402	S	S	.	.	H	α-helix	trans	-45.2	-50.6	-174.9	172.3	168.8	-11.7	0	0	114.3	V13 Q14 D68 V73	Q10-V13 PolarHBondContact O-N 2.84Å; Q10-Q14 WeakPolarHBondContact O-CG 3.43Å; Q10-Q14 PolarHBondContact O-N 3.17Å; Q10-D68 WeakPolarHBondContact CA-OD2 3.44Å; Q10-D68 PolarHBondContact N-OD2 3.01Å; Q10-V73 HydrophobicContact CB-CG2 3.95Å; Q10-V73 HydrophobicContact CG-CG1 4.25Å; Q10-V73 HydrophobicContact CG-CG2 3.66Å
11	A	94.1	Very high	94.9	Very high	69 Å²	69	77.3 Å²	77.3	57%	0.57	42%	0.417	S	S	*	.	H	α-helix	trans	-65.4	-43.2	-179.4	0	0	0	0	0	112.1	G9 Q14 M15	G9-A11 VanDerWaalsContact C-N 3.32Å; G9-A11 PolarHBondContact O-N 3.21Å; G9-A11 VanDerWaalsContact O-N 3.15Å; A11-Q14 PolarHBondContact O-N 3.31Å; A11-M15 WeakPolarHBondContact O-CB 3.46Å; A11-M15 VanDerWaalsContact O-CG 3.3Å; A11-M15 WeakPolarHBondContact O-CG 3.39Å; A11-M15 PolarHBondContact O-N 2.93Å
12	G	95.7	Very high	95.3	Very high	19 Å²	19	69 Å²	69	20%	0.196	39%	0.391	C	S	.	.	H	α-helix	trans	-63.2	-43.1	178.3	0	0	0	0	0	111.9	G9 M15 G16	G9-G12 PolarHBondContact O-N 3.45Å; G12-M15 PolarHBondContact O-N 2.93Å; G12-G16 PolarHBondContact O-N 2.72Å
13	V	95.2	Very high	95.3	Very high	0 Å²	0	66.2 Å²	66.2	0%	0	38%	0.376	C	S	.	.	H	α-helix	trans	-63.8	-46.7	178	174.3	0	0	0	0	111.5	G9 Q10 M15 G16 N17 F66 D68 V73	G9-V13 WeakPolarHBondContact O-CG2 3.46Å; G9-V13 PolarHBondContact O-N 2.87Å; Q10-V13 PolarHBondContact O-N 2.84Å; V13-M15 PolarHBondContact O-N 3.33Å; V13-G16 PolarHBondContact O-N 3.45Å; V13-N17 PolarHBondContact O-N 3.29Å; V13-F66 HydrophobicContact CB-CD1 4.17Å; V13-F66 HydrophobicContact CG1-CD1 3.86Å; V13-F66 HydrophobicContact CG1-CE1 4.47Å; V13-F66 HydrophobicContact CG2-CB 4.34Å; V13-F66 HydrophobicContact CG2-CD1 4.11Å; V13-D68 HydrophobicContact CG2-CB 4.4Å; V13-V73 HydrophobicContact CB-CG1 3.93Å; V13-V73 HydrophobicContact CG1-CG1 3.76Å
14	Q	93.8	Very high	95.2	Very high	104 Å²	104	64.7 Å²	64.7	49%	0.486	37%	0.365	S	S	.	.	H	α-helix	trans	-63.5	-42.4	179.1	-70.4	-177.3	34.6	0	0	112.2	Q10 A11 N17 A18 V73	Q10-Q14 WeakPolarHBondContact O-CG 3.43Å; Q10-Q14 PolarHBondContact O-N 3.17Å; A11-Q14 PolarHBondContact O-N 3.31Å; Q14-N17 PolarHBondContact O-N 3.43Å; Q14-A18 PolarHBondContact O-N 2.79Å; Q14-V73 HydrophobicContact CG-CG1 3.7Å
15	M	95.9	Very high	94.9	Very high	128 Å²	128	65.2 Å²	65.2	63%	0.631	37%	0.369	S	S	*	.	H	α-helix	trans	-63.5	-43.5	174	-72.4	-178.1	65	0	0	111.3	A11 G12 V13 N17 A18 C19	A11-M15 WeakPolarHBondContact O-CB 3.46Å; A11-M15 VanDerWaalsContact O-CG 3.3Å; A11-M15 WeakPolarHBondContact O-CG 3.39Å; A11-M15 PolarHBondContact O-N 2.93Å; G12-M15 PolarHBondContact O-N 2.93Å; V13-M15 PolarHBondContact O-N 3.33Å; M15-N17 VanDerWaalsContact C-N 3.33Å; M15-N17 PolarHBondContact O-N 3.17Å; M15-A18 PolarHBondContact O-N 2.83Å; M15-C19 WeakPolarHBondContact O-CB 3.4Å; M15-C19 PolarHBondContact O-N 2.63Å; M15-C19 PolarHBondContact O-SG 2.93Å
16	G	96.1	Very high	94.6	Very high	0 Å²	0	69.6 Å²	69.6	0%	0	39%	0.386	C	S	.	.	H	α-helix	trans	-58.2	-43.7	177.2	0	0	0	0	0	112.4	H7 G12 V13 C19 W20	H7-G16 VanDerWaalsContact CE1-CA 3.41Å; H7-G16 WeakPolarHBondContact CE1-CA 3.49Å; G12-G16 PolarHBondContact O-N 2.72Å; V13-G16 PolarHBondContact O-N 3.45Å; G16-C19 PolarHBondContact O-N 3.01Å; G16-W20 PolarHBondContact O-N 2.59Å
17	N	94.8	Very high	94.1	Very high	64 Å²	64	68.4 Å²	68.4	34%	0.342	37%	0.374	S	S	.	.	H	α-helix	trans	-59.4	-48.9	176.1	-77.1	-5	0	0	0	111.8	V13 Q14 M15 C19 W20 E21 F66	V13-N17 PolarHBondContact O-N 3.29Å; Q14-N17 PolarHBondContact O-N 3.43Å; M15-N17 VanDerWaalsContact C-N 3.33Å; M15-N17 PolarHBondContact O-N 3.17Å; N17-C19 PolarHBondContact O-N 3.24Å; N17-W20 PolarHBondContact O-N 3.44Å; N17-E21 WeakPolarHBondContact O-CB 3.49Å; N17-E21 PolarHBondContact O-N 3.26Å; N17-F66 WeakPolarHBondContact OD1-CE1 3.37Å
18	A	95.7	Very high	93.7	Very high	58 Å²	58	68.4 Å²	68.4	48%	0.479	38%	0.383	S	S	.	.	H	α-helix	trans	-63.1	-40.4	178	0	0	0	0	0	112.4	Q14 M15 L22	Q14-A18 PolarHBondContact O-N 2.79Å; M15-A18 PolarHBondContact O-N 2.83Å; A18-L22 PolarHBondContact O-N 3.08Å; A18-L22 VanDerWaalsContact O-N 3.11Å
19	C	96	Very high	93.5	Very high	60 Å²	60	64.3 Å²	64.3	41%	0.405	36%	0.358	S	S	.	.	H	α-helix	trans	-63.3	-44.4	176.4	-71.3	0	0	0	0	112.2	M15 G16 N17 L22 Y23	M15-C19 WeakPolarHBondContact O-CB 3.4Å; M15-C19 PolarHBondContact O-N 2.63Å; M15-C19 PolarHBondContact O-SG 2.93Å; G16-C19 PolarHBondContact O-N 3.01Å; N17-C19 PolarHBondContact O-N 3.24Å; C19-L22 PolarHBondContact O-N 3.3Å; C19-Y23 PolarHBondContact O-N 3.33Å
20	W	95.9	Very high	93.4	Very high	16 Å²	16	67.3 Å²	67.3	6%	0.061	37%	0.365	C	S	.	.	H	α-helix	trans	-73.5	-31.9	-179.3	-76.8	112.6	0	0	0	112.9	H7 G16 N17 L22 Y23 C24 F51 F52 P62 A64 F66	H7-W20 AromaticContact CD2-NE1 3.95Å; H7-W20 AromaticContact NE2-CD1 3.84Å; H7-W20 AromaticContact NE2-NE1 3.38Å; H7-W20 PolarHBondContact NE2-NE1 2.9Å; G16-W20 PolarHBondContact O-N 2.59Å; N17-W20 PolarHBondContact O-N 3.44Å; W20-L22 VanDerWaalsContact C-N 3.32Å; W20-Y23 HydrophobicContact CD2-CD2 4.36Å; W20-Y23 AromaticContact CE3-CD2 3.77Å; W20-Y23 HydrophobicContact CE3-CD2 3.77Å; W20-Y23 HydrophobicContact CE3-CG 4.43Å; W20-Y23 HydrophobicContact CH2-CD2 4.36Å; W20-Y23 AromaticContact CZ3-CD2 3.77Å; W20-Y23 HydrophobicContact CZ3-CD2 3.77Å; W20-Y23 PolarHBondContact O-N 2.81Å; W20-C24 WeakPolarHBondContact O-CB 3.23Å; W20-C24 PolarHBondContact O-N 2.94Å; W20-C24 PolarHBondContact O-SG 3.15Å; W20-F51 HydrophobicContact CH2-CB 3.95Å; W20-F51 WeakPolarHBondContact CH2-O 3.42Å; W20-F51 HydrophobicContact CZ3-CB 4.21Å; W20-F52 HydrophobicContact CE3-CE1 4.03Å; W20-F52 HydrophobicContact CE3-CE2 4.46Å; W20-F52 AromaticContact CE3-CZ 3.76Å; W20-F52 HydrophobicContact CE3-CZ 3.76Å; W20-F52 HydrophobicContact CZ3-CD1 4.33Å; W20-F52 HydrophobicContact CZ3-CD2 4.38Å; W20-F52 AromaticContact CZ3-CE1 3.79Å; W20-F52 HydrophobicContact CZ3-CE1 3.79Å; W20-F52 AromaticContact CZ3-CE2 3.85Å; W20-F52 HydrophobicContact CZ3-CE2 3.85Å; W20-F52 AromaticContact CZ3-CZ 3.53Å; W20-F52 HydrophobicContact CZ3-CZ 3.53Å; W20-P62 HydrophobicContact CD2-CB 3.85Å; W20-P62 HydrophobicContact CD2-CG 4.24Å; W20-P62 HydrophobicContact CE3-CB 3.7Å; W20-P62 HydrophobicContact CE3-CG 3.92Å; W20-P62 HydrophobicContact CH2-CB 3.79Å; W20-P62 HydrophobicContact CZ2-CB 3.94Å; W20-P62 HydrophobicContact CZ3-CB 3.66Å; W20-P62 HydrophobicContact CZ3-CG 4.2Å; W20-A64 HydrophobicContact CZ2-CB 3.7Å; W20-A64 VanDerWaalsContact NE1-CB 3.34Å; W20-F66 AromaticContact CD1-CZ 3.7Å
21	E	94.9	Very high	93.4	Very high	151 Å²	151	69.4 Å²	69.4	71%	0.706	39%	0.387	S	S	*	.	H	α-helix	trans	-59.2	-46.1	169.2	-177	176.3	-159.2	0	0	110.9	N17 C24 L25	N17-E21 WeakPolarHBondContact O-CB 3.49Å; N17-E21 PolarHBondContact O-N 3.26Å; E21-C24 PolarHBondContact O-N 2.87Å; E21-L25 PolarHBondContact O-N 3.08Å
22	L	94.1	Very high	93.4	Very high	85 Å²	85	70.1 Å²	70.1	45%	0.445	38%	0.381	S	S	.	.	H	α-helix	trans	-64.5	-44.5	176.4	-176.6	63.8	0	0	0	112.2	A18 C19 W20 C24 L25 E26	A18-L22 PolarHBondContact O-N 3.08Å; A18-L22 VanDerWaalsContact O-N 3.11Å; C19-L22 PolarHBondContact O-N 3.3Å; W20-L22 VanDerWaalsContact C-N 3.32Å; L22-C24 VanDerWaalsContact C-N 3.33Å; L22-C24 PolarHBondContact O-N 3.49Å; L22-L25 WeakPolarHBondContact O-CB 3.42Å; L22-L25 PolarHBondContact O-N 2.88Å; L22-L25 VanDerWaalsContact O-N 3.14Å; L22-E26 HydrophobicContact CD1-CG 4.22Å; L22-E26 HydrophobicContact CG-CG 4.29Å; L22-E26 WeakPolarHBondContact O-CB 3.26Å; L22-E26 WeakPolarHBondContact O-CG 3.5Å; L22-E26 PolarHBondContact O-N 2.78Å
23	Y	92.1	Very high	93.2	Very high	78 Å²	78	69.4 Å²	69.4	31%	0.306	37%	0.374	S	S	.	.	H	α-helix	trans	-60.5	-42	176.7	-76.7	2.7	0	0	0	112	C19 W20 L25 E26 H27 F51	C19-Y23 PolarHBondContact O-N 3.33Å; W20-Y23 HydrophobicContact CD2-CD2 4.36Å; W20-Y23 AromaticContact CE3-CD2 3.77Å; W20-Y23 HydrophobicContact CE3-CD2 3.77Å; W20-Y23 HydrophobicContact CE3-CG 4.43Å; W20-Y23 HydrophobicContact CH2-CD2 4.36Å; W20-Y23 AromaticContact CZ3-CD2 3.77Å; W20-Y23 HydrophobicContact CZ3-CD2 3.77Å; W20-Y23 PolarHBondContact O-N 2.81Å; Y23-L25 VanDerWaalsContact C-N 3.32Å; Y23-L25 PolarHBondContact O-N 2.97Å; Y23-E26 PolarHBondContact O-N 2.81Å; Y23-H27 WeakPolarHBondContact O-CB 3.07Å; Y23-H27 PolarHBondContact O-CD2 2.93Å; Y23-H27 PolarHBondContact O-N 3.48Å; Y23-H27 VanDerWaalsContact O-N 3.07Å; Y23-F51 HydrophobicContact CE2-CD1 4.44Å
24	C	92.4	Very high	93.1	Very high	27 Å²	27	73 Å²	73	18%	0.182	39%	0.391	C	S	.	.	H	α-helix	trans	-61.1	-43.5	174.9	-73.2	0	0	0	0	111.2	W20 E21 L22 H27 G28 I29	W20-C24 WeakPolarHBondContact O-CB 3.23Å; W20-C24 PolarHBondContact O-N 2.94Å; W20-C24 PolarHBondContact O-SG 3.15Å; E21-C24 PolarHBondContact O-N 2.87Å; L22-C24 VanDerWaalsContact C-N 3.33Å; L22-C24 PolarHBondContact O-N 3.49Å; C24-H27 PolarHBondContact O-N 2.79Å; C24-G28 PolarHBondContact O-N 3.45Å; C24-I29 HydrophobicContact CB-CB 4.12Å; C24-I29 WeakPolarHBondContact CB-O 3.28Å; C24-I29 PolarHBondContact O-N 2.81Å
25	L	90.8	Very high	92.8	Very high	136 Å²	136	69.3 Å²	69.3	71%	0.712	37%	0.374	S	S	*	.	H	α-helix	trans	-63.2	-47.1	177.6	-175.6	67.5	0	0	0	112.5	E21 L22 Y23 H27 G28	E21-L25 PolarHBondContact O-N 3.08Å; L22-L25 WeakPolarHBondContact O-CB 3.42Å; L22-L25 PolarHBondContact O-N 2.88Å; L22-L25 VanDerWaalsContact O-N 3.14Å; Y23-L25 VanDerWaalsContact C-N 3.32Å; Y23-L25 PolarHBondContact O-N 2.97Å; L25-H27 VanDerWaalsContact C-N 3.25Å; L25-H27 PolarHBondContact O-N 3.35Å; L25-G28 PolarHBondContact O-N 2.86Å
26	E	89.9	Confident	91.9	Very high	122 Å²	122	67.5 Å²	67.5	57%	0.57	37%	0.372	S	S	*	.	H	α-helix	trans	-61.7	-34.3	-180	-73.9	176.9	164.8	0	0	112.2	L22 Y23	L22-E26 HydrophobicContact CD1-CG 4.22Å; L22-E26 HydrophobicContact CG-CG 4.29Å; L22-E26 WeakPolarHBondContact O-CB 3.26Å; L22-E26 WeakPolarHBondContact O-CG 3.5Å; L22-E26 PolarHBondContact O-N 2.78Å; Y23-E26 PolarHBondContact O-N 2.81Å
27	H	87.6	Confident	90.5	Very high	65 Å²	65	71.7 Å²	71.7	30%	0.301	40%	0.401	S	S	.	.	H	α-helix	trans	-96.3	1.3	179.8	-66.9	-65.7	0	0	0	114.1	Y23 C24 L25 I29 M35	Y23-H27 WeakPolarHBondContact O-CB 3.07Å; Y23-H27 PolarHBondContact O-CD2 2.93Å; Y23-H27 PolarHBondContact O-N 3.48Å; Y23-H27 VanDerWaalsContact O-N 3.07Å; C24-H27 PolarHBondContact O-N 2.79Å; L25-H27 VanDerWaalsContact C-N 3.25Å; L25-H27 PolarHBondContact O-N 3.35Å; H27-I29 HydrophobicContact CB-CD1 4.07Å; H27-I29 HydrophobicContact CB-CG1 4.09Å; H27-I29 PolarHBondContact O-N 3.28Å; H27-M35 HydrophobicContact CB-CE 4.3Å; H27-M35 VanDerWaalsContact O-CE 3.24Å; H27-M35 WeakPolarHBondContact O-CE 3.32Å
28	G	89.7	Confident	88.7	Confident	33 Å²	33	71.4 Å²	71.4	34%	0.34	40%	0.4	S	S	.	.	T	Hydrogen-bonded Turn	trans	66.9	24.2	-179.1	0	0	0	0	0	114.2	C24 L25	C24-G28 PolarHBondContact O-N 3.45Å; L25-G28 PolarHBondContact O-N 2.86Å
29	I	91.2	Very high	86.6	Confident	10 Å²	10	78.5 Å²	78.5	5%	0.051	42%	0.42	C	S	.	.			trans	-82.6	123.1	174.2	-57	171.2	0	0	0	108	C24 H27 M35 F52 H60	C24-I29 HydrophobicContact CB-CB 4.12Å; C24-I29 WeakPolarHBondContact CB-O 3.28Å; C24-I29 PolarHBondContact O-N 2.81Å; H27-I29 HydrophobicContact CB-CD1 4.07Å; H27-I29 HydrophobicContact CB-CG1 4.09Å; H27-I29 PolarHBondContact O-N 3.28Å; I29-M35 HydrophobicContact CD1-CE 3.97Å; I29-M35 HydrophobicContact CG1-CE 3.41Å; I29-M35 VanDerWaalsContact CG1-CE 3.41Å; I29-F52 HydrophobicContact CD1-CD1 3.82Å; I29-F52 HydrophobicContact CD1-CD2 4.1Å; I29-F52 HydrophobicContact CD1-CE1 3.56Å; I29-F52 HydrophobicContact CD1-CE2 3.88Å; I29-F52 HydrophobicContact CD1-CG 4.08Å; I29-F52 HydrophobicContact CD1-CZ 3.59Å; I29-H60 HydrophobicContact CD1-CB 3.83Å; I29-H60 HydrophobicContact CG1-CB 4.3Å; I29-H60 HydrophobicContact CG2-CB 4.11Å
30	Q	93.3	Very high	84.3	Confident	89 Å²	89	78.9 Å²	78.9	42%	0.416	42%	0.421	S	S	.	.			trans	-71.4	161.2	175.6	-67.2	-168	2	0	0	111.5	D32 G33 Q34 P36	Q30-D32 VanDerWaalsContact CB-OD1 3.23Å; Q30-D32 WeakPolarHBondContact CB-OD1 3.3Å; Q30-D32 PolarHBondContact O-N 3.35Å; Q30-D32 VanDerWaalsContact O-N 3.08Å; Q30-G33 WeakPolarHBondContact O-CA 3.37Å; Q30-G33 PolarHBondContact O-N 2.88Å; Q30-Q34 WeakPolarHBondContact CB-O 3.35Å; Q30-Q34 PolarHBondContact N-O 2.84Å; Q30-P36 HydrophobicContact CG-CG 4.19Å
31	P	92.8	Very high	82.1	Confident	144 Å²	144	86.6 Å²	86.6	94%	0.935	46%	0.461	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.1	-23.9	178.3	-26.6	35.7	0	0	0	114.7	G33	P31-G33 VanDerWaalsContact C-N 3.25Å
32	D	93.7	Very high	80	Confident	83 Å²	83	83.2 Å²	83.2	44%	0.444	47%	0.467	S	S	.	.	T	Hydrogen-bonded Turn	trans	-80.9	-6	174.4	69.6	-8.5	0	0	0	113.5	Q30 Q34 K59	Q30-D32 VanDerWaalsContact CB-OD1 3.23Å; Q30-D32 WeakPolarHBondContact CB-OD1 3.3Å; Q30-D32 PolarHBondContact O-N 3.35Å; Q30-D32 VanDerWaalsContact O-N 3.08Å; D32-Q34 VanDerWaalsContact OD1-CB 3.28Å; D32-Q34 WeakPolarHBondContact OD1-CB 3.24Å; D32-Q34 WeakPolarHBondContact OD1-CG 3.41Å; D32-Q34 PolarHBondContact OD1-N 2.82Å; D32-Q34 WeakPolarHBondContact OD2-CG 3.3Å; D32-K59 WeakPolarHBondContact O-CD 3.47Å; D32-K59 WeakPolarHBondContact O-CE 3.45Å; D32-K59 PolarHBondContact O-NZ 2.92Å
33	G	91.9	Very high	77.9	Confident	5 Å²	5	82.1 Å²	82.1	5%	0.052	48%	0.476	C	S	.	.	S	Bend	trans	87.9	7.2	-178	0	0	0	0	0	114.4	Q30 P31 H60	Q30-G33 WeakPolarHBondContact O-CA 3.37Å; Q30-G33 PolarHBondContact O-N 2.88Å; P31-G33 VanDerWaalsContact C-N 3.25Å; G33-H60 PolarHBondContact O-N 3.35Å
34	Q	91.9	Very high	75.6	Confident	76 Å²	76	80.4 Å²	80.4	36%	0.355	48%	0.482	S	S	.	.			trans	-80.2	145.8	175.7	-66.8	-66.4	-22.3	0	0	111.3	Q30 D32	Q30-Q34 WeakPolarHBondContact CB-O 3.35Å; Q30-Q34 PolarHBondContact N-O 2.84Å; D32-Q34 VanDerWaalsContact OD1-CB 3.28Å; D32-Q34 WeakPolarHBondContact OD1-CB 3.24Å; D32-Q34 WeakPolarHBondContact OD1-CG 3.41Å; D32-Q34 PolarHBondContact OD1-N 2.82Å; D32-Q34 WeakPolarHBondContact OD2-CG 3.3Å
35	M	88	Confident	74	Confident	25 Å²	25	84.9 Å²	84.9	12%	0.123	50%	0.504	C	S	.	.			trans	-121.7	87.9	173.9	-169.9	-171.3	-68.6	0	0	109.1	H27 I29 S37 D38 F48	H27-M35 HydrophobicContact CB-CE 4.3Å; H27-M35 VanDerWaalsContact O-CE 3.24Å; H27-M35 WeakPolarHBondContact O-CE 3.32Å; I29-M35 HydrophobicContact CD1-CE 3.97Å; I29-M35 HydrophobicContact CG1-CE 3.41Å; I29-M35 VanDerWaalsContact CG1-CE 3.41Å; M35-S37 PolarHBondContact O-N 2.87Å; M35-S37 VanDerWaalsContact O-N 3.17Å; M35-D38 HydrophobicContact CG-CB 4.42Å; M35-D38 PolarHBondContact O-N 3.38Å; M35-D38 HydrophobicContact SD-CB 4.12Å; M35-F48 HydrophobicContact CE-CE2 4.29Å; M35-F48 HydrophobicContact CE-CZ 4.36Å
36	P	77.6	Confident	72.7	Confident	91 Å²	91	84.1 Å²	84.1	59%	0.591	50%	0.501	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.1	-18.4	-172.1	-11.8	21.3	0	0	0	114.4	Q30 D38	Q30-P36 HydrophobicContact CG-CG 4.19Å; P36-D38 VanDerWaalsContact C-N 3.31Å
37	S	66.4	Low	71.7	Confident	87 Å²	87	81.3 Å²	81.3	61%	0.608	50%	0.495	S	S	*	.	T	Hydrogen-bonded Turn	trans	-81	-8.6	-178.4	45.8	0	0	0	0	113.7	M35 K39	M35-S37 PolarHBondContact O-N 2.87Å; M35-S37 VanDerWaalsContact O-N 3.17Å; S37-K39 PolarHBondContact O-N 3.41Å
38	D	57.2	Low	71.2	Confident	59 Å²	59	79.7 Å²	79.7	32%	0.316	49%	0.487	S	S	.	.			trans	-82.2	87.8	-176.5	-152.9	-5	0	0	0	111.6	M35 P36 T40	M35-D38 HydrophobicContact CG-CB 4.42Å; M35-D38 PolarHBondContact O-N 3.38Å; M35-D38 HydrophobicContact SD-CB 4.12Å; P36-D38 VanDerWaalsContact C-N 3.31Å; D38-T40 PolarHBondContact O-N 2.93Å; D38-T40 VanDerWaalsContact OD1-C 3.3Å; D38-T40 VanDerWaalsContact OD1-CA 3.31Å; D38-T40 WeakPolarHBondContact OD1-CA 3.5Å; D38-T40 WeakPolarHBondContact OD1-CB 3.35Å; D38-T40 PolarHBondContact OD1-N 3.47Å; D38-T40 PolarHBondContact OD1-OG1 3.42Å
39	K	50.3	Low	70.9	Confident	207 Å²	207	81 Å²	81	90%	0.9	49%	0.488	S	S	*	.			trans	-77.4	4.6	163.4	-75.9	-170.7	178.3	179.2	0	112.4	S37	S37-K39 PolarHBondContact O-N 3.41Å
40	T	49	Very low	70.9	Confident	68 Å²	68	81.9 Å²	81.9	42%	0.417	49%	0.494	S	S	.	.			trans	-114.4	73.4	179.1	31.3	0	0	0	0	109.5	D38 G42	D38-T40 PolarHBondContact O-N 2.93Å; D38-T40 VanDerWaalsContact OD1-C 3.3Å; D38-T40 VanDerWaalsContact OD1-CA 3.31Å; D38-T40 WeakPolarHBondContact OD1-CA 3.5Å; D38-T40 WeakPolarHBondContact OD1-CB 3.35Å; D38-T40 PolarHBondContact OD1-N 3.47Å; D38-T40 PolarHBondContact OD1-OG1 3.42Å; T40-G42 PolarHBondContact O-N 3.15Å
41	I	48.9	Very low	70.9	Confident	177 Å²	177	80.6 Å²	80.6	91%	0.908	49%	0.487	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.2	94.4	152.4	-59.6	175.6	0	0	0	106.4
42	G	50.3	Low	71	Confident	81 Å²	81	73.8 Å²	73.8	84%	0.835	44%	0.443	S	S	*	.	T	Hydrogen-bonded Turn	trans	84.1	43.6	173.5	0	0	0	0	0	118.5	T40	T40-G42 PolarHBondContact O-N 3.15Å
43	G	50.2	Low	70.9	Confident	61 Å²	61	71.9 Å²	71.9	63%	0.629	44%	0.436	S	S	*	.			trans	-163.7	14.8	179.2	0	0	0	0	0	122.7
44	G	45.3	Very low	70.8	Confident	42 Å²	42	78.2 Å²	78.2	43%	0.433	46%	0.464	S	S	.	.	S	Bend	trans	-143	99.4	-175.1	0	0	0	0	0	114.6
45	D	57.3	Low	70.7	Confident	122 Å²	122	77.2 Å²	77.2	65%	0.652	46%	0.463	S	S	*	.			trans	54.6	79	173.1	-151.3	-16.9	0	0	0	116	S47 F48	D45-S47 PolarHBondContact O-N 3.07Å; D45-S47 WeakPolarHBondContact OD1-CB 3.3Å; D45-S47 PolarHBondContact OD1-N 2.96Å; D45-S47 PolarHBondContact OD1-OG 3.24Å; D45-F48 VanDerWaalsContact O-CD1 3.3Å; D45-F48 WeakPolarHBondContact O-CD1 3.12Å; D45-F48 WeakPolarHBondContact O-CE1 3.33Å
46	D	63.8	Low	70.5	Confident	119 Å²	119	80.7 Å²	80.7	64%	0.636	51%	0.505	S	S	*	.	G	3₁₀ helix	trans	-58.5	0.6	176.9	-66.8	-34.3	0	0	0	115	F48 T49	D46-F48 VanDerWaalsContact C-N 3.3Å; D46-F48 PolarHBondContact O-N 3.45Å; D46-T49 HydrophobicContact CB-CG2 4.49Å; D46-T49 WeakPolarHBondContact O-CB 3.4Å; D46-T49 PolarHBondContact O-N 3.35Å; D46-T49 VanDerWaalsContact O-N 3.15Å; D46-T49 PolarHBondContact O-OG1 3.24Å
47	S	69.1	Low	71.1	Confident	64 Å²	64	80 Å²	80	45%	0.448	51%	0.508	S	S	.	.	G	3₁₀ helix	trans	-61.7	-33.6	-174.9	55.3	0	0	0	0	113.2	D45 T49 T50	D45-S47 PolarHBondContact O-N 3.07Å; D45-S47 WeakPolarHBondContact OD1-CB 3.3Å; D45-S47 PolarHBondContact OD1-N 2.96Å; D45-S47 PolarHBondContact OD1-OG 3.24Å; S47-T49 PolarHBondContact O-N 3.16Å; S47-T50 WeakPolarHBondContact O-CB 3.49Å; S47-T50 PolarHBondContact O-N 2.93Å; S47-T50 PolarHBondContact O-OG1 3.34Å
48	F	77.3	Confident	72	Confident	30 Å²	30	76.9 Å²	76.9	13%	0.132	49%	0.489	C	S	.	.	G	3₁₀ helix	trans	-75.3	-19.9	177.8	72.9	-91	0	0	0	113.7	M35 D45 D46 T50 F51 F52 H60	M35-F48 HydrophobicContact CE-CE2 4.29Å; M35-F48 HydrophobicContact CE-CZ 4.36Å; D45-F48 VanDerWaalsContact O-CD1 3.3Å; D45-F48 WeakPolarHBondContact O-CD1 3.12Å; D45-F48 WeakPolarHBondContact O-CE1 3.33Å; D46-F48 VanDerWaalsContact C-N 3.3Å; D46-F48 PolarHBondContact O-N 3.45Å; F48-T50 PolarHBondContact O-N 3.43Å; F48-T50 VanDerWaalsContact O-N 3.08Å; F48-F51 PolarHBondContact O-N 3.45Å; F48-F52 HydrophobicContact CB-CD2 4.47Å; F48-F52 HydrophobicContact CD2-CB 4.43Å; F48-F52 HydrophobicContact CD2-CD2 4.35Å; F48-F52 PolarHBondContact O-N 2.8Å; F48-H60 AromaticContact CE2-CD2 3.6Å; F48-H60 AromaticContact CE2-NE2 3.64Å
49	T	83.9	Confident	73.6	Confident	60 Å²	60	78.4 Å²	78.4	37%	0.368	49%	0.492	S	S	.	.	G	3₁₀ helix	trans	-62.2	-16.9	173.1	72.4	0	0	0	0	112.4	D46 S47 F51 F52 R63	D46-T49 HydrophobicContact CB-CG2 4.49Å; D46-T49 WeakPolarHBondContact O-CB 3.4Å; D46-T49 PolarHBondContact O-N 3.35Å; D46-T49 VanDerWaalsContact O-N 3.15Å; D46-T49 PolarHBondContact O-OG1 3.24Å; S47-T49 PolarHBondContact O-N 3.16Å; T49-F51 VanDerWaalsContact C-N 3.26Å; T49-F51 PolarHBondContact O-N 3.34Å; T49-F52 CarbonylContact C-O 3.45Å; T49-F52 WeakPolarHBondContact CA-O 3.43Å; T49-R63 PolarHBondContact O-NE 2.85Å; T49-R63 PolarHBondContact O-NH2 3.21Å
50	T	91	Very high	75.6	Confident	30 Å²	30	69 Å²	69	18%	0.184	45%	0.452	C	S	.	.	G	3₁₀ helix	trans	-56.1	-40.9	167.3	-57.2	0	0	0	0	111.7	R1 C3 S47 F48 R63	R1-T50 WeakPolarHBondContact O-CB 3.31Å; R1-T50 VanDerWaalsContact O-CG2 3.26Å; R1-T50 WeakPolarHBondContact O-CG2 3.31Å; R1-T50 PolarHBondContact O-OG1 3.35Å; C3-T50 HydrophobicContact CB-CG2 3.94Å; C3-T50 PolarHBondContact N-O 3.35Å; S47-T50 WeakPolarHBondContact O-CB 3.49Å; S47-T50 PolarHBondContact O-N 2.93Å; S47-T50 PolarHBondContact O-OG1 3.34Å; F48-T50 PolarHBondContact O-N 3.43Å; F48-T50 VanDerWaalsContact O-N 3.08Å; T50-R63 WeakPolarHBondContact O-CD 3.49Å
51	F	93.6	Very high	77.8	Confident	61 Å²	61	68.1 Å²	68.1	27%	0.268	45%	0.446	S	S	.	.	T	Hydrogen-bonded Turn	trans	-107.6	-24.4	-172.3	-64.8	-73	0	0	0	113.4	C3 W20 Y23 F48 T49 R63	C3-F51 HydrophobicContact CB-CD1 4.11Å; C3-F51 HydrophobicContact CB-CE1 3.84Å; W20-F51 HydrophobicContact CH2-CB 3.95Å; W20-F51 WeakPolarHBondContact CH2-O 3.42Å; W20-F51 HydrophobicContact CZ3-CB 4.21Å; Y23-F51 HydrophobicContact CE2-CD1 4.44Å; F48-F51 PolarHBondContact O-N 3.45Å; T49-F51 VanDerWaalsContact C-N 3.26Å; T49-F51 PolarHBondContact O-N 3.34Å; F51-R63 VanDerWaalsContact O-CB 3.32Å; F51-R63 WeakPolarHBondContact O-CB 3.41Å; F51-R63 WeakPolarHBondContact O-CG 3.36Å; F51-R63 PolarHBondContact O-N 2.9Å
52	F	93.4	Very high	80.1	Confident	2 Å²	2	62 Å²	62	1%	0.009	42%	0.418	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.8	149.1	177.5	-64.1	-92.5	0	0	0	111.4	W20 I29 F48 T49 H60 V61 P62 R63	W20-F52 HydrophobicContact CE3-CE1 4.03Å; W20-F52 HydrophobicContact CE3-CE2 4.46Å; W20-F52 AromaticContact CE3-CZ 3.76Å; W20-F52 HydrophobicContact CE3-CZ 3.76Å; W20-F52 HydrophobicContact CZ3-CD1 4.33Å; W20-F52 HydrophobicContact CZ3-CD2 4.38Å; W20-F52 AromaticContact CZ3-CE1 3.79Å; W20-F52 HydrophobicContact CZ3-CE1 3.79Å; W20-F52 AromaticContact CZ3-CE2 3.85Å; W20-F52 HydrophobicContact CZ3-CE2 3.85Å; W20-F52 AromaticContact CZ3-CZ 3.53Å; W20-F52 HydrophobicContact CZ3-CZ 3.53Å; I29-F52 HydrophobicContact CD1-CD1 3.82Å; I29-F52 HydrophobicContact CD1-CD2 4.1Å; I29-F52 HydrophobicContact CD1-CE1 3.56Å; I29-F52 HydrophobicContact CD1-CE2 3.88Å; I29-F52 HydrophobicContact CD1-CG 4.08Å; I29-F52 HydrophobicContact CD1-CZ 3.59Å; F48-F52 HydrophobicContact CB-CD2 4.47Å; F48-F52 HydrophobicContact CD2-CB 4.43Å; F48-F52 HydrophobicContact CD2-CD2 4.35Å; F48-F52 PolarHBondContact O-N 2.8Å; T49-F52 CarbonylContact C-O 3.45Å; T49-F52 WeakPolarHBondContact CA-O 3.43Å; F52-H60 HydrophobicContact CD1-CB 4.23Å; F52-V61 CarbonylContact C-O 3.53Å; F52-V61 VanDerWaalsContact CA-O 3.3Å; F52-V61 WeakPolarHBondContact CA-O 3.43Å; F52-P62 HydrophobicContact CD1-CG 4.25Å; F52-P62 HydrophobicContact CE1-CB 4.5Å; F52-P62 HydrophobicContact CE1-CG 3.91Å; F52-R63 PolarHBondContact O-NE 3.11Å; F52-R63 VanDerWaalsContact O-NE 3.17Å; F52-R63 PolarHBondContact O-NH2 2.9Å
53	C	92.2	Very high	82.3	Confident	43 Å²	43	61.6 Å²	61.6	29%	0.291	39%	0.391	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.9	144.1	160.5	62	0	0	0	0	110.1	H60 V61	C53-H60 WeakPolarHBondContact O-CA 3.45Å; C53-V61 PolarHBondContact N-O 3.48Å; C53-V61 PolarHBondContact O-N 2.82Å
54	E	90.6	Very high	84.5	Confident	138 Å²	138	60 Å²	60	65%	0.645	37%	0.372	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-97.2	133.8	174.8	-161.7	-168.1	159	0	0	109.6	K59	E54-K59 WeakPolarHBondContact CA-O 3.45Å
55	T	89.2	Confident	86.9	Confident	54 Å²	54	61.4 Å²	61.4	33%	0.331	37%	0.372	S	S	.	.			trans	-88.1	161.1	171	67.8	0	0	0	0	110.3	A57 G58 K59 V61	T55-A57 PolarHBondContact O-N 3.33Å; T55-A57 PolarHBondContact OG1-N 3.41Å; T55-G58 PolarHBondContact O-N 3.46Å; T55-K59 HydrophobicContact CG2-CB 4.34Å; T55-K59 PolarHBondContact N-O 2.91Å; T55-K59 VanDerWaalsContact OG1-CB 3.31Å; T55-K59 WeakPolarHBondContact OG1-CB 3.26Å; T55-K59 PolarHBondContact OG1-N 3.44Å; T55-K59 PolarHBondContact OG1-O 2.92Å; T55-V61 HydrophobicContact CG2-CG2 3.94Å
56	G	84.6	Confident	88.7	Confident	98 Å²	98	58.5 Å²	58.5	100%	1.01	35%	0.354	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.2	-8.9	174.6	0	0	0	0	0	115.3
57	A	88.6	Confident	90.2	Very high	78 Å²	78	55.9 Å²	55.9	65%	0.645	34%	0.342	S	S	*	.	T	Hydrogen-bonded Turn	trans	-95.8	10.9	173.8	0	0	0	0	0	113.3	T55 K59	T55-A57 PolarHBondContact O-N 3.33Å; T55-A57 PolarHBondContact OG1-N 3.41Å; A57-K59 PolarHBondContact O-N 3.21Å
58	G	86.5	Confident	91.3	Very high	20 Å²	20	54.4 Å²	54.4	21%	0.206	33%	0.329	C	S	.	.	S	Bend	trans	75.9	6.8	-178.7	0	0	0	0	0	114.5	T55 H60	T55-G58 PolarHBondContact O-N 3.46Å; G58-H60 PolarHBondContact O-ND1 3.4Å
59	K	91.3	Very high	92	Very high	91 Å²	91	61.1 Å²	61.1	40%	0.396	37%	0.365	S	S	.	.			trans	-77.4	128.3	177.2	-172	177.6	177.4	160.8	0	110.8	D32 E54 T55 A57 V61	D32-K59 WeakPolarHBondContact O-CD 3.47Å; D32-K59 WeakPolarHBondContact O-CE 3.45Å; D32-K59 PolarHBondContact O-NZ 2.92Å; E54-K59 WeakPolarHBondContact CA-O 3.45Å; T55-K59 HydrophobicContact CG2-CB 4.34Å; T55-K59 PolarHBondContact N-O 2.91Å; T55-K59 VanDerWaalsContact OG1-CB 3.31Å; T55-K59 WeakPolarHBondContact OG1-CB 3.26Å; T55-K59 PolarHBondContact OG1-N 3.44Å; T55-K59 PolarHBondContact OG1-O 2.92Å; A57-K59 PolarHBondContact O-N 3.21Å; K59-V61 HydrophobicContact CD-CG2 4.19Å; K59-V61 HydrophobicContact CG-CG2 4.09Å
60	H	92.4	Very high	92.1	Very high	10 Å²	10	63.5 Å²	63.5	5%	0.046	37%	0.372	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.1	121.1	170.7	-64.4	78.2	0	0	0	110	I29 G33 F48 F52 C53 G58	I29-H60 HydrophobicContact CD1-CB 3.83Å; I29-H60 HydrophobicContact CG1-CB 4.3Å; I29-H60 HydrophobicContact CG2-CB 4.11Å; G33-H60 PolarHBondContact O-N 3.35Å; F48-H60 AromaticContact CE2-CD2 3.6Å; F48-H60 AromaticContact CE2-NE2 3.64Å; F52-H60 HydrophobicContact CD1-CB 4.23Å; C53-H60 WeakPolarHBondContact O-CA 3.45Å; G58-H60 PolarHBondContact O-ND1 3.4Å
61	V	94.9	Very high	91.5	Very high	50 Å²	50	67.9 Å²	67.9	30%	0.303	40%	0.401	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118	124.5	-175.3	178.1	0	0	0	0	109.4	F52 C53 T55 K59 R63	F52-V61 CarbonylContact C-O 3.53Å; F52-V61 VanDerWaalsContact CA-O 3.3Å; F52-V61 WeakPolarHBondContact CA-O 3.43Å; C53-V61 PolarHBondContact N-O 3.48Å; C53-V61 PolarHBondContact O-N 2.82Å; T55-V61 HydrophobicContact CG2-CG2 3.94Å; K59-V61 HydrophobicContact CD-CG2 4.19Å; K59-V61 HydrophobicContact CG-CG2 4.09Å; V61-R63 PolarHBondContact O-N 3.14Å
62	P	96.2	Very high	90.6	Very high	48 Å²	48	69.9 Å²	69.9	31%	0.312	42%	0.418	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-56.2	135.9	174.9	-28	35.9	0	0	0	112.7	W20 F52 A64	W20-P62 HydrophobicContact CD2-CB 3.85Å; W20-P62 HydrophobicContact CD2-CG 4.24Å; W20-P62 HydrophobicContact CE3-CB 3.7Å; W20-P62 HydrophobicContact CE3-CG 3.92Å; W20-P62 HydrophobicContact CH2-CB 3.79Å; W20-P62 HydrophobicContact CZ2-CB 3.94Å; W20-P62 HydrophobicContact CZ3-CB 3.66Å; W20-P62 HydrophobicContact CZ3-CG 4.2Å; F52-P62 HydrophobicContact CD1-CG 4.25Å; F52-P62 HydrophobicContact CE1-CB 4.5Å; F52-P62 HydrophobicContact CE1-CG 3.91Å; P62-A64 HydrophobicContact CB-CB 4.06Å; P62-A64 PolarHBondContact O-N 2.98Å
63	R	96.2	Very high	89.3	Confident	73 Å²	73	70.4 Å²	70.4	28%	0.275	42%	0.422	S	S	.	.			trans	-80.5	66.6	166.9	-62.1	174.8	-171.1	-82.3	2.4	109.1	C3 I4 S5 T49 T50 F51 F52 V61	C3-R63 VanDerWaalsContact O-CB 3.3Å; C3-R63 WeakPolarHBondContact O-CB 3.35Å; I4-R63 WeakPolarHBondContact CA-O 3.48Å; S5-R63 PolarHBondContact N-O 3.02Å; T49-R63 PolarHBondContact O-NE 2.85Å; T49-R63 PolarHBondContact O-NH2 3.21Å; T50-R63 WeakPolarHBondContact O-CD 3.49Å; F51-R63 VanDerWaalsContact O-CB 3.32Å; F51-R63 WeakPolarHBondContact O-CB 3.41Å; F51-R63 WeakPolarHBondContact O-CG 3.36Å; F51-R63 PolarHBondContact O-N 2.9Å; F52-R63 PolarHBondContact O-NE 3.11Å; F52-R63 VanDerWaalsContact O-NE 3.17Å; F52-R63 PolarHBondContact O-NH2 2.9Å; V61-R63 PolarHBondContact O-N 3.14Å
64	A	96.8	Very high	88.2	Confident	27 Å²	27	72.4 Å²	72.4	22%	0.223	43%	0.429	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.3	144.5	-174.6	0	0	0	0	0	112.4	S5 W20 P62 F66	S5-A64 CarbonylContact O-C 3.54Å; S5-A64 VanDerWaalsContact O-CA 3.26Å; S5-A64 WeakPolarHBondContact O-CA 3.45Å; W20-A64 HydrophobicContact CZ2-CB 3.7Å; W20-A64 VanDerWaalsContact NE1-CB 3.34Å; P62-A64 HydrophobicContact CB-CB 4.06Å; P62-A64 PolarHBondContact O-N 2.98Å; A64-F66 HydrophobicContact CB-CD2 4.33Å; A64-F66 HydrophobicContact CB-CE2 3.76Å
65	V	96.3	Very high	86.8	Confident	71 Å²	71	74.6 Å²	74.6	43%	0.43	45%	0.451	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.6	127.4	170	-177.5	0	0	0	0	108.2	I4 S5 V6 H7 V67	I4-V65 HydrophobicContact CG2-CG2 4.44Å; S5-V65 PolarHBondContact O-N 3.15Å; V6-V65 WeakPolarHBondContact CA-O 3.39Å; H7-V65 PolarHBondContact N-O 3.47Å; V65-V67 HydrophobicContact CG1-CG2 3.89Å
66	F	95.3	Very high	86.7	Confident	62 Å²	62	75.6 Å²	75.6	27%	0.272	46%	0.457	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.5	128.3	175.5	-66.7	-97.2	0	0	0	108.9	H7 V13 N17 W20 A64	H7-F66 HydrophobicContact CB-CD1 3.68Å; H7-F66 HydrophobicContact CB-CE1 3.98Å; H7-F66 HydrophobicContact CB-CG 4.36Å; H7-F66 AromaticContact CD2-CE1 3.62Å; H7-F66 AromaticContact CD2-CZ 3.75Å; H7-F66 AromaticContact CG-CE1 3.98Å; H7-F66 WeakPolarHBondContact O-CA 3.34Å; V13-F66 HydrophobicContact CB-CD1 4.17Å; V13-F66 HydrophobicContact CG1-CD1 3.86Å; V13-F66 HydrophobicContact CG1-CE1 4.47Å; V13-F66 HydrophobicContact CG2-CB 4.34Å; V13-F66 HydrophobicContact CG2-CD1 4.11Å; N17-F66 WeakPolarHBondContact OD1-CE1 3.37Å; W20-F66 AromaticContact CD1-CZ 3.7Å; A64-F66 HydrophobicContact CB-CD2 4.33Å; A64-F66 HydrophobicContact CB-CE2 3.76Å
67	V	94.5	Very high	86.8	Confident	63 Å²	63	74.4 Å²	74.4	38%	0.382	43%	0.428	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.9	121.6	-178	-174	0	0	0	0	108.9	H7 V8 G9 V65	H7-V67 PolarHBondContact O-N 3.07Å; V8-V67 CarbonylContact C-O 3.52Å; V8-V67 WeakPolarHBondContact CA-O 3.3Å; V8-V67 HydrophobicContact CG2-CB 4.46Å; G9-V67 PolarHBondContact N-O 3.49Å; V65-V67 HydrophobicContact CG1-CG2 3.89Å
68	D	92.8	Very high	86.7	Confident	34 Å²	34	74.2 Å²	74.2	18%	0.182	42%	0.416	C	S	.	.			trans	-138	147.7	170.3	-155.1	-19	0	0	0	108.7	Q10 V13 E70 I74	Q10-D68 WeakPolarHBondContact CA-OD2 3.44Å; Q10-D68 PolarHBondContact N-OD2 3.01Å; V13-D68 HydrophobicContact CG2-CB 4.4Å; D68-E70 VanDerWaalsContact C-N 3.34Å; D68-E70 PolarHBondContact OD1-N 3.28Å; D68-I74 HydrophobicContact CB-CD1 3.87Å; D68-I74 HydrophobicContact CB-CG1 3.98Å
69	L	91.6	Very high	86.7	Confident	170 Å²	170	77.4 Å²	77.4	89%	0.89	43%	0.428	S	S	*	.	S	Bend	trans	-90.1	-8.2	174.4	-60.9	-178.2	0	0	0	111.6
70	E	86.4	Confident	86.4	Confident	111 Å²	111	76.6 Å²	76.6	52%	0.519	43%	0.43	S	S	.	.	S	Bend	trans	-113.7	132.5	174	-62	-174.8	-179.8	0	0	110.4	D68 T72	D68-E70 VanDerWaalsContact C-N 3.34Å; D68-E70 PolarHBondContact OD1-N 3.28Å; E70-T72 PolarHBondContact O-N 3.27Å; E70-T72 VanDerWaalsContact O-N 3.16Å
71	P	77.9	Confident	86	Confident	121 Å²	121	81 Å²	81	79%	0.786	46%	0.456	S	S	*	.	T	Hydrogen-bonded Turn	trans	-77.4	1.6	-172.9	32.3	-37	0	0	0	114
72	T	74.4	Confident	85.3	Confident	103 Å²	103	83.2 Å²	83.2	63%	0.632	47%	0.467	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.6	-16.8	-169.6	45.5	0	0	0	0	113.8	E70	E70-T72 PolarHBondContact O-N 3.27Å; E70-T72 VanDerWaalsContact O-N 3.16Å
73	V	67.4	Low	84.5	Confident	13 Å²	13	85.9 Å²	85.9	8%	0.079	48%	0.478	C	S	.	.	S	Bend	trans	-115	-22.5	-167.5	-170.2	0	0	0	0	113.3	Q10 V13 Q14 V75	Q10-V73 HydrophobicContact CB-CG2 3.95Å; Q10-V73 HydrophobicContact CG-CG1 4.25Å; Q10-V73 HydrophobicContact CG-CG2 3.66Å; V13-V73 HydrophobicContact CB-CG1 3.93Å; V13-V73 HydrophobicContact CG1-CG1 3.76Å; Q14-V73 HydrophobicContact CG-CG1 3.7Å; V73-V75 PolarHBondContact O-N 3.22Å
74	I	68.9	Low	83.5	Confident	86 Å²	86	87 Å²	87	44%	0.441	50%	0.495	S	S	.	.			trans	-83.3	106.7	176.7	-54.5	175.7	0	0	0	108.3	D68	D68-I74 HydrophobicContact CB-CD1 3.87Å; D68-I74 HydrophobicContact CB-CG1 3.98Å
75	V	60.3	Low	82.3	Confident	183 Å²	183	92.5 Å²	92.5	100%	1.109	52%	0.52	S	S	*	.			trans	-129.6	0	177.5	-136.2	0	0	0	0	110.5	V73	V73-V75 PolarHBondContact O-N 3.22Å

Retrieved 75 of 75 residues in 33 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).