A0A087WS44_MOUSE Loading...

Sulfatase 1

AlphaFold DB , UniProt , Accession A0A087WS44, Species MOUSE (Mus musculus, Mouse), Gene Sulf1, Length 37 aa.

						>A0A087WS44_MOUSE|A0A087WS44|Sulf1
MKYSLWALLLAVLGTQLLGSLCSTVRSQRFRGRIQQE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	58.1	Low	81.8	Confident	220 Å²	220	128 Å²	128	100%	1.084	65%	0.647	S	S	*	*				0	70.2	0	-65.8	-162.8	172.6	0	0	111.2
2	K	63.6	Low	82.4	Confident	181 Å²	181	123.9 Å²	123.9	79%	0.787	63%	0.633	S	S	*	*			trans	-92.6	-20	-177.4	-87.1	143	71.3	175.4	0	113.8
3	Y	75.2	Confident	83	Confident	192 Å²	192	123.2 Å²	123.2	75%	0.753	63%	0.631	S	S	*	*	S	Bend	trans	-95.2	-9.6	-179	-55.5	-73.7	0	0	0	114	L5 W6 A7	Y3-L5 PolarHBondContact O-N 3.32Å; Y3-W6 PolarHBondContact O-N 2.94Å; Y3-A7 WeakPolarHBondContact O-CB 3.34Å; Y3-A7 PolarHBondContact O-N 3.02Å
4	S	78.1	Confident	83.3	Confident	75 Å²	75	117.3 Å²	117.3	52%	0.524	62%	0.615	S	S	.	*	H	α-helix	trans	-66	-39.5	-177.9	177.9	0	0	0	0	111.6	A7 L8	S4-A7 PolarHBondContact O-N 2.92Å; S4-L8 WeakPolarHBondContact O-CB 3.49Å; S4-L8 PolarHBondContact O-N 3.35Å
5	L	84.8	Confident	83.5	Confident	121 Å²	121	115.5 Å²	115.5	63%	0.634	61%	0.611	S	S	*	*	H	α-helix	trans	-66	-41.1	176.5	-160.8	79.1	0	0	0	111.8	Y3 L8 L9	Y3-L5 PolarHBondContact O-N 3.32Å; L5-L8 PolarHBondContact O-N 3.49Å; L5-L9 WeakPolarHBondContact O-CG 3.44Å; L5-L9 PolarHBondContact O-N 3.34Å
6	W	86.7	Confident	83.6	Confident	172 Å²	172	117.4 Å²	117.4	65%	0.652	62%	0.616	S	S	*	*	H	α-helix	trans	-66.8	-40.9	176.8	-75.1	102.6	0	0	0	112.3	Y3 L8 L9 L10	Y3-W6 PolarHBondContact O-N 2.94Å; W6-L8 VanDerWaalsContact C-N 3.32Å; W6-L8 PolarHBondContact O-N 3.3Å; W6-L9 PolarHBondContact O-N 2.94Å; W6-L10 WeakPolarHBondContact O-CB 3.46Å; W6-L10 WeakPolarHBondContact O-CD1 3.45Å; W6-L10 WeakPolarHBondContact O-CG 3.4Å; W6-L10 PolarHBondContact O-N 3.5Å
7	A	89.2	Confident	83.5	Confident	57 Å²	57	116.7 Å²	116.7	47%	0.471	61%	0.612	S	S	.	*	H	α-helix	trans	-62.6	-40.1	173.4	0	0	0	0	0	111.7	Y3 S4 L10 A11	Y3-A7 WeakPolarHBondContact O-CB 3.34Å; Y3-A7 PolarHBondContact O-N 3.02Å; S4-A7 PolarHBondContact O-N 2.92Å; A7-L10 PolarHBondContact O-N 3.48Å; A7-A11 VanDerWaalsContact O-CB 3.28Å; A7-A11 WeakPolarHBondContact O-CB 3.29Å; A7-A11 PolarHBondContact O-N 2.87Å
8	L	90.1	Very high	83.5	Confident	115 Å²	115	117 Å²	117	60%	0.602	61%	0.613	S	S	*	*	H	α-helix	trans	-65.1	-44.8	176.1	-151.1	86.5	0	0	0	111.3	S4 L5 W6 A11 V12	S4-L8 WeakPolarHBondContact O-CB 3.49Å; S4-L8 PolarHBondContact O-N 3.35Å; L5-L8 PolarHBondContact O-N 3.49Å; W6-L8 VanDerWaalsContact C-N 3.32Å; W6-L8 PolarHBondContact O-N 3.3Å; L8-A11 PolarHBondContact O-N 3.37Å; L8-V12 WeakPolarHBondContact O-CB 3.35Å; L8-V12 VanDerWaalsContact O-CG2 3.29Å; L8-V12 WeakPolarHBondContact O-CG2 3.39Å; L8-V12 PolarHBondContact O-N 3.42Å
9	L	91.5	Very high	83.3	Confident	96 Å²	96	112.9 Å²	112.9	50%	0.503	60%	0.603	S	S	.	*	H	α-helix	trans	-60.9	-46.1	176.3	-79.6	163.1	0	0	0	111.7	L5 W6 A11 V12 L13	L5-L9 WeakPolarHBondContact O-CG 3.44Å; L5-L9 PolarHBondContact O-N 3.34Å; W6-L9 PolarHBondContact O-N 2.94Å; L9-A11 VanDerWaalsContact C-N 3.35Å; L9-A11 PolarHBondContact O-N 2.91Å; L9-V12 PolarHBondContact O-N 3.46Å; L9-L13 WeakPolarHBondContact O-CB 3.49Å; L9-L13 PolarHBondContact O-N 2.78Å
10	L	92.1	Very high	82.6	Confident	123 Å²	123	110.9 Å²	110.9	64%	0.644	60%	0.597	S	S	*	*	H	α-helix	trans	-62.1	-41.7	176.2	-78.1	161.3	0	0	0	111.8	W6 A7 L13 G14	W6-L10 WeakPolarHBondContact O-CB 3.46Å; W6-L10 WeakPolarHBondContact O-CD1 3.45Å; W6-L10 WeakPolarHBondContact O-CG 3.4Å; W6-L10 PolarHBondContact O-N 3.5Å; A7-L10 PolarHBondContact O-N 3.48Å; L10-L13 PolarHBondContact O-N 3.37Å; L10-G14 PolarHBondContact O-N 2.82Å
11	A	90.5	Very high	82	Confident	56 Å²	56	110.4 Å²	110.4	46%	0.463	59%	0.594	S	S	.	*	H	α-helix	trans	-65.2	-42.9	176.6	0	0	0	0	0	112	A7 L8 L9 G14 T15	A7-A11 VanDerWaalsContact O-CB 3.28Å; A7-A11 WeakPolarHBondContact O-CB 3.29Å; A7-A11 PolarHBondContact O-N 2.87Å; L8-A11 PolarHBondContact O-N 3.37Å; L9-A11 VanDerWaalsContact C-N 3.35Å; L9-A11 PolarHBondContact O-N 2.91Å; A11-G14 PolarHBondContact O-N 3.49Å; A11-T15 WeakPolarHBondContact O-CB 3.37Å; A11-T15 VanDerWaalsContact O-CG2 3.23Å; A11-T15 WeakPolarHBondContact O-CG2 3.4Å; A11-T15 PolarHBondContact O-N 3.39Å; A11-T15 PolarHBondContact O-OG1 3.47Å
12	V	89.4	Confident	82.4	Confident	79 Å²	79	103.5 Å²	103.5	48%	0.479	57%	0.567	S	S	.	*	H	α-helix	trans	-65.1	-42.9	176.1	171.7	0	0	0	0	111	L8 L9 T15 Q16	L8-V12 WeakPolarHBondContact O-CB 3.35Å; L8-V12 VanDerWaalsContact O-CG2 3.29Å; L8-V12 WeakPolarHBondContact O-CG2 3.39Å; L8-V12 PolarHBondContact O-N 3.42Å; L9-V12 PolarHBondContact O-N 3.46Å; V12-T15 WeakPolarHBondContact CA-OG1 3.28Å; V12-T15 PolarHBondContact O-N 2.88Å; V12-T15 PolarHBondContact O-OG1 2.91Å; V12-Q16 WeakPolarHBondContact O-CB 3.2Å; V12-Q16 WeakPolarHBondContact O-CG 3.22Å; V12-Q16 PolarHBondContact O-N 2.87Å
13	L	89.7	Confident	82.3	Confident	115 Å²	115	98.7 Å²	98.7	60%	0.602	56%	0.556	S	S	*	*	H	α-helix	trans	-64.9	-43.8	178.2	-140.1	82.1	0	0	0	111.6	L9 L10 Q16 L17	L9-L13 WeakPolarHBondContact O-CB 3.49Å; L9-L13 PolarHBondContact O-N 2.78Å; L10-L13 PolarHBondContact O-N 3.37Å; L13-Q16 PolarHBondContact O-N 2.76Å; L13-L17 WeakPolarHBondContact O-CB 3.23Å; L13-L17 WeakPolarHBondContact O-CG 3.46Å; L13-L17 PolarHBondContact O-N 3.49Å
14	G	87.8	Confident	81.6	Confident	40 Å²	40	92.9 Å²	92.9	41%	0.412	54%	0.541	S	S	.	.	H	α-helix	trans	-66	-40.8	178.1	0	0	0	0	0	112.8	L10 A11 L17 L18	L10-G14 PolarHBondContact O-N 2.82Å; A11-G14 PolarHBondContact O-N 3.49Å; G14-L17 PolarHBondContact O-N 2.79Å; G14-L18 WeakPolarHBondContact O-CB 3.22Å; G14-L18 PolarHBondContact O-N 3.49Å
15	T	85.6	Confident	80.7	Confident	91 Å²	91	93.6 Å²	93.6	56%	0.558	54%	0.542	S	S	*	.	H	α-helix	trans	-71	-35.8	176.9	51.7	0	0	0	0	112.6	A11 V12 G19	A11-T15 WeakPolarHBondContact O-CB 3.37Å; A11-T15 VanDerWaalsContact O-CG2 3.23Å; A11-T15 WeakPolarHBondContact O-CG2 3.4Å; A11-T15 PolarHBondContact O-N 3.39Å; A11-T15 PolarHBondContact O-OG1 3.47Å; V12-T15 WeakPolarHBondContact CA-OG1 3.28Å; V12-T15 PolarHBondContact O-N 2.88Å; V12-T15 PolarHBondContact O-OG1 2.91Å; T15-G19 WeakPolarHBondContact O-CA 3.3Å; T15-G19 PolarHBondContact O-N 3.49Å
16	Q	84.8	Confident	79.3	Confident	146 Å²	146	97.4 Å²	97.4	68%	0.682	55%	0.548	S	S	*	.	H	α-helix	trans	-64.3	-44.9	170.9	-85.7	-109.9	88.8	0	0	112	V12 L13 G19 S20	V12-Q16 WeakPolarHBondContact O-CB 3.2Å; V12-Q16 WeakPolarHBondContact O-CG 3.22Å; V12-Q16 PolarHBondContact O-N 2.87Å; L13-Q16 PolarHBondContact O-N 2.76Å; Q16-G19 PolarHBondContact O-N 2.73Å; Q16-S20 VanDerWaalsContact O-CB 3.22Å; Q16-S20 WeakPolarHBondContact O-CB 3.45Å; Q16-S20 PolarHBondContact O-N 3.46Å
17	L	83.1	Confident	77.6	Confident	105 Å²	105	92.7 Å²	92.7	55%	0.55	54%	0.541	S	S	.	.	H	α-helix	trans	-63.3	-46.3	175.4	-80.9	163	0	0	0	111.3	L13 G14 S20 L21	L13-L17 WeakPolarHBondContact O-CB 3.23Å; L13-L17 WeakPolarHBondContact O-CG 3.46Å; L13-L17 PolarHBondContact O-N 3.49Å; G14-L17 PolarHBondContact O-N 2.79Å; L17-S20 PolarHBondContact O-N 2.95Å; L17-L21 VanDerWaalsContact O-CB 3.3Å; L17-L21 WeakPolarHBondContact O-CB 3.37Å; L17-L21 VanDerWaalsContact O-CG 3.22Å; L17-L21 WeakPolarHBondContact O-CG 3.13Å; L17-L21 PolarHBondContact O-N 2.91Å
18	L	82.4	Confident	75.9	Confident	122 Å²	122	95.9 Å²	95.9	64%	0.639	55%	0.546	S	S	*	.	H	α-helix	trans	-68.5	-35.9	179.5	-165.5	66.5	0	0	0	111.7	G14 C22	G14-L18 WeakPolarHBondContact O-CB 3.22Å; G14-L18 PolarHBondContact O-N 3.49Å; L18-C22 WeakPolarHBondContact O-CB 3.41Å; L18-C22 PolarHBondContact O-N 2.89Å
19	G	79.5	Confident	74.2	Confident	40 Å²	40	101 Å²	101	41%	0.412	56%	0.557	S	S	.	*	H	α-helix	trans	-67.9	-42.2	173.7	0	0	0	0	0	112.3	T15 Q16 C22 S23	T15-G19 WeakPolarHBondContact O-CA 3.3Å; T15-G19 PolarHBondContact O-N 3.49Å; Q16-G19 PolarHBondContact O-N 2.73Å; G19-C22 PolarHBondContact O-N 2.83Å; G19-S23 WeakPolarHBondContact O-CB 3.37Å; G19-S23 PolarHBondContact O-N 2.81Å
20	S	69.4	Low	72.3	Confident	71 Å²	71	102.8 Å²	102.8	50%	0.497	56%	0.561	S	S	.	*	H	α-helix	trans	-64.8	-43.2	173.2	179.7	0	0	0	0	111.6	Q16 L17 T24	Q16-S20 VanDerWaalsContact O-CB 3.22Å; Q16-S20 WeakPolarHBondContact O-CB 3.45Å; Q16-S20 PolarHBondContact O-N 3.46Å; L17-S20 PolarHBondContact O-N 2.95Å; S20-T24 WeakPolarHBondContact O-CA 3.43Å; S20-T24 WeakPolarHBondContact O-CB 3.42Å; S20-T24 PolarHBondContact O-N 2.72Å; S20-T24 PolarHBondContact O-OG1 2.98Å
21	L	70.3	Confident	70.3	Confident	101 Å²	101	103.8 Å²	103.8	53%	0.529	56%	0.556	S	S	.	*	H	α-helix	trans	-66.7	-38.9	174	-73.8	166.7	0	0	0	111.6	L17 T24 V25	L17-L21 VanDerWaalsContact O-CB 3.3Å; L17-L21 WeakPolarHBondContact O-CB 3.37Å; L17-L21 VanDerWaalsContact O-CG 3.22Å; L17-L21 WeakPolarHBondContact O-CG 3.13Å; L17-L21 PolarHBondContact O-N 2.91Å; L21-T24 CarbonylContact O-C 3.6Å; L21-T24 PolarHBondContact O-N 3.26Å; L21-V25 WeakPolarHBondContact O-CB 3.37Å; L21-V25 WeakPolarHBondContact O-CG2 3.42Å; L21-V25 PolarHBondContact O-N 2.65Å
22	C	65.8	Low	68.6	Low	75 Å²	75	104.4 Å²	104.4	51%	0.507	57%	0.568	S	S	.	*	H	α-helix	trans	-71.9	-37	178.7	-165.3	0	0	0	0	111.3	L18 G19 R26	L18-C22 WeakPolarHBondContact O-CB 3.41Å; L18-C22 PolarHBondContact O-N 2.89Å; G19-C22 PolarHBondContact O-N 2.83Å; C22-R26 WeakPolarHBondContact O-CB 3.4Å; C22-R26 PolarHBondContact O-N 2.75Å
23	S	61.6	Low	66.7	Low	80 Å²	80	111 Å²	111	56%	0.559	58%	0.584	S	S	*	*	H	α-helix	trans	-69.4	-41.8	171.7	-163.5	0	0	0	0	111.1	G19 R26 S27	G19-S23 WeakPolarHBondContact O-CB 3.37Å; G19-S23 PolarHBondContact O-N 2.81Å; S23-R26 PolarHBondContact O-N 3.45Å; S23-S27 WeakPolarHBondContact O-CA 2.97Å; S23-S27 WeakPolarHBondContact O-CB 3.44Å; S23-S27 PolarHBondContact O-N 3.46Å
24	T	61.7	Low	65.3	Low	71 Å²	71	110 Å²	110	44%	0.436	58%	0.579	S	S	.	*	H	α-helix	trans	-63	-45.5	173	-61.8	0	0	0	0	110.2	S20 L21 S27 Q28	S20-T24 WeakPolarHBondContact O-CA 3.43Å; S20-T24 WeakPolarHBondContact O-CB 3.42Å; S20-T24 PolarHBondContact O-N 2.72Å; S20-T24 PolarHBondContact O-OG1 2.98Å; L21-T24 CarbonylContact O-C 3.6Å; L21-T24 PolarHBondContact O-N 3.26Å; T24-S27 PolarHBondContact O-N 2.82Å; T24-Q28 WeakPolarHBondContact O-CA 3.21Å; T24-Q28 WeakPolarHBondContact O-CB 2.85Å; T24-Q28 PolarHBondContact O-N 3.45Å
25	V	58.7	Low	63.6	Low	90 Å²	90	113.9 Å²	113.9	55%	0.545	59%	0.586	S	S	.	*	H	α-helix	trans	-68.2	-41.9	178.4	167.7	0	0	0	0	111.2	L21 R29	L21-V25 WeakPolarHBondContact O-CB 3.37Å; L21-V25 WeakPolarHBondContact O-CG2 3.42Å; L21-V25 PolarHBondContact O-N 2.65Å; V25-R29 WeakPolarHBondContact O-CB 3.33Å; V25-R29 PolarHBondContact O-N 2.72Å
26	R	55.7	Low	62	Low	201 Å²	201	118.4 Å²	118.4	76%	0.758	60%	0.601	S	S	*	*	H	α-helix	trans	-66.5	-39.9	176.5	-174.9	175.8	-75.5	-149.3	-1.8	111.6	C22 S23	C22-R26 WeakPolarHBondContact O-CB 3.4Å; C22-R26 PolarHBondContact O-N 2.75Å; S23-R26 PolarHBondContact O-N 3.45Å
27	S	51.6	Low	60.3	Low	72 Å²	72	123.3 Å²	123.3	50%	0.503	62%	0.624	S	S	.	*	H	α-helix	trans	-78.4	-35.6	178.7	-160.5	0	0	0	0	112.1	S23 T24 R29 F30 R31	S23-S27 WeakPolarHBondContact O-CA 2.97Å; S23-S27 WeakPolarHBondContact O-CB 3.44Å; S23-S27 PolarHBondContact O-N 3.46Å; T24-S27 PolarHBondContact O-N 2.82Å; S27-R29 VanDerWaalsContact C-N 3.35Å; S27-F30 CarbonylContact O-C 3.42Å; S27-F30 WeakPolarHBondContact O-CA 3.09Å; S27-F30 WeakPolarHBondContact O-CB 3.15Å; S27-F30 PolarHBondContact O-N 2.71Å; S27-R31 WeakPolarHBondContact O-CB 3.04Å; S27-R31 PolarHBondContact O-N 2.95Å
28	Q	53.4	Low	59.1	Low	124 Å²	124	124.2 Å²	124.2	58%	0.579	63%	0.627	S	S	*	*	H	α-helix	trans	-69.5	-32.5	174.9	-170.9	176.6	-2.5	0	0	111.2	T24 F30 R31 G32	T24-Q28 WeakPolarHBondContact O-CA 3.21Å; T24-Q28 WeakPolarHBondContact O-CB 2.85Å; T24-Q28 PolarHBondContact O-N 3.45Å; Q28-F30 PolarHBondContact O-N 2.75Å; Q28-R31 PolarHBondContact O-N 3.36Å; Q28-G32 PolarHBondContact O-N 3.26Å; Q28-G32 VanDerWaalsContact O-N 3.1Å
29	R	53.7	Low	57.9	Low	222 Å²	222	124.3 Å²	124.3	84%	0.838	63%	0.627	S	S	*	*	H	α-helix	trans	-61.5	-24.9	167.7	-128.4	178.2	-176.6	176.9	1	112.6	V25 S27	V25-R29 WeakPolarHBondContact O-CB 3.33Å; V25-R29 PolarHBondContact O-N 2.72Å; S27-R29 VanDerWaalsContact C-N 3.35Å
30	F	51.1	Low	56.7	Low	134 Å²	134	129 Å²	129	59%	0.588	64%	0.639	S	S	*	*	H	α-helix	trans	-93.7	-30.8	175	-145.8	-111.4	0	0	0	112.5	S27 Q28 G32 R33 I34	S27-F30 CarbonylContact O-C 3.42Å; S27-F30 WeakPolarHBondContact O-CA 3.09Å; S27-F30 WeakPolarHBondContact O-CB 3.15Å; S27-F30 PolarHBondContact O-N 2.71Å; Q28-F30 PolarHBondContact O-N 2.75Å; F30-G32 VanDerWaalsContact C-N 3.27Å; F30-G32 PolarHBondContact O-N 2.93Å; F30-R33 CarbonylContact O-C 3.56Å; F30-R33 WeakPolarHBondContact O-CA 3.48Å; F30-R33 PolarHBondContact O-N 2.95Å; F30-I34 HydrophobicContact CD1-CB 4.2Å; F30-I34 HydrophobicContact CD1-CD1 3.9Å; F30-I34 HydrophobicContact CD1-CG1 3.52Å; F30-I34 HydrophobicContact CE1-CD1 3.34Å; F30-I34 HydrophobicContact CE1-CG1 3.5Å; F30-I34 HydrophobicContact CG-CG1 4.33Å; F30-I34 HydrophobicContact CZ-CD1 4.05Å; F30-I34 HydrophobicContact CZ-CG1 4.29Å; F30-I34 WeakPolarHBondContact O-CB 3.37Å; F30-I34 WeakPolarHBondContact O-CG1 3.22Å; F30-I34 PolarHBondContact O-N 3.1Å
31	R	50.5	Low	55.9	Low	145 Å²	145	132.4 Å²	132.4	55%	0.547	65%	0.647	S	S	.	*	H	α-helix	trans	-76.2	-8.7	178	-155.9	172.7	-170.9	-102.7	-4.7	114	S27 Q28 Q35	S27-R31 WeakPolarHBondContact O-CB 3.04Å; S27-R31 PolarHBondContact O-N 2.95Å; Q28-R31 PolarHBondContact O-N 3.36Å; R31-Q35 HydrophobicContact CG-CB 4.24Å; R31-Q35 VanDerWaalsContact NH1-OE1 3.14Å
32	G	55.3	Low	55	Low	69 Å²	69	134.4 Å²	134.4	71%	0.711	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.7	-14.3	161.2	0	0	0	0	0	113.4	Q28 F30	Q28-G32 PolarHBondContact O-N 3.26Å; Q28-G32 VanDerWaalsContact O-N 3.1Å; F30-G32 VanDerWaalsContact C-N 3.27Å; F30-G32 PolarHBondContact O-N 2.93Å
33	R	49.6	Very low	54.3	Low	217 Å²	217	138.3 Å²	138.3	82%	0.819	66%	0.664	S	S	*	*	T	Hydrogen-bonded Turn	trans	-116	-20.1	175.9	-68.8	-71.1	-147.4	172.1	6	113.5	F30	F30-R33 CarbonylContact O-C 3.56Å; F30-R33 WeakPolarHBondContact O-CA 3.48Å; F30-R33 PolarHBondContact O-N 2.95Å
34	I	59.7	Low	53.8	Low	94 Å²	94	142.5 Å²	142.5	48%	0.482	67%	0.672	S	S	.	*	S	Bend	trans	-118.5	27.3	-169.2	-60	-110.5	0	0	0	111.9	F30	F30-I34 HydrophobicContact CD1-CB 4.2Å; F30-I34 HydrophobicContact CD1-CD1 3.9Å; F30-I34 HydrophobicContact CD1-CG1 3.52Å; F30-I34 HydrophobicContact CE1-CD1 3.34Å; F30-I34 HydrophobicContact CE1-CG1 3.5Å; F30-I34 HydrophobicContact CG-CG1 4.33Å; F30-I34 HydrophobicContact CZ-CD1 4.05Å; F30-I34 HydrophobicContact CZ-CG1 4.29Å; F30-I34 WeakPolarHBondContact O-CB 3.37Å; F30-I34 WeakPolarHBondContact O-CG1 3.22Å; F30-I34 PolarHBondContact O-N 3.1Å
35	Q	51.3	Low	53.2	Low	122 Å²	122	148 Å²	148	57%	0.57	69%	0.69	S	S	*	*	S	Bend	trans	-111.8	29.1	161.9	-166.6	166.1	-140	0	0	110	R31	R31-Q35 HydrophobicContact CG-CB 4.24Å; R31-Q35 VanDerWaalsContact NH1-OE1 3.14Å
36	Q	53.3	Low	52.8	Low	185 Å²	185	152.8 Å²	152.8	86%	0.864	70%	0.702	S	S	*	*			trans	-123.9	45.4	172.4	-80.7	-118.5	-73	0	0	108.9
37	E	47.9	Very low	52.5	Low	249 Å²	249	148.5 Å²	148.5	100%	1.164	70%	0.697	S	S	*	*			trans	-121.4	0	149.2	-78.5	-169.8	91	0	0	107.6

Retrieved 37 of 37 residues in 20.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).