A0A087WS45_MOUSE Loading...

Aldehyde dehydrogenase 3 family, member B3

AlphaFold DB , UniProt , Accession A0A087WS45, Species MOUSE (Mus musculus, Mouse), Gene Aldh3b3, Length 72 aa.

						>A0A087WS45_MOUSE|A0A087WS45|Aldh3b3
MSTKGKHPRADQGTDPFEEKLQRLKEAFNTGKTKTAKFRAEQLQSLGRFLQDNSKQLHDALDGDLGKASSQT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46.9	Very low	51.5	Low	241 Å²	241	160.2 Å²	160.2	100%	1.187	85%	0.852	S	S	*	*				0	119.8	0	-70.4	-164.7	148.6	0	0	109.2
2	S	46.4	Very low	52.4	Low	129 Å²	129	161 Å²	161	90%	0.902	85%	0.847	S	S	*	*			trans	-169.1	96.2	161.4	-92.2	0	0	0	0	109	K4	S2-K4 PolarHBondContact O-N 3.42Å
3	T	63	Low	53.7	Low	147 Å²	147	153.2 Å²	153.2	90%	0.902	83%	0.829	S	S	*	*			trans	-78.2	104.7	175.7	44.9	0	0	0	0	109	G5	T3-G5 PolarHBondContact O-N 3.27Å
4	K	52	Low	55.1	Low	212 Å²	212	147.6 Å²	147.6	92%	0.922	80%	0.803	S	S	*	*			trans	-87.1	97.3	166.6	-158.7	133.2	-174.5	174.2	0	108.1	S2 K6	S2-K4 PolarHBondContact O-N 3.42Å; K4-K6 PolarHBondContact O-N 3.5Å
5	G	45.1	Very low	57.3	Low	59 Å²	59	143.3 Å²	143.3	61%	0.608	78%	0.779	S	S	*	*			trans	-51.5	125.3	-179.9	0	0	0	0	0	111.6	T3 H7	T3-G5 PolarHBondContact O-N 3.27Å; G5-H7 VanDerWaalsContact C-N 3.26Å; G5-H7 PolarHBondContact O-N 2.91Å
6	K	52.1	Low	59.4	Low	209 Å²	209	140.5 Å²	140.5	91%	0.909	77%	0.77	S	S	*	*			trans	-71.8	87.5	167	-158.5	172.3	-171.1	177.1	0	106.2	K4	K4-K6 PolarHBondContact O-N 3.5Å
7	H	50.5	Low	61.4	Low	171 Å²	171	140.8 Å²	140.8	79%	0.792	76%	0.762	S	S	*	*	P	Polyproline II helix	trans	-60.6	129.8	171.9	-97.3	-82.1	0	0	0	108.6	G5 R9	G5-H7 VanDerWaalsContact C-N 3.26Å; G5-H7 PolarHBondContact O-N 2.91Å; H7-R9 PolarHBondContact O-N 3.22Å
8	P	48.6	Very low	63.3	Low	115 Å²	115	139.4 Å²	139.4	75%	0.747	75%	0.75	S	S	*	*	P	Polyproline II helix	trans	-60.2	132	174.6	20.3	-25.3	0	0	0	108.6	A10	P8-A10 PolarHBondContact O-N 3.38Å
9	R	50.9	Low	64.9	Low	244 Å²	244	137.3 Å²	137.3	92%	0.921	74%	0.735	S	S	*	*	P	Polyproline II helix	trans	-56.6	127.4	175.6	-74.4	-178.6	170.6	-160.7	-3.2	107.8	H7 D11	H7-R9 PolarHBondContact O-N 3.22Å; R9-D11 PolarHBondContact O-N 2.72Å
10	A	51.8	Low	66.5	Low	78 Å²	78	137.3 Å²	137.3	65%	0.645	73%	0.728	S	S	*	*	P	Polyproline II helix	trans	-50	129.7	172.5	0	0	0	0	0	109.1	P8 Q12	P8-A10 PolarHBondContact O-N 3.38Å; A10-Q12 PolarHBondContact O-N 2.94Å
11	D	59	Low	67.9	Low	157 Å²	157	134 Å²	134	84%	0.84	71%	0.71	S	S	*	*			trans	-41.1	101.1	167.9	-175.9	23.8	0	0	0	109.9	R9 G13	R9-D11 PolarHBondContact O-N 2.72Å; D11-G13 VanDerWaalsContact C-N 3.34Å; D11-G13 PolarHBondContact O-N 2.92Å
12	Q	62.5	Low	70.3	Confident	170 Å²	170	127 Å²	127	79%	0.794	68%	0.675	S	S	*	*			trans	-79.3	94.7	169.4	-65.1	-71.7	-34.1	0	0	104.5	A10 T14	A10-Q12 PolarHBondContact O-N 2.94Å; Q12-T14 PolarHBondContact O-N 3.29Å
13	G	68.9	Low	72.7	Confident	59 Å²	59	129.8 Å²	129.8	61%	0.608	67%	0.666	S	S	*	*			trans	-45.9	133.9	169.9	0	0	0	0	0	109	D11	D11-G13 VanDerWaalsContact C-N 3.34Å; D11-G13 PolarHBondContact O-N 2.92Å
14	T	73.1	Confident	74.3	Confident	76 Å²	76	127.9 Å²	127.9	47%	0.466	65%	0.65	S	S	.	*			trans	-59.9	145.1	-175.4	-49.5	0	0	0	0	108.4	Q12 E18 E19	Q12-T14 PolarHBondContact O-N 3.29Å; T14-E18 HydrophobicContact CG2-CB 3.94Å; T14-E19 HydrophobicContact CG2-CG 4.03Å
15	D	89.1	Confident	76.5	Confident	82 Å²	82	122.8 Å²	122.8	44%	0.439	63%	0.627	S	S	.	*			trans	-54.6	131.4	179.8	171.5	94.2	0	0	0	109.9	F17 E18 E19	D15-F17 PolarHBondContact O-N 3.26Å; D15-F17 VanDerWaalsContact OD2-CA 3.32Å; D15-F17 WeakPolarHBondContact OD2-CA 3.49Å; D15-F17 WeakPolarHBondContact OD2-CB 2.88Å; D15-F17 PolarHBondContact OD2-N 2.99Å; D15-E18 HydrophobicContact CB-CB 4.14Å; D15-E18 HydrophobicContact CB-CG 3.92Å; D15-E18 WeakPolarHBondContact O-CA 3.37Å; D15-E18 WeakPolarHBondContact O-CB 3.12Å; D15-E18 PolarHBondContact O-N 2.93Å; D15-E18 PolarHBondContact OD2-N 3.28Å; D15-E18 VanDerWaalsContact OD2-N 3.1Å; D15-E19 PolarHBondContact O-N 3.43Å
16	P	90.9	Very high	79	Confident	99 Å²	99	124.9 Å²	124.9	64%	0.643	62%	0.621	S	S	*	*	H	α-helix	trans	-58.6	-26.8	-174.3	-27.1	34.4	0	0	0	114.1	K20	P16-K20 WeakPolarHBondContact O-CB 3.37Å; P16-K20 PolarHBondContact O-N 3.45Å; P16-K20 VanDerWaalsContact O-N 3.14Å
17	F	93.2	Very high	81.1	Confident	145 Å²	145	117.5 Å²	117.5	64%	0.636	60%	0.599	S	S	*	*	H	α-helix	trans	-75.2	-41.1	174.2	174.5	-91	0	0	0	111.2	D15 E19 K20 L21	D15-F17 PolarHBondContact O-N 3.26Å; D15-F17 VanDerWaalsContact OD2-CA 3.32Å; D15-F17 WeakPolarHBondContact OD2-CA 3.49Å; D15-F17 WeakPolarHBondContact OD2-CB 2.88Å; D15-F17 PolarHBondContact OD2-N 2.99Å; F17-E19 VanDerWaalsContact C-N 3.34Å; F17-E19 PolarHBondContact O-N 3.22Å; F17-K20 PolarHBondContact O-N 3.44Å; F17-L21 HydrophobicContact CE1-CD2 4.45Å; F17-L21 WeakPolarHBondContact O-CB 3.27Å; F17-L21 PolarHBondContact O-N 3.38Å
18	E	94.6	Very high	83.3	Confident	116 Å²	116	115 Å²	115	54%	0.542	59%	0.586	S	S	.	*	H	α-helix	trans	-58.8	-44.2	172.3	-69.8	-174.7	166.8	0	0	111.8	T14 D15 K20 L21 Q22	T14-E18 HydrophobicContact CG2-CB 3.94Å; D15-E18 HydrophobicContact CB-CB 4.14Å; D15-E18 HydrophobicContact CB-CG 3.92Å; D15-E18 WeakPolarHBondContact O-CA 3.37Å; D15-E18 WeakPolarHBondContact O-CB 3.12Å; D15-E18 PolarHBondContact O-N 2.93Å; D15-E18 PolarHBondContact OD2-N 3.28Å; D15-E18 VanDerWaalsContact OD2-N 3.1Å; E18-K20 PolarHBondContact O-N 3.3Å; E18-L21 PolarHBondContact O-N 3.35Å; E18-Q22 WeakPolarHBondContact O-CB 3.36Å; E18-Q22 PolarHBondContact O-N 3.25Å
19	E	94.4	Very high	85.7	Confident	99 Å²	99	115.5 Å²	115.5	46%	0.463	58%	0.582	S	S	.	*	H	α-helix	trans	-60.7	-46	175.9	-67.9	-173.8	171.1	0	0	111.9	T14 D15 F17 Q22 R23	T14-E19 HydrophobicContact CG2-CG 4.03Å; D15-E19 PolarHBondContact O-N 3.43Å; F17-E19 VanDerWaalsContact C-N 3.34Å; F17-E19 PolarHBondContact O-N 3.22Å; E19-Q22 PolarHBondContact O-N 2.98Å; E19-R23 WeakPolarHBondContact O-CG 3.41Å; E19-R23 PolarHBondContact O-N 2.75Å
20	K	96.2	Very high	87.8	Confident	137 Å²	137	108.5 Å²	108.5	60%	0.596	57%	0.567	S	S	*	*	H	α-helix	trans	-62.9	-44.5	177.7	-173	176	-173.9	176.5	0	111.3	P16 F17 E18 Q22 R23 L24	P16-K20 WeakPolarHBondContact O-CB 3.37Å; P16-K20 PolarHBondContact O-N 3.45Å; P16-K20 VanDerWaalsContact O-N 3.14Å; F17-K20 PolarHBondContact O-N 3.44Å; E18-K20 PolarHBondContact O-N 3.3Å; K20-Q22 VanDerWaalsContact C-N 3.33Å; K20-Q22 PolarHBondContact O-N 3.23Å; K20-R23 PolarHBondContact O-N 2.99Å; K20-L24 HydrophobicContact CG-CD1 4.28Å; K20-L24 VanDerWaalsContact O-CG 3.32Å; K20-L24 WeakPolarHBondContact O-CG 3.49Å; K20-L24 PolarHBondContact O-N 2.94Å
21	L	97.2	Very high	90	Very high	68 Å²	68	105.8 Å²	105.8	36%	0.356	55%	0.547	S	S	.	.	H	α-helix	trans	-62.3	-43.1	178.6	178.2	61.3	0	0	0	111.1	F17 E18 L24 K25	F17-L21 HydrophobicContact CE1-CD2 4.45Å; F17-L21 WeakPolarHBondContact O-CB 3.27Å; F17-L21 PolarHBondContact O-N 3.38Å; E18-L21 PolarHBondContact O-N 3.35Å; L21-L24 PolarHBondContact O-N 3.26Å; L21-K25 HydrophobicContact CD1-CG 4.49Å; L21-K25 HydrophobicContact CG-CD 4.35Å; L21-K25 WeakPolarHBondContact O-CG 3.39Å; L21-K25 PolarHBondContact O-N 3.17Å
22	Q	96.8	Very high	91.6	Very high	95 Å²	95	104.7 Å²	104.7	44%	0.444	53%	0.534	S	S	.	.	H	α-helix	trans	-60.9	-47.6	178.3	-176.2	55.4	33	0	0	111.3	E18 E19 K20 L24 K25 E26	E18-Q22 WeakPolarHBondContact O-CB 3.36Å; E18-Q22 PolarHBondContact O-N 3.25Å; E19-Q22 PolarHBondContact O-N 2.98Å; K20-Q22 VanDerWaalsContact C-N 3.33Å; K20-Q22 PolarHBondContact O-N 3.23Å; Q22-L24 VanDerWaalsContact C-N 3.32Å; Q22-L24 PolarHBondContact O-N 3.29Å; Q22-K25 WeakPolarHBondContact O-CB 3.29Å; Q22-K25 PolarHBondContact O-N 3.08Å; Q22-E26 WeakPolarHBondContact CG-OE1 3.37Å; Q22-E26 PolarHBondContact NE2-OE1 2.94Å; Q22-E26 WeakPolarHBondContact O-CG 3.46Å; Q22-E26 PolarHBondContact O-N 3.08Å
23	R	96.4	Very high	93.3	Very high	187 Å²	187	98.7 Å²	98.7	71%	0.706	51%	0.51	S	S	*	.	H	α-helix	trans	-60.4	-39	176.6	-71.2	174.6	63.5	-166.6	-0	113	E19 K20 E26 A27	E19-R23 WeakPolarHBondContact O-CG 3.41Å; E19-R23 PolarHBondContact O-N 2.75Å; K20-R23 PolarHBondContact O-N 2.99Å; R23-E26 PolarHBondContact O-N 2.98Å; R23-A27 WeakPolarHBondContact O-CB 3.36Å; R23-A27 PolarHBondContact O-N 3.34Å
24	L	97.3	Very high	94.5	Very high	108 Å²	108	103.2 Å²	103.2	57%	0.565	51%	0.513	S	S	*	.	H	α-helix	trans	-66.6	-42	177	-71.6	170.9	0	0	0	111.7	K20 L21 Q22 A27 F28	K20-L24 HydrophobicContact CG-CD1 4.28Å; K20-L24 VanDerWaalsContact O-CG 3.32Å; K20-L24 WeakPolarHBondContact O-CG 3.49Å; K20-L24 PolarHBondContact O-N 2.94Å; L21-L24 PolarHBondContact O-N 3.26Å; Q22-L24 VanDerWaalsContact C-N 3.32Å; Q22-L24 PolarHBondContact O-N 3.29Å; L24-A27 PolarHBondContact O-N 3Å; L24-F28 WeakPolarHBondContact O-CB 3.48Å; L24-F28 PolarHBondContact O-N 3.26Å
25	K	97.9	Very high	95.7	Very high	105 Å²	105	103.1 Å²	103.1	46%	0.457	51%	0.512	S	S	.	.	H	α-helix	trans	-60.7	-46.4	174.8	-74	172.7	178.4	172.2	0	111.1	L21 Q22 F28 N29	L21-K25 HydrophobicContact CD1-CG 4.49Å; L21-K25 HydrophobicContact CG-CD 4.35Å; L21-K25 WeakPolarHBondContact O-CG 3.39Å; L21-K25 PolarHBondContact O-N 3.17Å; Q22-K25 WeakPolarHBondContact O-CB 3.29Å; Q22-K25 PolarHBondContact O-N 3.08Å; K25-F28 PolarHBondContact O-N 3.47Å; K25-N29 WeakPolarHBondContact O-CB 3.48Å; K25-N29 PolarHBondContact O-N 2.9Å; K25-N29 PolarHBondContact O-ND2 2.8Å
26	E	97.6	Very high	96.2	Very high	102 Å²	102	102.3 Å²	102.3	48%	0.477	52%	0.517	S	S	.	.	H	α-helix	trans	-59.4	-49.8	177.7	-73.4	167.2	-174	0	0	111.6	Q22 R23 F28 N29 T30	Q22-E26 WeakPolarHBondContact CG-OE1 3.37Å; Q22-E26 PolarHBondContact NE2-OE1 2.94Å; Q22-E26 WeakPolarHBondContact O-CG 3.46Å; Q22-E26 PolarHBondContact O-N 3.08Å; R23-E26 PolarHBondContact O-N 2.98Å; E26-F28 VanDerWaalsContact C-N 3.3Å; E26-F28 PolarHBondContact O-N 3.32Å; E26-N29 PolarHBondContact O-N 3.21Å; E26-T30 WeakPolarHBondContact O-CG2 3.4Å; E26-T30 PolarHBondContact O-N 3.27Å
27	A	96.3	Very high	96.5	Very high	54 Å²	54	104.7 Å²	104.7	45%	0.446	52%	0.517	S	S	.	.	H	α-helix	trans	-58.8	-41.5	177.6	0	0	0	0	0	112.2	R23 L24 T30	R23-A27 WeakPolarHBondContact O-CB 3.36Å; R23-A27 PolarHBondContact O-N 3.34Å; L24-A27 PolarHBondContact O-N 3Å; A27-T30 PolarHBondContact O-OG1 3.29Å
28	F	96.8	Very high	96.7	Very high	119 Å²	119	99.5 Å²	99.5	52%	0.522	49%	0.494	S	S	.	.	H	α-helix	trans	-65.3	-43.9	176.1	-178.9	-96.6	0	0	0	112.3	L24 K25 E26 T30 G31 T33	L24-F28 WeakPolarHBondContact O-CB 3.48Å; L24-F28 PolarHBondContact O-N 3.26Å; K25-F28 PolarHBondContact O-N 3.47Å; E26-F28 VanDerWaalsContact C-N 3.3Å; E26-F28 PolarHBondContact O-N 3.32Å; F28-T30 PolarHBondContact O-N 3.23Å; F28-G31 PolarHBondContact O-N 2.91Å; F28-T33 WeakPolarHBondContact CD2-OG1 3.44Å
29	N	97.9	Very high	96.9	Very high	125 Å²	125	100.1 Å²	100.1	67%	0.668	49%	0.492	S	S	*	.	H	α-helix	trans	-65.2	-21.3	-178.1	-72.9	-19.1	0	0	0	113.1	K25 E26 G31	K25-N29 WeakPolarHBondContact O-CB 3.48Å; K25-N29 PolarHBondContact O-N 2.9Å; K25-N29 PolarHBondContact O-ND2 2.8Å; E26-N29 PolarHBondContact O-N 3.21Å; N29-G31 PolarHBondContact O-N 3.43Å; N29-G31 VanDerWaalsContact O-N 3.13Å
30	T	97.1	Very high	97.1	Very high	98 Å²	98	97.6 Å²	97.6	60%	0.601	49%	0.488	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.8	-19.3	169	72.4	0	0	0	0	113.4	E26 A27 F28 K32	E26-T30 WeakPolarHBondContact O-CG2 3.4Å; E26-T30 PolarHBondContact O-N 3.27Å; A27-T30 PolarHBondContact O-OG1 3.29Å; F28-T30 PolarHBondContact O-N 3.23Å; T30-K32 PolarHBondContact O-N 3.13Å; T30-K32 WeakPolarHBondContact OG1-CB 3.38Å; T30-K32 PolarHBondContact OG1-N 2.93Å
31	G	96.7	Very high	97.2	Very high	21 Å²	21	94.8 Å²	94.8	22%	0.216	48%	0.477	C	S	.	.	S	Bend	trans	77	-2.4	-176.6	0	0	0	0	0	114.6	F28 N29 T33 K34	F28-G31 PolarHBondContact O-N 2.91Å; N29-G31 PolarHBondContact O-N 3.43Å; N29-G31 VanDerWaalsContact O-N 3.13Å; G31-T33 PolarHBondContact O-N 2.67Å; G31-K34 VanDerWaalsContact O-CB 3.27Å; G31-K34 WeakPolarHBondContact O-CB 3.4Å; G31-K34 WeakPolarHBondContact O-CG 3.48Å; G31-K34 PolarHBondContact O-N 3.21Å
32	K	93.4	Very high	97.2	Very high	133 Å²	133	95.9 Å²	95.9	58%	0.578	48%	0.48	S	S	*	.	G	3₁₀ helix	trans	-54.6	-37.4	-179.9	-171.1	-179.4	-176	-177	0	112.6	T30 K34 T35 F38	T30-K32 PolarHBondContact O-N 3.13Å; T30-K32 WeakPolarHBondContact OG1-CB 3.38Å; T30-K32 PolarHBondContact OG1-N 2.93Å; K32-K34 PolarHBondContact O-N 3.18Å; K32-T35 PolarHBondContact O-OG1 2.8Å; K32-F38 HydrophobicContact CD-CD2 4.01Å; K32-F38 HydrophobicContact CD-CE2 3.76Å; K32-F38 HydrophobicContact CD-CZ 4.48Å; K32-F38 VanDerWaalsContact CE-CE2 3.45Å; K32-F38 HydrophobicContact CG-CD2 3.74Å; K32-F38 HydrophobicContact CG-CE2 3.92Å; K32-F38 HydrophobicContact CG-CG 4.23Å; K32-F38 WeakPolarHBondContact O-CB 3.41Å; K32-F38 WeakPolarHBondContact O-CG 3.34Å
33	T	96.9	Very high	97.3	Very high	45 Å²	45	97.2 Å²	97.2	28%	0.276	49%	0.49	S	S	.	.	G	3₁₀ helix	trans	-66.7	-16.6	179.4	57	0	0	0	0	114.1	F28 G31 F38	F28-T33 WeakPolarHBondContact CD2-OG1 3.44Å; G31-T33 PolarHBondContact O-N 2.67Å; T33-F38 HydrophobicContact CG2-CD1 4.46Å; T33-F38 HydrophobicContact CG2-CE1 3.89Å
34	K	96.1	Very high	97.4	Very high	154 Å²	154	93.9 Å²	93.9	67%	0.67	48%	0.482	S	S	*	.	G	3₁₀ helix	trans	-74.7	-24.7	-177.9	-63.3	-177.9	178.2	179.8	0	113.3	G31 K32 R39	G31-K34 VanDerWaalsContact O-CB 3.27Å; G31-K34 WeakPolarHBondContact O-CB 3.4Å; G31-K34 WeakPolarHBondContact O-CG 3.48Å; G31-K34 PolarHBondContact O-N 3.21Å; K32-K34 PolarHBondContact O-N 3.18Å; K34-R39 VanDerWaalsContact C-NH1 3.3Å; K34-R39 PolarHBondContact O-NH1 3.35Å
35	T	97.8	Very high	97.5	Very high	73 Å²	73	91 Å²	91	45%	0.448	47%	0.471	S	S	.	.	S	Bend	trans	-75.8	137.9	-176.2	70.8	0	0	0	0	111.2	K32 K37 F38 R39	K32-T35 PolarHBondContact O-OG1 2.8Å; T35-K37 VanDerWaalsContact C-N 3.27Å; T35-K37 PolarHBondContact O-N 3.2Å; T35-F38 PolarHBondContact O-N 3.38Å; T35-F38 WeakPolarHBondContact OG1-CB 3.29Å; T35-F38 PolarHBondContact OG1-N 3.1Å; T35-R39 PolarHBondContact O-N 3.09Å
36	A	97.9	Very high	97.5	Very high	66 Å²	66	90.6 Å²	90.6	55%	0.545	47%	0.473	S	S	.	.	H	α-helix	trans	-61.9	-38.2	176.9	0	0	0	0	0	111.7	F38 R39 A40	A36-F38 PolarHBondContact O-N 3.01Å; A36-R39 PolarHBondContact O-N 3.43Å; A36-A40 WeakPolarHBondContact O-CB 3.42Å; A36-A40 PolarHBondContact O-N 3.04Å
37	K	97.9	Very high	97.6	Very high	149 Å²	149	87 Å²	87	65%	0.648	46%	0.464	S	S	*	.	H	α-helix	trans	-56	-51.5	175.3	179.3	175.6	174.5	176.8	0	111.7	T35 R39 A40 E41	T35-K37 VanDerWaalsContact C-N 3.27Å; T35-K37 PolarHBondContact O-N 3.2Å; K37-R39 VanDerWaalsContact C-N 3.33Å; K37-R39 PolarHBondContact O-N 2.81Å; K37-A40 PolarHBondContact O-N 3.3Å; K37-E41 WeakPolarHBondContact CE-OE1 3.48Å; K37-E41 HydrophobicContact CG-CG 4.47Å; K37-E41 IonicContact NZ-OE1 3.96Å; K37-E41 WeakPolarHBondContact O-CG 3.36Å; K37-E41 PolarHBondContact O-N 3.49Å
38	F	97.7	Very high	97.7	Very high	36 Å²	36	90 Å²	90	16%	0.158	46%	0.464	C	S	.	.	H	α-helix	trans	-58.4	-46.2	178.7	178.9	-93.6	0	0	0	111.4	K32 T33 T35 A36 A40 E41 Q42	K32-F38 HydrophobicContact CD-CD2 4.01Å; K32-F38 HydrophobicContact CD-CE2 3.76Å; K32-F38 HydrophobicContact CD-CZ 4.48Å; K32-F38 VanDerWaalsContact CE-CE2 3.45Å; K32-F38 HydrophobicContact CG-CD2 3.74Å; K32-F38 HydrophobicContact CG-CE2 3.92Å; K32-F38 HydrophobicContact CG-CG 4.23Å; K32-F38 WeakPolarHBondContact O-CB 3.41Å; K32-F38 WeakPolarHBondContact O-CG 3.34Å; T33-F38 HydrophobicContact CG2-CD1 4.46Å; T33-F38 HydrophobicContact CG2-CE1 3.89Å; T35-F38 PolarHBondContact O-N 3.38Å; T35-F38 WeakPolarHBondContact OG1-CB 3.29Å; T35-F38 PolarHBondContact OG1-N 3.1Å; A36-F38 PolarHBondContact O-N 3.01Å; F38-A40 PolarHBondContact O-N 3.45Å; F38-E41 PolarHBondContact O-N 3.28Å; F38-Q42 HydrophobicContact CD1-CG 3.91Å; F38-Q42 HydrophobicContact CE1-CG 3.48Å; F38-Q42 VanDerWaalsContact CE1-CG 3.48Å; F38-Q42 HydrophobicContact CE2-CG 4.24Å; F38-Q42 HydrophobicContact CG-CG 4.47Å; F38-Q42 HydrophobicContact CZ-CG 3.68Å; F38-Q42 VanDerWaalsContact O-CG 3.29Å; F38-Q42 WeakPolarHBondContact O-CG 3.35Å; F38-Q42 PolarHBondContact O-N 3.18Å
39	R	97.9	Very high	97.8	Very high	128 Å²	128	89.3 Å²	89.3	48%	0.483	46%	0.461	S	S	.	.	H	α-helix	trans	-60.2	-44.1	178	-66.8	-164.8	-60.8	-83.6	3.3	112.3	K34 T35 A36 K37 Q42 L43	K34-R39 VanDerWaalsContact C-NH1 3.3Å; K34-R39 PolarHBondContact O-NH1 3.35Å; T35-R39 PolarHBondContact O-N 3.09Å; A36-R39 PolarHBondContact O-N 3.43Å; K37-R39 VanDerWaalsContact C-N 3.33Å; K37-R39 PolarHBondContact O-N 2.81Å; R39-Q42 PolarHBondContact O-N 2.98Å; R39-L43 WeakPolarHBondContact O-CG 3.19Å; R39-L43 PolarHBondContact O-N 3.08Å
40	A	98.6	Very high	97.8	Very high	47 Å²	47	87.6 Å²	87.6	39%	0.388	45%	0.451	S	S	.	.	H	α-helix	trans	-61.7	-44.8	177	0	0	0	0	0	111.7	A36 K37 F38 Q42 L43 Q44	A36-A40 WeakPolarHBondContact O-CB 3.42Å; A36-A40 PolarHBondContact O-N 3.04Å; K37-A40 PolarHBondContact O-N 3.3Å; F38-A40 PolarHBondContact O-N 3.45Å; A40-Q42 VanDerWaalsContact C-N 3.33Å; A40-Q42 PolarHBondContact O-N 2.99Å; A40-L43 PolarHBondContact O-N 3Å; A40-Q44 WeakPolarHBondContact O-CG 3.46Å; A40-Q44 PolarHBondContact O-N 3.17Å
41	E	98.5	Very high	97.8	Very high	78 Å²	78	89.9 Å²	89.9	36%	0.364	46%	0.455	S	S	.	.	H	α-helix	trans	-61.1	-39.6	176.1	-71.7	170.4	170.7	0	0	112.2	K37 F38 S45	K37-E41 WeakPolarHBondContact CE-OE1 3.48Å; K37-E41 HydrophobicContact CG-CG 4.47Å; K37-E41 IonicContact NZ-OE1 3.96Å; K37-E41 WeakPolarHBondContact O-CG 3.36Å; K37-E41 PolarHBondContact O-N 3.49Å; F38-E41 PolarHBondContact O-N 3.28Å; E41-S45 WeakPolarHBondContact O-CB 3.33Å; E41-S45 PolarHBondContact O-N 3Å; E41-S45 PolarHBondContact O-OG 3.35Å
42	Q	98.4	Very high	97.9	Very high	91 Å²	91	94.9 Å²	94.9	43%	0.425	48%	0.477	S	S	.	.	H	α-helix	trans	-65.6	-43.7	175.6	-63.5	-36.9	-78.2	0	0	111.7	F38 R39 A40 S45 L46	F38-Q42 HydrophobicContact CD1-CG 3.91Å; F38-Q42 HydrophobicContact CE1-CG 3.48Å; F38-Q42 VanDerWaalsContact CE1-CG 3.48Å; F38-Q42 HydrophobicContact CE2-CG 4.24Å; F38-Q42 HydrophobicContact CG-CG 4.47Å; F38-Q42 HydrophobicContact CZ-CG 3.68Å; F38-Q42 VanDerWaalsContact O-CG 3.29Å; F38-Q42 WeakPolarHBondContact O-CG 3.35Å; F38-Q42 PolarHBondContact O-N 3.18Å; R39-Q42 PolarHBondContact O-N 2.98Å; A40-Q42 VanDerWaalsContact C-N 3.33Å; A40-Q42 PolarHBondContact O-N 2.99Å; Q42-S45 PolarHBondContact O-N 2.87Å; Q42-L46 PolarHBondContact O-N 2.95Å
43	L	98.7	Very high	98.1	Very high	123 Å²	123	90.5 Å²	90.5	64%	0.644	46%	0.46	S	S	*	.	H	α-helix	trans	-63.5	-42.4	177.9	-71.4	171.4	0	0	0	112.1	R39 A40 S45 L46 G47	R39-L43 WeakPolarHBondContact O-CG 3.19Å; R39-L43 PolarHBondContact O-N 3.08Å; A40-L43 PolarHBondContact O-N 3Å; L43-S45 VanDerWaalsContact C-N 3.3Å; L43-S45 PolarHBondContact O-N 2.85Å; L43-L46 PolarHBondContact O-N 3.14Å; L43-G47 PolarHBondContact O-N 3.33Å
44	Q	98.7	Very high	98.1	Very high	117 Å²	117	90.8 Å²	90.8	55%	0.547	46%	0.463	S	S	.	.	H	α-helix	trans	-62.5	-39.5	174.2	-72.1	176.8	-7.2	0	0	111.9	A40 L46 G47 R48	A40-Q44 WeakPolarHBondContact O-CG 3.46Å; A40-Q44 PolarHBondContact O-N 3.17Å; Q44-L46 VanDerWaalsContact C-N 3.34Å; Q44-G47 PolarHBondContact O-N 3.05Å; Q44-R48 PolarHBondContact O-N 2.99Å
45	S	98.5	Very high	98	Very high	48 Å²	48	90.8 Å²	90.8	34%	0.336	46%	0.464	S	S	.	.	H	α-helix	trans	-66.5	-38.4	177.4	-56.8	0	0	0	0	111.6	E41 Q42 L43 R48 F49	E41-S45 WeakPolarHBondContact O-CB 3.33Å; E41-S45 PolarHBondContact O-N 3Å; E41-S45 PolarHBondContact O-OG 3.35Å; Q42-S45 PolarHBondContact O-N 2.87Å; L43-S45 VanDerWaalsContact C-N 3.3Å; L43-S45 PolarHBondContact O-N 2.85Å; S45-R48 PolarHBondContact O-N 3.41Å; S45-R48 PolarHBondContact OG-NH2 3.06Å; S45-F49 WeakPolarHBondContact O-CB 3.4Å; S45-F49 PolarHBondContact O-N 3.5Å
46	L	98.6	Very high	98	Very high	95 Å²	95	93.7 Å²	93.7	50%	0.497	47%	0.472	S	S	.	.	H	α-helix	trans	-63.8	-43.3	172.8	-177.4	61.4	0	0	0	111.5	Q42 L43 Q44 R48 F49 L50	Q42-L46 PolarHBondContact O-N 2.95Å; L43-L46 PolarHBondContact O-N 3.14Å; Q44-L46 VanDerWaalsContact C-N 3.34Å; L46-R48 PolarHBondContact O-N 2.99Å; L46-F49 HydrophobicContact CD1-CD1 4.41Å; L46-F49 WeakPolarHBondContact O-CB 3.39Å; L46-F49 PolarHBondContact O-N 3.19Å; L46-L50 WeakPolarHBondContact O-CG 3.46Å; L46-L50 PolarHBondContact O-N 3.31Å
47	G	98.4	Very high	97.9	Very high	28 Å²	28	93.6 Å²	93.6	29%	0.289	46%	0.462	S	S	.	.	H	α-helix	trans	-57.7	-46.9	175	0	0	0	0	0	112.6	L43 Q44 L50 Q51	L43-G47 PolarHBondContact O-N 3.33Å; Q44-G47 PolarHBondContact O-N 3.05Å; G47-L50 PolarHBondContact O-N 3.35Å; G47-Q51 WeakPolarHBondContact O-CG 3.32Å; G47-Q51 PolarHBondContact O-N 2.82Å; G47-Q51 VanDerWaalsContact O-N 3.08Å
48	R	98.8	Very high	97.7	Very high	116 Å²	116	91.2 Å²	91.2	44%	0.438	45%	0.453	S	S	.	.	H	α-helix	trans	-61.5	-45.7	174.3	-73.5	-174.3	-66.2	-92.2	0.6	112.2	Q44 S45 L46 L50 Q51 D52	Q44-R48 PolarHBondContact O-N 2.99Å; S45-R48 PolarHBondContact O-N 3.41Å; S45-R48 PolarHBondContact OG-NH2 3.06Å; L46-R48 PolarHBondContact O-N 2.99Å; R48-L50 VanDerWaalsContact C-N 3.27Å; R48-L50 PolarHBondContact O-N 2.83Å; R48-Q51 PolarHBondContact O-N 2.86Å; R48-Q51 VanDerWaalsContact O-N 3.08Å; R48-D52 WeakPolarHBondContact O-CB 3.47Å; R48-D52 PolarHBondContact O-N 3.28Å
49	F	98.5	Very high	97.6	Very high	105 Å²	105	93.7 Å²	93.7	46%	0.461	47%	0.468	S	S	.	.	H	α-helix	trans	-54.6	-44.8	176.8	171.6	-96.3	0	0	0	111.9	S45 L46 N53	S45-F49 WeakPolarHBondContact O-CB 3.4Å; S45-F49 PolarHBondContact O-N 3.5Å; L46-F49 HydrophobicContact CD1-CD1 4.41Å; L46-F49 WeakPolarHBondContact O-CB 3.39Å; L46-F49 PolarHBondContact O-N 3.19Å; F49-N53 VanDerWaalsContact CD2-ND2 3.34Å; F49-N53 WeakPolarHBondContact CD2-ND2 3.37Å; F49-N53 WeakPolarHBondContact O-CB 3.39Å; F49-N53 PolarHBondContact O-N 2.87Å; F49-N53 VanDerWaalsContact O-N 3.09Å; F49-N53 PolarHBondContact O-ND2 3.14Å
50	L	97.9	Very high	97.4	Very high	89 Å²	89	90 Å²	90	47%	0.466	47%	0.465	S	S	.	.	H	α-helix	trans	-65	-40.1	177.7	-66.8	173	0	0	0	112.3	L46 G47 R48 S54 L57	L46-L50 WeakPolarHBondContact O-CG 3.46Å; L46-L50 PolarHBondContact O-N 3.31Å; G47-L50 PolarHBondContact O-N 3.35Å; R48-L50 VanDerWaalsContact C-N 3.27Å; R48-L50 PolarHBondContact O-N 2.83Å; L50-S54 VanDerWaalsContact O-CA 3.29Å; L50-S54 WeakPolarHBondContact O-CA 3.43Å; L50-S54 WeakPolarHBondContact O-CB 3.25Å; L50-S54 PolarHBondContact O-N 3.06Å; L50-L57 HydrophobicContact CD2-CD1 3.87Å
51	Q	98	Very high	97.2	Very high	145 Å²	145	92 Å²	92	68%	0.678	47%	0.469	S	S	*	.	H	α-helix	trans	-66	-52.7	177.3	-71.4	172.6	-3.5	0	0	111.3	G47 R48 N53 S54	G47-Q51 WeakPolarHBondContact O-CG 3.32Å; G47-Q51 PolarHBondContact O-N 2.82Å; G47-Q51 VanDerWaalsContact O-N 3.08Å; R48-Q51 PolarHBondContact O-N 2.86Å; R48-Q51 VanDerWaalsContact O-N 3.08Å; Q51-N53 PolarHBondContact O-N 3.48Å; Q51-S54 WeakPolarHBondContact O-CB 3.5Å; Q51-S54 PolarHBondContact O-N 3.02Å
52	D	98.5	Very high	96.8	Very high	127 Å²	127	91.2 Å²	91.2	68%	0.679	47%	0.467	S	S	*	.	H	α-helix	trans	-62.9	-30	-175.7	-64	-18.2	0	0	0	112	R48	R48-D52 WeakPolarHBondContact O-CB 3.47Å; R48-D52 PolarHBondContact O-N 3.28Å
53	N	97.7	Very high	96.6	Very high	41 Å²	41	90 Å²	90	22%	0.219	48%	0.479	C	S	.	.	T	Hydrogen-bonded Turn	trans	-109.8	11.9	-176.9	-58	-84.6	0	0	0	113.4	F49 Q51 K55 Q56 L57	F49-N53 VanDerWaalsContact CD2-ND2 3.34Å; F49-N53 WeakPolarHBondContact CD2-ND2 3.37Å; F49-N53 WeakPolarHBondContact O-CB 3.39Å; F49-N53 PolarHBondContact O-N 2.87Å; F49-N53 VanDerWaalsContact O-N 3.09Å; F49-N53 PolarHBondContact O-ND2 3.14Å; Q51-N53 PolarHBondContact O-N 3.48Å; N53-K55 VanDerWaalsContact C-N 3.32Å; N53-K55 PolarHBondContact O-N 3.33Å; N53-Q56 PolarHBondContact O-N 3Å; N53-Q56 VanDerWaalsContact O-N 3.1Å; N53-L57 HydrophobicContact CB-CD1 4.39Å; N53-L57 HydrophobicContact CB-CG 4.4Å; N53-L57 WeakPolarHBondContact O-CG 3.34Å; N53-L57 PolarHBondContact O-N 2.85Å
54	S	96.2	Very high	96.3	Very high	50 Å²	50	90.7 Å²	90.7	35%	0.35	48%	0.483	S	S	.	.	H	α-helix	trans	-52.7	-45.7	-171.6	171.8	0	0	0	0	113.3	L50 Q51 L57 H58	L50-S54 VanDerWaalsContact O-CA 3.29Å; L50-S54 WeakPolarHBondContact O-CA 3.43Å; L50-S54 WeakPolarHBondContact O-CB 3.25Å; L50-S54 PolarHBondContact O-N 3.06Å; Q51-S54 WeakPolarHBondContact O-CB 3.5Å; Q51-S54 PolarHBondContact O-N 3.02Å; S54-L57 PolarHBondContact O-N 2.89Å; S54-H58 PolarHBondContact O-N 3.38Å
55	K	95.8	Very high	95.8	Very high	155 Å²	155	90.3 Å²	90.3	67%	0.674	48%	0.484	S	S	*	.	H	α-helix	trans	-63.2	-48.1	178.9	-177.4	178.9	176.3	-177.1	0	112.2	N53 L57 H58 D59	N53-K55 VanDerWaalsContact C-N 3.32Å; N53-K55 PolarHBondContact O-N 3.33Å; K55-L57 VanDerWaalsContact C-N 3.26Å; K55-L57 PolarHBondContact O-N 3.48Å; K55-H58 PolarHBondContact O-N 3.48Å; K55-H58 VanDerWaalsContact O-N 3.17Å; K55-D59 WeakPolarHBondContact CE-OD2 3.42Å; K55-D59 VanDerWaalsContact O-CG 3.27Å; K55-D59 PolarHBondContact O-N 3.1Å
56	Q	96.9	Very high	94.6	Very high	134 Å²	134	91.1 Å²	91.1	63%	0.626	50%	0.5	S	S	*	.	H	α-helix	trans	-62	-38.3	-179	-65.3	178.9	6.2	0	0	111.4	N53 A60	N53-Q56 PolarHBondContact O-N 3Å; N53-Q56 VanDerWaalsContact O-N 3.1Å; Q56-A60 WeakPolarHBondContact O-CB 3.34Å; Q56-A60 PolarHBondContact O-N 2.92Å
57	L	95.8	Very high	92.7	Very high	64 Å²	64	93.9 Å²	93.9	34%	0.335	51%	0.508	S	S	.	.	H	α-helix	trans	-65.5	-43	175.8	-66.7	172.1	0	0	0	111.5	L50 N53 S54 K55 L61	L50-L57 HydrophobicContact CD2-CD1 3.87Å; N53-L57 HydrophobicContact CB-CD1 4.39Å; N53-L57 HydrophobicContact CB-CG 4.4Å; N53-L57 WeakPolarHBondContact O-CG 3.34Å; N53-L57 PolarHBondContact O-N 2.85Å; S54-L57 PolarHBondContact O-N 2.89Å; K55-L57 VanDerWaalsContact C-N 3.26Å; K55-L57 PolarHBondContact O-N 3.48Å; L57-L61 WeakPolarHBondContact O-CB 3.35Å; L57-L61 WeakPolarHBondContact O-CD1 3.43Å; L57-L61 WeakPolarHBondContact O-CG 3.41Å; L57-L61 PolarHBondContact O-N 3.3Å
58	H	93.8	Very high	90.6	Very high	98 Å²	98	96.9 Å²	96.9	45%	0.454	53%	0.53	S	S	.	.	H	α-helix	trans	-64.8	-46.5	174.6	-71.9	166.2	0	0	0	112.4	S54 K55 A60 L61 D62	S54-H58 PolarHBondContact O-N 3.38Å; K55-H58 PolarHBondContact O-N 3.48Å; K55-H58 VanDerWaalsContact O-N 3.17Å; H58-A60 VanDerWaalsContact C-N 3.28Å; H58-A60 PolarHBondContact O-N 2.95Å; H58-L61 PolarHBondContact O-N 2.96Å; H58-L61 VanDerWaalsContact O-N 3.14Å; H58-D62 WeakPolarHBondContact O-CB 3.43Å; H58-D62 PolarHBondContact O-N 3.17Å
59	D	94.9	Very high	88.6	Confident	89 Å²	89	94 Å²	94	48%	0.476	53%	0.528	S	S	.	.	H	α-helix	trans	-59.6	-40.5	179.1	-67	-15.7	0	0	0	111	K55 G63	K55-D59 WeakPolarHBondContact CE-OD2 3.42Å; K55-D59 VanDerWaalsContact O-CG 3.27Å; K55-D59 PolarHBondContact O-N 3.1Å; D59-G63 PolarHBondContact O-N 2.95Å
60	A	94.5	Very high	86.8	Confident	51 Å²	51	94.7 Å²	94.7	42%	0.421	55%	0.546	S	S	.	.	H	α-helix	trans	-66.1	-44	175.1	0	0	0	0	0	112.2	Q56 H58 G63 D64	Q56-A60 WeakPolarHBondContact O-CB 3.34Å; Q56-A60 PolarHBondContact O-N 2.92Å; H58-A60 VanDerWaalsContact C-N 3.28Å; H58-A60 PolarHBondContact O-N 2.95Å; A60-G63 PolarHBondContact O-N 3.31Å; A60-D64 WeakPolarHBondContact O-CB 3.15Å; A60-D64 PolarHBondContact O-N 2.83Å
61	L	93.4	Very high	84.5	Confident	88 Å²	88	98.8 Å²	98.8	46%	0.461	56%	0.563	S	S	.	*	H	α-helix	trans	-63.9	-40.6	177.1	-73.7	168.3	0	0	0	112.1	L57 H58 G63 D64 L65	L57-L61 WeakPolarHBondContact O-CB 3.35Å; L57-L61 WeakPolarHBondContact O-CD1 3.43Å; L57-L61 WeakPolarHBondContact O-CG 3.41Å; L57-L61 PolarHBondContact O-N 3.3Å; H58-L61 PolarHBondContact O-N 2.96Å; H58-L61 VanDerWaalsContact O-N 3.14Å; L61-G63 VanDerWaalsContact C-N 3.33Å; L61-D64 PolarHBondContact O-N 3.06Å; L61-L65 HydrophobicContact CD2-CD1 3.85Å; L61-L65 WeakPolarHBondContact O-CA 3.23Å; L61-L65 VanDerWaalsContact O-CB 3.25Å; L61-L65 WeakPolarHBondContact O-CB 3.32Å; L61-L65 PolarHBondContact O-N 3.33Å
62	D	91.4	Very high	81.6	Confident	62 Å²	62	101.9 Å²	101.9	33%	0.332	59%	0.591	S	S	.	*	H	α-helix	trans	-63.5	-41.6	176	-75.5	-0.1	0	0	0	110.4	H58 G66	H58-D62 WeakPolarHBondContact O-CB 3.43Å; H58-D62 PolarHBondContact O-N 3.17Å; D62-G66 VanDerWaalsContact O-CA 3.23Å; D62-G66 WeakPolarHBondContact O-CA 3.37Å; D62-G66 PolarHBondContact O-N 3.27Å
63	G	92.7	Very high	80.8	Confident	65 Å²	65	100.6 Å²	100.6	67%	0.67	59%	0.587	S	S	*	*	H	α-helix	trans	-65.6	-44.7	175.8	0	0	0	0	0	113.9	D59 A60 L61	D59-G63 PolarHBondContact O-N 2.95Å; A60-G63 PolarHBondContact O-N 3.31Å; L61-G63 VanDerWaalsContact C-N 3.33Å
64	D	92.5	Very high	79.9	Confident	138 Å²	138	103.7 Å²	103.7	74%	0.738	61%	0.606	S	S	*	*	H	α-helix	trans	-78.5	-38.9	-175.8	-73.1	-18.6	0	0	0	112.7	A60 L61	A60-D64 WeakPolarHBondContact O-CB 3.15Å; A60-D64 PolarHBondContact O-N 2.83Å; L61-D64 PolarHBondContact O-N 3.06Å
65	L	88.8	Confident	79	Confident	108 Å²	108	106.7 Å²	106.7	57%	0.565	62%	0.621	S	S	*	*	H	α-helix	trans	-108.3	-13.2	-169.7	-55	179.1	0	0	0	113.7	L61 K67	L61-L65 HydrophobicContact CD2-CD1 3.85Å; L61-L65 WeakPolarHBondContact O-CA 3.23Å; L61-L65 VanDerWaalsContact O-CB 3.25Å; L61-L65 WeakPolarHBondContact O-CB 3.32Å; L61-L65 PolarHBondContact O-N 3.33Å; L65-K67 HydrophobicContact CB-CG 4.27Å; L65-K67 PolarHBondContact O-N 3.36Å
66	G	73.4	Confident	78	Confident	66 Å²	66	103.9 Å²	103.9	68%	0.68	62%	0.617	S	S	*	*			trans	59.5	17.3	-178.1	0	0	0	0	0	114.3	D62	D62-G66 VanDerWaalsContact O-CA 3.23Å; D62-G66 WeakPolarHBondContact O-CA 3.37Å; D62-G66 PolarHBondContact O-N 3.27Å
67	K	59.1	Low	76.8	Confident	153 Å²	153	102 Å²	102	67%	0.665	62%	0.617	S	S	*	*			trans	-88.5	113.3	-179.2	-70.3	-170	179.5	-176.8	0	108.7	L65 S69	L65-K67 HydrophobicContact CB-CG 4.27Å; L65-K67 PolarHBondContact O-N 3.36Å; K67-S69 PolarHBondContact O-N 3.34Å
68	A	54.8	Low	75.6	Confident	91 Å²	91	104.5 Å²	104.5	75%	0.752	64%	0.636	S	S	*	*			trans	-52.2	115.5	168.3	0	0	0	0	0	108.7	S70	A68-S70 PolarHBondContact O-N 2.98Å; A68-S70 VanDerWaalsContact O-N 3.08Å
69	S	55.5	Low	74.3	Confident	56 Å²	56	105 Å²	105	39%	0.392	65%	0.649	S	S	.	*			trans	-37.6	117.4	176.3	47	0	0	0	0	110.9	K67 Q71	K67-S69 PolarHBondContact O-N 3.34Å; S69-Q71 PolarHBondContact O-N 3.32Å
70	S	60.3	Low	72.7	Confident	118 Å²	118	106.2 Å²	106.2	83%	0.825	66%	0.662	S	S	*	*			trans	-70.7	79.3	164	-63.3	0	0	0	0	106.8	A68 T72	A68-S70 PolarHBondContact O-N 2.98Å; A68-S70 VanDerWaalsContact O-N 3.08Å; S70-T72 PolarHBondContact O-N 3.41Å
71	Q	51.1	Low	70.9	Confident	176 Å²	176	110.8 Å²	110.8	82%	0.822	68%	0.682	S	S	*	*			trans	-64.1	122.2	168.3	-70.3	-170.5	-20.7	0	0	107.5	S69	S69-Q71 PolarHBondContact O-N 3.32Å
72	T	37.5	Very low	68.8	Low	209 Å²	209	112.9 Å²	112.9	100%	1.282	70%	0.702	S	S	*	*			trans	-117.8	0	163.7	-18.5	0	0	0	0	108	S70	S70-T72 PolarHBondContact O-N 3.41Å

Retrieved 72 of 72 residues in 18.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).