A0A087WS85_MOUSE Loading...

PDZ domain containing 2

AlphaFold DB , UniProt , Accession A0A087WS85, Species MOUSE (Mus musculus, Mouse), Gene Pdzd2, Length 36 aa.

						>A0A087WS85_MOUSE|A0A087WS85|Pdzd2
MLRRFKQKAHLTYNGNSGNSSEPGETPTLELGDQTS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	82.2	Confident	69.9	Low	238 Å²	238	180.8 Å²	180.8	100%	1.172	84%	0.837	S	S	*	*				0	119.9	0	-64.7	178.8	-71.6	0	0	108.4
2	L	81.8	Confident	68.3	Low	164 Å²	164	175.4 Å²	175.4	86%	0.859	83%	0.827	S	S	*	*	P	Polyproline II helix	trans	-75.1	129.8	-172.8	-170.4	61.8	0	0	0	110.6
3	R	77.3	Confident	66.8	Low	225 Å²	225	171.8 Å²	171.8	85%	0.849	80%	0.802	S	S	*	*	P	Polyproline II helix	trans	-69.4	136.7	172.9	-68	-171.8	-66	-88.2	1.2	109	F5	R3-F5 PolarHBondContact O-N 3.06Å
4	R	78.6	Confident	65.3	Low	236 Å²	236	167.7 Å²	167.7	89%	0.891	79%	0.788	S	S	*	*	P	Polyproline II helix	trans	-68	118.1	179.5	-59.1	-62	170.8	178.1	-3.4	109.2	K6	R4-K6 PolarHBondContact O-N 3.29Å
5	F	74.9	Confident	64.6	Low	194 Å²	194	156.8 Å²	156.8	85%	0.851	74%	0.738	S	S	*	*			trans	-66.8	115.8	168.3	180	-103.9	0	0	0	107.7	R3 Q7	R3-F5 PolarHBondContact O-N 3.06Å; F5-Q7 VanDerWaalsContact O-N 3.16Å; F5-Q7 PolarHBondContact O-N 2.85Å
6	K	71.1	Confident	63.6	Low	187 Å²	187	155.9 Å²	155.9	81%	0.813	74%	0.74	S	S	*	*			trans	-73.9	107.3	173.4	-139.4	-177.1	-171.3	-80.1	0	105.8	R4 K8	R4-K6 PolarHBondContact O-N 3.29Å; K6-K8 PolarHBondContact O-N 3.15Å
7	Q	65.8	Low	63.2	Low	161 Å²	161	153.1 Å²	153.1	75%	0.752	74%	0.741	S	S	*	*			trans	-55.3	107.9	167	-174.2	177.4	-0.5	0	0	106.1	F5 A9	F5-Q7 VanDerWaalsContact O-N 3.16Å; F5-Q7 PolarHBondContact O-N 2.85Å; Q7-A9 VanDerWaalsContact C-N 3.32Å; Q7-A9 PolarHBondContact O-N 2.83Å
8	K	61.7	Low	63	Low	191 Å²	191	146.7 Å²	146.7	83%	0.83	72%	0.722	S	S	*	*			trans	-63.3	111.2	157.1	-71.9	179.1	179.8	178.5	0	102.2	K6 H10	K6-K8 PolarHBondContact O-N 3.15Å; K8-H10 PolarHBondContact O-N 3.04Å; K8-H10 VanDerWaalsContact O-N 3.15Å
9	A	62.2	Low	62.3	Low	75 Å²	75	142.7 Å²	142.7	62%	0.62	70%	0.703	S	S	*	*			trans	-39.6	130.2	158.2	0	0	0	0	0	104.5	Q7 L11	Q7-A9 VanDerWaalsContact C-N 3.32Å; Q7-A9 PolarHBondContact O-N 2.83Å; A9-L11 PolarHBondContact O-N 3.1Å
10	H	55.9	Low	62.5	Low	156 Å²	156	140.3 Å²	140.3	72%	0.722	70%	0.701	S	S	*	*			trans	-35.3	128.3	164.5	-100.1	-123	0	0	0	104.8	K8 T12	K8-H10 PolarHBondContact O-N 3.04Å; K8-H10 VanDerWaalsContact O-N 3.15Å; H10-T12 PolarHBondContact O-N 2.86Å
11	L	57.7	Low	62.4	Low	162 Å²	162	137.9 Å²	137.9	85%	0.848	70%	0.698	S	S	*	*			trans	-54.8	85.9	141.5	-95.1	89.1	0	0	0	102	A9 Y13	A9-L11 PolarHBondContact O-N 3.1Å; L11-Y13 PolarHBondContact O-N 3.4Å
12	T	50.1	Low	61	Low	116 Å²	116	134.7 Å²	134.7	71%	0.712	68%	0.68	S	S	*	*			trans	-45.9	104.6	140.5	27.4	0	0	0	0	99.1	H10 N14	H10-T12 PolarHBondContact O-N 2.86Å; T12-N14 PolarHBondContact O-N 2.99Å
13	Y	49.6	Very low	59.7	Low	129 Å²	129	132.3 Å²	132.3	51%	0.506	67%	0.674	S	S	.	*			trans	-50.3	89.1	176	169.1	-105.7	0	0	0	104.2	L11 G15 N19	L11-Y13 PolarHBondContact O-N 3.4Å; Y13-G15 PolarHBondContact O-N 3.16Å; Y13-N19 PolarHBondContact OH-ND2 3.21Å; Y13-N19 WeakPolarHBondContact OH-CB 3.08Å; Y13-N19 WeakPolarHBondContact CE2-OD1 3.02Å; Y13-N19 WeakPolarHBondContact CE2-ND2 2.93Å; Y13-N19 WeakPolarHBondContact CD2-OD1 3.18Å; Y13-N19 HydrophobicContact CE2-CB 4.14Å; Y13-N19 WeakPolarHBondContact CE1-OD1 3.17Å; Y13-N19 WeakPolarHBondContact CE1-O 2.94Å; Y13-N19 HydrophobicContact CE1-CB 3.29Å; Y13-N19 VanDerWaalsContact CD2-OD1 3.24Å; Y13-N19 WeakPolarHBondContact CD1-OD1 3.33Å; Y13-N19 WeakPolarHBondContact CD1-O 3.11Å; Y13-N19 HydrophobicContact CD1-CB 4.24Å
14	N	46.1	Very low	58.9	Low	114 Å²	114	124.7 Å²	124.7	61%	0.61	67%	0.665	S	S	*	*			trans	-79.5	74.1	175.3	174.5	28.6	0	0	0	102.5	T12 N16 S17	T12-N14 PolarHBondContact O-N 2.99Å; N14-N16 PolarHBondContact O-N 2.62Å; N14-N16 PolarHBondContact OD1-N 3.26Å; N14-N16 VanDerWaalsContact OD1-N 3.12Å; N14-S17 PolarHBondContact O-N 2.89Å; N14-S17 PolarHBondContact O-OG 3.15Å; N14-S17 VanDerWaalsContact O-OG 3.07Å
15	G	53.5	Low	57.7	Low	4 Å²	4	121.7 Å²	121.7	4%	0.041	66%	0.662	C	S	.	*	B	Isolated β-bridge	trans	-89.9	68.8	154.7	0	0	0	0	0	111.2	Y13 G18 N19 S20	Y13-G15 PolarHBondContact O-N 3.16Å; G15-G18 WeakPolarHBondContact CA-O 2.91Å; G15-G18 CarbonylContact O-C 3.33Å; G15-N19 WeakPolarHBondContact O-CA 3.06Å; G15-N19 VanDerWaalsContact O-O 3.05Å; G15-N19 PolarHBondContact O-N 3Å; G15-N19 CarbonylContact O-C 2.64Å; G15-N19 PolarHBondContact N-OD1 2.87Å; G15-N19 VanDerWaalsContact N-O 3.09Å; G15-N19 PolarHBondContact N-O 3.07Å; G15-N19 WeakPolarHBondContact CA-OD1 2.9Å; G15-N19 WeakPolarHBondContact CA-O 3.24Å; G15-N19 CarbonylContact C-O 3.21Å; G15-S20 PolarHBondContact O-N 2.86Å
16	N	50	Low	56.9	Low	143 Å²	143	117.9 Å²	117.9	77%	0.765	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn		-130.2	41.4	115	-125.4	36.7	0	0	0	114.6	N14 G18	N14-N16 PolarHBondContact O-N 2.62Å; N14-N16 PolarHBondContact OD1-N 3.26Å; N14-N16 VanDerWaalsContact OD1-N 3.12Å; N16-G18 WeakPolarHBondContact OD1-CA 3.19Å
17	S	56.6	Low	56.2	Low	108 Å²	108	114.9 Å²	114.9	76%	0.755	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn		-83.6	44.4	119.4	59.3	0	0	0	0	111.7	N14	N14-S17 PolarHBondContact O-N 2.89Å; N14-S17 PolarHBondContact O-OG 3.15Å; N14-S17 VanDerWaalsContact O-OG 3.07Å
18	G	58.4	Low	56	Low	38 Å²	38	112.1 Å²	112.1	39%	0.392	65%	0.648	S	S	.	*	T	Hydrogen-bonded Turn	trans	75.6	120.5	-166.4	0	0	0	0	0	113.6	G15 N16	G15-G18 WeakPolarHBondContact CA-O 2.91Å; G15-G18 CarbonylContact O-C 3.33Å; N16-G18 WeakPolarHBondContact OD1-CA 3.19Å
19	N	50.3	Low	56	Low	70 Å²	70	109.9 Å²	109.9	37%	0.374	65%	0.645	S	S	.	*	B	Isolated β-bridge	trans	107.3	83.7	175	62.6	42.5	0	0	0	124.5	Y13 G15	Y13-N19 PolarHBondContact OH-ND2 3.21Å; Y13-N19 WeakPolarHBondContact OH-CB 3.08Å; Y13-N19 WeakPolarHBondContact CE2-OD1 3.02Å; Y13-N19 WeakPolarHBondContact CE2-ND2 2.93Å; Y13-N19 WeakPolarHBondContact CD2-OD1 3.18Å; Y13-N19 HydrophobicContact CE2-CB 4.14Å; Y13-N19 WeakPolarHBondContact CE1-OD1 3.17Å; Y13-N19 WeakPolarHBondContact CE1-O 2.94Å; Y13-N19 HydrophobicContact CE1-CB 3.29Å; Y13-N19 VanDerWaalsContact CD2-OD1 3.24Å; Y13-N19 WeakPolarHBondContact CD1-OD1 3.33Å; Y13-N19 WeakPolarHBondContact CD1-O 3.11Å; Y13-N19 HydrophobicContact CD1-CB 4.24Å; G15-N19 WeakPolarHBondContact O-CA 3.06Å; G15-N19 VanDerWaalsContact O-O 3.05Å; G15-N19 PolarHBondContact O-N 3Å; G15-N19 CarbonylContact O-C 2.64Å; G15-N19 PolarHBondContact N-OD1 2.87Å; G15-N19 VanDerWaalsContact N-O 3.09Å; G15-N19 PolarHBondContact N-O 3.07Å; G15-N19 WeakPolarHBondContact CA-OD1 2.9Å; G15-N19 WeakPolarHBondContact CA-O 3.24Å; G15-N19 CarbonylContact C-O 3.21Å
20	S	66.6	Low	56.4	Low	95 Å²	95	114 Å²	114	66%	0.664	65%	0.651	S	S	*	*			trans	-23.7	134.4	165.9	166.2	0	0	0	0	116.7	G15	G15-S20 PolarHBondContact O-N 2.86Å
21	S	59.3	Low	56.8	Low	89 Å²	89	113.2 Å²	113.2	62%	0.622	65%	0.652	S	S	*	*			trans	-162.4	102.7	155	-76	0	0	0	0	111.3
22	E	54.1	Low	57.2	Low	171 Å²	171	108.7 Å²	108.7	80%	0.799	64%	0.644	S	S	*	*			trans	-58.6	174.4	161.6	-125.6	106.5	177.6	0	0	111.8
23	P	54.6	Low	57.9	Low	115 Å²	115	110.5 Å²	110.5	75%	0.747	65%	0.649	S	S	*	*	S	Bend	trans	-69.8	142.9	-140.9	34.2	-37.3	0	0	0	113.2	E25	P23-E25 PolarHBondContact O-N 2.58Å
24	G	59.1	Low	58.6	Low	64 Å²	64	113.6 Å²	113.6	66%	0.66	67%	0.668	S	S	*	*			trans	-47.6	132.1	-178	0	0	0	0	0	112.9	T26	G24-T26 PolarHBondContact O-N 3.12Å
25	E	54.9	Low	59.1	Low	174 Å²	174	114 Å²	114	81%	0.813	68%	0.675	S	S	*	*			trans	-46.6	110.8	171.8	47	-87.5	-174.2	0	0	110.6	P23	P23-E25 PolarHBondContact O-N 2.58Å
26	T	57.9	Low	59.1	Low	113 Å²	113	123.3 Å²	123.3	69%	0.693	74%	0.739	S	S	*	*			trans	-57.8	128.8	163.2	47.8	0	0	0	0	106.8	G24 T28	G24-T26 PolarHBondContact O-N 3.12Å; T26-T28 PolarHBondContact O-N 3.09Å
27	P	56.7	Low	59.5	Low	125 Å²	125	122.3 Å²	122.3	81%	0.812	74%	0.738	S	S	*	*			trans	-60.6	107.6	175.6	24.3	-31.7	0	0	0	107.9	L29	P27-L29 PolarHBondContact O-N 2.94Å
28	T	60.3	Low	59.7	Low	103 Å²	103	123.1 Å²	123.1	63%	0.632	74%	0.737	S	S	*	*			trans	-63.8	109.7	175.7	-56.1	0	0	0	0	107.6	T26 E30	T26-T28 PolarHBondContact O-N 3.09Å; T28-E30 VanDerWaalsContact C-N 3.33Å; T28-E30 HydrophobicContact CG2-CG 4.39Å; T28-E30 WeakPolarHBondContact CG2-OE1 3.33Å; T28-E30 PolarHBondContact O-N 3.22Å; T28-E30 VanDerWaalsContact O-N 3.1Å
29	L	62.2	Low	59.8	Low	144 Å²	144	127.8 Å²	127.8	75%	0.754	76%	0.756	S	S	*	*			trans	-76.8	91.3	169.6	-170.6	85.5	0	0	0	106.3	P27 L31	P27-L29 PolarHBondContact O-N 2.94Å; L29-L31 VanDerWaalsContact C-N 3.28Å; L29-L31 HydrophobicContact CD2-CD1 3.56Å; L29-L31 HydrophobicContact CG-CD1 4.17Å; L29-L31 PolarHBondContact O-N 2.88Å
30	E	71.3	Confident	60.3	Low	161 Å²	161	131.2 Å²	131.2	75%	0.752	78%	0.779	S	S	*	*			trans	-62.6	91.3	172.2	-60.5	-67.8	152.8	0	0	108.3	T28 G32	T28-E30 VanDerWaalsContact C-N 3.33Å; T28-E30 HydrophobicContact CG2-CG 4.39Å; T28-E30 WeakPolarHBondContact CG2-OE1 3.33Å; T28-E30 PolarHBondContact O-N 3.22Å; T28-E30 VanDerWaalsContact O-N 3.1Å; E30-G32 VanDerWaalsContact C-N 3.34Å; E30-G32 PolarHBondContact O-N 2.72Å; E30-G32 VanDerWaalsContact O-N 3.15Å
31	L	64.6	Low	59.9	Low	140 Å²	140	133.4 Å²	133.4	73%	0.733	79%	0.786	S	S	*	*			trans	-78.3	90.8	167.4	-130.2	81.1	0	0	0	105.9	L29 D33	L29-L31 VanDerWaalsContact C-N 3.28Å; L29-L31 HydrophobicContact CD2-CD1 3.56Å; L29-L31 HydrophobicContact CG-CD1 4.17Å; L29-L31 PolarHBondContact O-N 2.88Å; L31-D33 PolarHBondContact O-N 3.32Å
32	G	65.5	Low	60	Low	66 Å²	66	136.4 Å²	136.4	68%	0.68	80%	0.797	S	S	*	*			trans	-55	128.2	178.6	0	0	0	0	0	111	E30 Q34	E30-G32 VanDerWaalsContact C-N 3.34Å; E30-G32 PolarHBondContact O-N 2.72Å; E30-G32 VanDerWaalsContact O-N 3.15Å; G32-Q34 VanDerWaalsContact C-N 3.32Å; G32-Q34 PolarHBondContact O-N 3.07Å
33	D	65.4	Low	60.4	Low	154 Å²	154	133.9 Å²	133.9	82%	0.824	80%	0.797	S	S	*	*			trans	-64.5	90.7	174.7	-73.8	-34.8	0	0	0	109.8	L31 T35	L31-D33 PolarHBondContact O-N 3.32Å; D33-T35 PolarHBondContact O-N 3.23Å
34	Q	64.3	Low	60.8	Low	195 Å²	195	135.4 Å²	135.4	91%	0.911	80%	0.8	S	S	*	*			trans	-72.1	88.3	154.9	-91.7	179.2	50.6	0	0	107.5	G32	G32-Q34 VanDerWaalsContact C-N 3.32Å; G32-Q34 PolarHBondContact O-N 3.07Å
35	T	55.1	Low	61	Low	121 Å²	121	141.3 Å²	141.3	74%	0.742	81%	0.812	S	S	*	*			trans	-115.5	105.4	160.1	35.9	0	0	0	0	109.8	D33	D33-T35 PolarHBondContact O-N 3.23Å
36	S	53.5	Low	61.5	Low	200 Å²	200	138.4 Å²	138.4	100%	1.399	81%	0.812	S	S	*	*			trans	44.8	0	160.1	-64.8	0	0	0	0	120.1

Retrieved 36 of 36 residues in 102.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).