A0A087WSC7_MOUSE Loading...

Alsin Rho guanine nucleotide exchange factor

AlphaFold DB , UniProt , Accession A0A087WSC7, Species MOUSE (Mus musculus, Mouse), Gene Als2, Length 69 aa.

						>A0A087WSC7_MOUSE|A0A087WSC7|Als2
MWGENAAGQCAVANQQYVPEPSPVSISDSETSPSLAVRILQLACGEEHTLALSLSREIWAWGTGCQLGL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	87.9	Confident	90.7	Very high	44 Å²	44	46.5 Å²	46.5	22%	0.217	27%	0.27	C	S	.	.				0	149.9	0	-67.4	-66.5	-83.9	0	0	108.8	Q9 C10 S22 V24 T49	M1-Q9 WeakPolarHBondContact CE-O 3.45Å; M1-C10 HydrophobicContact CB-CB 3.67Å; M1-C10 WeakPolarHBondContact CB-O 3.35Å; M1-S22 PolarHBondContact N-O 3.25Å; M1-S22 PolarHBondContact O-N 2.85Å; M1-S22 PolarHBondContact O-OG 2.81Å; M1-V24 HydrophobicContact CB-CG2 4.06Å; M1-V24 HydrophobicContact CG-CG2 3.77Å; M1-T49 HydrophobicContact CE-CG2 4.07Å; M1-T49 WeakPolarHBondContact CE-OG1 3.22Å
2	W	92.8	Very high	90.5	Very high	171 Å²	171	45.6 Å²	45.6	65%	0.648	27%	0.265	S	S	*	.			trans	-152.3	164.8	173.4	66.7	94.9	0	0	0	109.1	C10 V18 P21	W2-C10 VanDerWaalsContact C-SG 3.58Å; W2-C10 PolarHBondContact O-SG 2.93Å; W2-V18 HydrophobicContact CB-CG1 4.33Å; W2-P21 HydrophobicContact CD2-CG 4.25Å; W2-P21 HydrophobicContact CE3-CB 3.93Å; W2-P21 HydrophobicContact CE3-CG 4.08Å
3	G	92.8	Very high	90.2	Very high	15 Å²	15	48.3 Å²	48.3	16%	0.155	30%	0.296	C	S	.	.	E	Extended strand (participates in β ladder)	trans	104	-149.4	-178.3	0	0	0	0	0	113.1	Y17 V18	G3-Y17 WeakPolarHBondContact O-CD2 3.45Å; G3-V18 PolarHBondContact N-O 2.99Å; G3-V18 PolarHBondContact O-N 2.88Å
4	E	91.8	Very high	89.9	Confident	100 Å²	100	57.6 Å²	57.6	47%	0.467	34%	0.343	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-63	134.7	179.6	-172.8	52.1	-110.7	0	0	111.2	A6 Q9 C10	E4-A6 WeakPolarHBondContact OE1-CB 3.3Å; E4-A6 PolarHBondContact OE1-N 3.35Å; E4-Q9 WeakPolarHBondContact O-CG 3.42Å; E4-Q9 PolarHBondContact O-OE1 3.3Å; E4-C10 PolarHBondContact O-SG 3.02Å
5	N	92	Very high	90	Very high	6 Å²	6	59.4 Å²	59.4	3%	0.032	35%	0.347	C	S	.	.			trans	-139.5	14.6	-178.4	-165.4	47.4	0	0	0	112.6	A7 G8 Q9 C10 V12 Q15 Q16 V18	N5-A7 PolarHBondContact O-N 3.4Å; N5-G8 PolarHBondContact O-N 3.35Å; N5-G8 WeakPolarHBondContact OD1-CA 3.36Å; N5-G8 PolarHBondContact OD1-O 2.86Å; N5-Q9 VanDerWaalsContact C-OE1 3.31Å; N5-Q9 PolarHBondContact OD1-N 3.35Å; N5-C10 HydrophobicContact CB-CB 3.91Å; N5-C10 WeakPolarHBondContact OD1-CA 3.35Å; N5-C10 VanDerWaalsContact OD1-CB 3.26Å; N5-C10 WeakPolarHBondContact OD1-CB 3.5Å; N5-C10 PolarHBondContact OD1-N 3.42Å; N5-V12 PolarHBondContact ND2-O 3.31Å; N5-Q15 PolarHBondContact ND2-O 3.34Å; N5-Q16 CarbonylContact C-O 3.54Å; N5-Q16 WeakPolarHBondContact CA-O 3.43Å; N5-Q16 WeakPolarHBondContact CB-O 3.34Å; N5-Q16 PolarHBondContact N-O 2.89Å; N5-V18 HydrophobicContact CB-CG2 4.1Å
6	A	90.7	Very high	90	Very high	68 Å²	68	64.9 Å²	64.9	56%	0.562	37%	0.368	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.5	-30	177	0	0	0	0	0	113.2	E4 Q16	E4-A6 WeakPolarHBondContact OE1-CB 3.3Å; E4-A6 PolarHBondContact OE1-N 3.35Å; A6-Q16 PolarHBondContact N-O 2.87Å; A6-Q16 VanDerWaalsContact N-O 3.11Å
7	A	89.6	Confident	90.2	Very high	15 Å²	15	69.2 Å²	69.2	12%	0.124	38%	0.378	C	S	.	.	T	Hydrogen-bonded Turn	trans	-93.7	-1	175.8	0	0	0	0	0	113.2	N5 Q9 E47 G62 T63	N5-A7 PolarHBondContact O-N 3.4Å; A7-Q9 VanDerWaalsContact N-OE1 3.12Å; A7-E47 HydrophobicContact CB-CB 3.72Å; A7-E47 HydrophobicContact CB-CG 4.17Å; A7-E47 WeakPolarHBondContact CB-O 3.34Å; A7-G62 CarbonylContact O-C 3.17Å; A7-G62 WeakPolarHBondContact O-CA 3.13Å; A7-T63 PolarHBondContact O-N 2.97Å; A7-T63 PolarHBondContact O-OG1 2.85Å
8	G	89.9	Confident	90.4	Very high	28 Å²	28	65.6 Å²	65.6	29%	0.289	36%	0.359	S	S	.	.	S	Bend	trans	81.6	9.9	-174.6	0	0	0	0	0	114.5	N5 C10 A11 W61	N5-G8 PolarHBondContact O-N 3.35Å; N5-G8 WeakPolarHBondContact OD1-CA 3.36Å; N5-G8 PolarHBondContact OD1-O 2.86Å; G8-C10 PolarHBondContact O-N 3.12Å; G8-A11 PolarHBondContact O-N 3.38Å; G8-W61 VanDerWaalsContact O-CD1 3.3Å
9	Q	90.9	Very high	90.5	Very high	16 Å²	16	66.4 Å²	66.4	8%	0.075	37%	0.367	C	S	.	.	T	Hydrogen-bonded Turn	trans	-65.6	-19.1	-174.1	65.3	-90.1	62.4	0	0	114.5	M1 E4 N5 A7 A11 E46 T49 W61	M1-Q9 WeakPolarHBondContact CE-O 3.45Å; E4-Q9 WeakPolarHBondContact O-CG 3.42Å; E4-Q9 PolarHBondContact O-OE1 3.3Å; N5-Q9 VanDerWaalsContact C-OE1 3.31Å; N5-Q9 PolarHBondContact OD1-N 3.35Å; A7-Q9 VanDerWaalsContact N-OE1 3.12Å; Q9-A11 VanDerWaalsContact C-N 3.35Å; Q9-E46 PolarHBondContact NE2-O 3.35Å; Q9-T49 PolarHBondContact O-OG1 2.96Å; Q9-W61 PolarHBondContact O-NE1 3.16Å
10	C	89.4	Confident	90.7	Very high	3 Å²	3	70.2 Å²	70.2	2%	0.02	38%	0.382	C	S	.	.	T	Hydrogen-bonded Turn	trans	-84.9	-3.3	171.8	-68.4	0	0	0	0	113.7	M1 W2 E4 N5 G8 V12 V18 V24	M1-C10 HydrophobicContact CB-CB 3.67Å; M1-C10 WeakPolarHBondContact CB-O 3.35Å; W2-C10 VanDerWaalsContact C-SG 3.58Å; W2-C10 PolarHBondContact O-SG 2.93Å; E4-C10 PolarHBondContact O-SG 3.02Å; N5-C10 HydrophobicContact CB-CB 3.91Å; N5-C10 WeakPolarHBondContact OD1-CA 3.35Å; N5-C10 VanDerWaalsContact OD1-CB 3.26Å; N5-C10 WeakPolarHBondContact OD1-CB 3.5Å; N5-C10 PolarHBondContact OD1-N 3.42Å; G8-C10 PolarHBondContact O-N 3.12Å; C10-V12 HydrophobicContact CB-CG2 4.41Å; C10-V12 PolarHBondContact O-N 2.76Å; C10-V18 HydrophobicContact CB-CG2 3.97Å; C10-V24 WeakPolarHBondContact O-CG2 3.49Å
11	A	89.9	Confident	90.8	Very high	46 Å²	46	71.1 Å²	71.1	38%	0.38	39%	0.392	S	S	.	.			trans	54.1	32	-177.4	0	0	0	0	0	114.1	G8 Q9 V24 W61	G8-A11 PolarHBondContact O-N 3.38Å; Q9-A11 VanDerWaalsContact C-N 3.35Å; A11-V24 HydrophobicContact CB-CG1 3.64Å; A11-V24 HydrophobicContact CB-CG2 4.15Å; A11-W61 HydrophobicContact CB-CD2 4.37Å; A11-W61 HydrophobicContact CB-CG 4.24Å
12	V	88.7	Confident	90.9	Very high	35 Å²	35	70.5 Å²	70.5	21%	0.212	39%	0.392	C	S	.	.			trans	-107.3	122.2	172.6	-177.9	0	0	0	0	108.5	N5 C10 Q15 V18 S22	N5-V12 PolarHBondContact ND2-O 3.31Å; C10-V12 HydrophobicContact CB-CG2 4.41Å; C10-V12 PolarHBondContact O-N 2.76Å; V12-Q15 HydrophobicContact CG1-CB 4.07Å; V12-V18 HydrophobicContact CB-CG2 3.86Å; V12-V18 HydrophobicContact CG1-CG2 4.3Å; V12-V18 HydrophobicContact CG2-CG1 4.41Å; V12-V18 HydrophobicContact CG2-CG2 3.77Å; V12-S22 VanDerWaalsContact CG2-OG 3.26Å; V12-S22 WeakPolarHBondContact CG2-OG 3.39Å
13	A	85.9	Confident	90.8	Very high	81 Å²	81	68.4 Å²	68.4	67%	0.669	40%	0.4	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.7	150	179.1	0	0	0	0	0	111.6	Q15	A13-Q15 PolarHBondContact O-N 2.57Å
14	N	85.9	Confident	90.7	Very high	179 Å²	179	70.1 Å²	70.1	96%	0.957	41%	0.407	S	S	*	.	T	Hydrogen-bonded Turn	trans	58.5	26	172.7	-58.8	-35.1	0	0	0	115.6
15	Q	91.1	Very high	90.5	Very high	84 Å²	84	70.7 Å²	70.7	39%	0.393	42%	0.423	S	S	.	.			trans	-142.6	125	-178.7	-166.6	168.8	-13	0	0	110.5	N5 V12 A13 Y17 V18 P19	N5-Q15 PolarHBondContact ND2-O 3.34Å; V12-Q15 HydrophobicContact CG1-CB 4.07Å; A13-Q15 PolarHBondContact O-N 2.57Å; Q15-Y17 VanDerWaalsContact CG-O 3.23Å; Q15-Y17 WeakPolarHBondContact CG-O 3.34Å; Q15-Y17 PolarHBondContact NE2-O 3.37Å; Q15-V18 HydrophobicContact CG-CG2 4.45Å; Q15-P19 VanDerWaalsContact NE2-CD 3.33Å
16	Q	90.5	Very high	90.2	Very high	147 Å²	147	71.8 Å²	71.8	69%	0.687	43%	0.428	S	S	*	.	S	Bend	trans	-84.5	-22.6	179	-66.3	-167.7	-55.2	0	0	113.3	N5 A6	N5-Q16 CarbonylContact C-O 3.54Å; N5-Q16 WeakPolarHBondContact CA-O 3.43Å; N5-Q16 WeakPolarHBondContact CB-O 3.34Å; N5-Q16 PolarHBondContact N-O 2.89Å; A6-Q16 PolarHBondContact N-O 2.87Å; A6-Q16 VanDerWaalsContact N-O 3.11Å
17	Y	93.6	Very high	90.1	Very high	138 Å²	138	71.6 Å²	71.6	54%	0.541	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.2	128.7	178.8	-178.9	-92	0	0	0	110	G3 Q15 P19	G3-Y17 WeakPolarHBondContact O-CD2 3.45Å; Q15-Y17 VanDerWaalsContact CG-O 3.23Å; Q15-Y17 WeakPolarHBondContact CG-O 3.34Å; Q15-Y17 PolarHBondContact NE2-O 3.37Å; Y17-P19 HydrophobicContact CD1-CB 4.38Å; Y17-P19 HydrophobicContact CE1-CB 4.02Å; Y17-P19 WeakPolarHBondContact O-CD 3.34Å
18	V	93.9	Very high	89.8	Confident	5 Å²	5	72.1 Å²	72.1	3%	0.03	42%	0.423	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.5	102.4	-176	-178.5	0	0	0	0	108.7	W2 G3 N5 C10 V12 Q15 E20	W2-V18 HydrophobicContact CB-CG1 4.33Å; G3-V18 PolarHBondContact N-O 2.99Å; G3-V18 PolarHBondContact O-N 2.88Å; N5-V18 HydrophobicContact CB-CG2 4.1Å; C10-V18 HydrophobicContact CB-CG2 3.97Å; V12-V18 HydrophobicContact CB-CG2 3.86Å; V12-V18 HydrophobicContact CG1-CG2 4.3Å; V12-V18 HydrophobicContact CG2-CG1 4.41Å; V12-V18 HydrophobicContact CG2-CG2 3.77Å; Q15-V18 HydrophobicContact CG-CG2 4.45Å; V18-E20 VanDerWaalsContact CG1-O 3.25Å; V18-E20 WeakPolarHBondContact CG1-O 3.43Å; V18-E20 PolarHBondContact O-N 2.79Å
19	P	92.9	Very high	89.3	Confident	80 Å²	80	75.5 Å²	75.5	52%	0.519	44%	0.443	S	S	.	.			trans	-74.9	-26.1	-170.7	29.5	-35.3	0	0	0	113.7	Q15 Y17	Q15-P19 VanDerWaalsContact NE2-CD 3.33Å; Y17-P19 HydrophobicContact CD1-CB 4.38Å; Y17-P19 HydrophobicContact CE1-CB 4.02Å; Y17-P19 WeakPolarHBondContact O-CD 3.34Å
20	E	93.9	Very high	88.8	Confident	143 Å²	143	82.9 Å²	82.9	67%	0.668	48%	0.477	S	S	*	.	S	Bend	trans	-125.7	149.9	-174.4	-67.4	-65.8	159.2	0	0	110.3	V18 S22	V18-E20 VanDerWaalsContact CG1-O 3.25Å; V18-E20 WeakPolarHBondContact CG1-O 3.43Å; V18-E20 PolarHBondContact O-N 2.79Å; E20-S22 PolarHBondContact O-N 2.85Å; E20-S22 VanDerWaalsContact O-N 3.09Å
21	P	92.9	Very high	88	Confident	89 Å²	89	85.2 Å²	85.2	58%	0.578	49%	0.491	S	S	*	.			trans	-54.8	114.5	177.3	-25	34.6	0	0	0	113.1	W2	W2-P21 HydrophobicContact CD2-CG 4.25Å; W2-P21 HydrophobicContact CE3-CB 3.93Å; W2-P21 HydrophobicContact CE3-CG 4.08Å
22	S	90.3	Very high	87.4	Confident	31 Å²	31	89 Å²	89	22%	0.217	52%	0.515	C	S	.	.			trans	-101.6	135.6	174.4	69.4	0	0	0	0	112	M1 V12 E20	M1-S22 PolarHBondContact N-O 3.25Å; M1-S22 PolarHBondContact O-N 2.85Å; M1-S22 PolarHBondContact O-OG 2.81Å; V12-S22 VanDerWaalsContact CG2-OG 3.26Å; V12-S22 WeakPolarHBondContact CG2-OG 3.39Å; E20-S22 PolarHBondContact O-N 2.85Å; E20-S22 VanDerWaalsContact O-N 3.09Å
23	P	90.1	Very high	87	Confident	127 Å²	127	92.1 Å²	92.1	83%	0.825	54%	0.536	S	S	*	.			trans	-69.6	135.3	169.6	27.5	-31.3	0	0	0	110.2
24	V	89.7	Confident	86.6	Confident	51 Å²	51	92 Å²	92	31%	0.309	53%	0.531	S	S	.	.			trans	-113.3	127	176.1	177	0	0	0	0	108.3	M1 C10 A11	M1-V24 HydrophobicContact CB-CG2 4.06Å; M1-V24 HydrophobicContact CG-CG2 3.77Å; C10-V24 WeakPolarHBondContact O-CG2 3.49Å; A11-V24 HydrophobicContact CB-CG1 3.64Å; A11-V24 HydrophobicContact CB-CG2 4.15Å
25	S	87.9	Confident	86.5	Confident	113 Å²	113	88.5 Å²	88.5	79%	0.79	51%	0.511	S	S	*	.			trans	-107.2	123.7	176.3	-64.3	0	0	0	0	109.6
26	I	87.4	Confident	86.3	Confident	28 Å²	28	88.4 Å²	88.4	14%	0.144	53%	0.525	C	S	.	.			trans	-100.8	125.3	172.7	-59.1	171.5	0	0	0	106.9	V37 I39 A51 W59 W61	I26-V37 HydrophobicContact CB-CB 4.25Å; I26-V37 HydrophobicContact CG2-CB 3.97Å; I26-V37 HydrophobicContact CG2-CG2 4.01Å; I26-V37 PolarHBondContact O-N 3.19Å; I26-I39 HydrophobicContact CD1-CD1 3.77Å; I26-I39 HydrophobicContact CD1-CG1 3.91Å; I26-A51 HydrophobicContact CD1-CB 4.02Å; I26-W59 HydrophobicContact CG2-CD2 3.68Å; I26-W59 HydrophobicContact CG2-CE3 3.69Å; I26-W59 HydrophobicContact CG2-CG 4.11Å; I26-W59 HydrophobicContact CG2-CZ3 4.16Å; I26-W61 HydrophobicContact CD1-CH2 3.85Å; I26-W61 HydrophobicContact CD1-CZ3 3.56Å
27	S	87.1	Confident	86.2	Confident	64 Å²	64	82.5 Å²	82.5	45%	0.448	50%	0.498	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.9	135.8	177.3	-60.7	0	0	0	0	108.9	L35	S27-L35 WeakPolarHBondContact CA-O 3.36Å
28	D	83.1	Confident	86.2	Confident	26 Å²	26	84.9 Å²	84.9	14%	0.139	51%	0.507	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.4	119.3	172	176.3	19.6	0	0	0	109.2	E30 T31 S34 L35 V37 W59	D28-E30 WeakPolarHBondContact OD1-CB 3.21Å; D28-E30 PolarHBondContact OD1-N 2.82Å; D28-T31 WeakPolarHBondContact CB-OG1 3.37Å; D28-T31 VanDerWaalsContact CG-OG1 3.26Å; D28-T31 PolarHBondContact O-OG1 2.97Å; D28-T31 VanDerWaalsContact OD2-CG2 3.3Å; D28-T31 WeakPolarHBondContact OD2-CG2 3.48Å; D28-T31 PolarHBondContact OD2-OG1 3.42Å; D28-S34 WeakPolarHBondContact O-CA 3.44Å; D28-S34 VanDerWaalsContact O-CB 3.31Å; D28-S34 WeakPolarHBondContact O-CB 3.31Å; D28-L35 PolarHBondContact N-O 3.46Å; D28-L35 PolarHBondContact O-N 3.09Å; D28-V37 HydrophobicContact CB-CG2 4.01Å; D28-W59 HydrophobicContact CB-CH2 3.86Å; D28-W59 HydrophobicContact CB-CZ2 4.09Å
29	S	80.4	Confident	86.1	Confident	99 Å²	99	87.6 Å²	87.6	69%	0.692	52%	0.52	S	S	*	.	S	Bend	trans	-88	-14	179.3	56.3	0	0	0	0	113.5	T31	S29-T31 VanDerWaalsContact C-N 3.3Å
30	E	81	Confident	86.2	Confident	172 Å²	172	89.2 Å²	89.2	80%	0.804	52%	0.524	S	S	*	.	S	Bend	trans	-78.2	-21.4	178.5	-63.3	-67	106.1	0	0	111.3	D28	D28-E30 WeakPolarHBondContact OD1-CB 3.21Å; D28-E30 PolarHBondContact OD1-N 2.82Å
31	T	72.3	Confident	86.1	Confident	51 Å²	51	88.5 Å²	88.5	31%	0.313	52%	0.52	S	S	.	.	S	Bend	trans	-85.8	136	171.4	37.4	0	0	0	0	111.4	D28 S29 P33 S34	D28-T31 WeakPolarHBondContact CB-OG1 3.37Å; D28-T31 VanDerWaalsContact CG-OG1 3.26Å; D28-T31 PolarHBondContact O-OG1 2.97Å; D28-T31 VanDerWaalsContact OD2-CG2 3.3Å; D28-T31 WeakPolarHBondContact OD2-CG2 3.48Å; D28-T31 PolarHBondContact OD2-OG1 3.42Å; S29-T31 VanDerWaalsContact C-N 3.3Å; T31-P33 CarbonylContact C-O 3.54Å; T31-P33 CarbonylContact O-C 3.58Å; T31-P33 VanDerWaalsContact O-O 3.12Å; T31-S34 VanDerWaalsContact O-CA 3.27Å; T31-S34 WeakPolarHBondContact O-CA 3.39Å; T31-S34 PolarHBondContact O-N 3.27Å; T31-S34 VanDerWaalsContact O-N 3.1Å
32	S	76.4	Confident	86.1	Confident	126 Å²	126	88.6 Å²	88.6	88%	0.881	52%	0.516	S	S	*	.	S	Bend	trans	-116.4	114	175.4	-177.8	0	0	0	0	110
33	P	80.3	Confident	86.2	Confident	100 Å²	100	89.4 Å²	89.4	65%	0.649	52%	0.524	S	S	*	.	S	Bend	cis	-70.1	158.8	-1.2	31.1	-35.7	0	0	0	112.9	T31 L35	T31-P33 CarbonylContact C-O 3.54Å; T31-P33 CarbonylContact O-C 3.58Å; T31-P33 VanDerWaalsContact O-O 3.12Å; P33-L35 PolarHBondContact O-N 2.99Å
34	S	78.6	Confident	86.1	Confident	80 Å²	80	87.6 Å²	87.6	56%	0.559	51%	0.514	S	S	*	.	P	Polyproline II helix	trans	-59.6	120.3	177.1	61.5	0	0	0	0	110.3	D28 T31	D28-S34 WeakPolarHBondContact O-CA 3.44Å; D28-S34 VanDerWaalsContact O-CB 3.31Å; D28-S34 WeakPolarHBondContact O-CB 3.31Å; T31-S34 VanDerWaalsContact O-CA 3.27Å; T31-S34 WeakPolarHBondContact O-CA 3.39Å; T31-S34 PolarHBondContact O-N 3.27Å; T31-S34 VanDerWaalsContact O-N 3.1Å
35	L	82.8	Confident	86	Confident	104 Å²	104	86.7 Å²	86.7	55%	0.545	52%	0.515	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97	137	-176.4	-72.4	168.9	0	0	0	111.2	S27 D28 P33 V37	S27-L35 WeakPolarHBondContact CA-O 3.36Å; D28-L35 PolarHBondContact N-O 3.46Å; D28-L35 PolarHBondContact O-N 3.09Å; P33-L35 PolarHBondContact O-N 2.99Å; L35-V37 PolarHBondContact O-N 3.1Å
36	A	86.4	Confident	86	Confident	82 Å²	82	89.6 Å²	89.6	68%	0.678	52%	0.516	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-65.6	124.5	170	0	0	0	0	0	109.7
37	V	89.9	Confident	86.1	Confident	23 Å²	23	92.8 Å²	92.8	14%	0.139	53%	0.53	C	S	.	.	P	Polyproline II helix	trans	-83.6	122.8	-178.3	-175.3	0	0	0	0	109.3	I26 D28 L35 I39 S53 W59	I26-V37 HydrophobicContact CB-CB 4.25Å; I26-V37 HydrophobicContact CG2-CB 3.97Å; I26-V37 HydrophobicContact CG2-CG2 4.01Å; I26-V37 PolarHBondContact O-N 3.19Å; D28-V37 HydrophobicContact CB-CG2 4.01Å; L35-V37 PolarHBondContact O-N 3.1Å; V37-I39 HydrophobicContact CB-CD1 4.5Å; V37-I39 HydrophobicContact CG1-CD1 3.85Å; V37-I39 PolarHBondContact O-N 2.8Å; V37-S53 VanDerWaalsContact CG1-CB 3.42Å; V37-W59 HydrophobicContact CG2-CH2 4.34Å; V37-W59 HydrophobicContact CG2-CZ2 3.74Å
38	R	91.9	Very high	86.1	Confident	189 Å²	189	90.9 Å²	90.9	71%	0.713	51%	0.514	S	S	*	.			trans	-82.4	115.3	175.6	-71.5	-100.6	-80.6	-102.6	-3.3	109.5	S53 L54	R38-S53 CarbonylContact O-C 3.36Å; R38-S53 WeakPolarHBondContact O-CA 3.45Å; R38-L54 HydrophobicContact CB-CB 4.43Å; R38-L54 HydrophobicContact CB-CD1 3.62Å; R38-L54 HydrophobicContact CB-CG 4.05Å; R38-L54 HydrophobicContact CG-CD1 4.44Å; R38-L54 PolarHBondContact O-N 2.94Å
39	I	92.5	Very high	86.5	Confident	61 Å²	61	89.7 Å²	89.7	31%	0.313	51%	0.508	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.1	134	180	-56.2	-52.3	0	0	0	110.8	I26 V37 Q41 L42 A51	I26-I39 HydrophobicContact CD1-CD1 3.77Å; I26-I39 HydrophobicContact CD1-CG1 3.91Å; V37-I39 HydrophobicContact CB-CD1 4.5Å; V37-I39 HydrophobicContact CG1-CD1 3.85Å; V37-I39 PolarHBondContact O-N 2.8Å; I39-Q41 WeakPolarHBondContact CG2-O 3.12Å; I39-L42 HydrophobicContact CG2-CD2 4Å; I39-L42 HydrophobicContact CG2-CG 4.11Å; I39-A51 HydrophobicContact CD1-CB 3.91Å; I39-A51 HydrophobicContact CG1-CB 4.35Å; I39-A51 HydrophobicContact CG2-CB 4.01Å
40	L	94.7	Very high	87.1	Confident	114 Å²	114	87.8 Å²	87.8	60%	0.597	49%	0.489	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-93.3	-45.2	175.6	-177.8	68	0	0	0	111.4	L52 L54	L40-L52 HydrophobicContact CD2-CD2 4.26Å; L40-L52 PolarHBondContact N-O 3Å; L40-L54 HydrophobicContact CB-CD2 4.12Å; L40-L54 HydrophobicContact CD1-CD2 3.85Å; L40-L54 HydrophobicContact CG-CD2 4.44Å
41	Q	92.9	Very high	87.6	Confident	128 Å²	128	79.6 Å²	79.6	60%	0.598	45%	0.451	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-145.9	148.5	-174.8	-167	176.6	-51.3	0	0	111.1	I39 A51 L52	I39-Q41 WeakPolarHBondContact CG2-O 3.12Å; Q41-A51 WeakPolarHBondContact O-CA 3.37Å; Q41-L52 HydrophobicContact CB-CB 4.4Å; Q41-L52 PolarHBondContact N-O 2.92Å; Q41-L52 PolarHBondContact O-N 2.9Å
42	L	91.9	Very high	88.6	Confident	91 Å²	91	80.1 Å²	80.1	48%	0.476	45%	0.452	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.3	146.3	172.6	-68.4	170.3	0	0	0	109.9	I39 T49 L50 A51 W61	I39-L42 HydrophobicContact CG2-CD2 4Å; I39-L42 HydrophobicContact CG2-CG 4.11Å; L42-T49 HydrophobicContact CD2-CG2 4.35Å; L42-L50 CarbonylContact C-O 3.06Å; L42-L50 WeakPolarHBondContact CA-O 3.43Å; L42-A51 HydrophobicContact CD2-CB 3.41Å; L42-A51 VanDerWaalsContact CD2-CB 3.41Å; L42-W61 HydrophobicContact CD2-CH2 3.94Å
43	A	92.3	Very high	89.4	Confident	48 Å²	48	74.2 Å²	74.2	40%	0.397	41%	0.41	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.7	129.1	166.9	0	0	0	0	0	108.7	T49 L50	A43-T49 WeakPolarHBondContact O-CA 3.38Å; A43-L50 HydrophobicContact CB-CB 4.47Å; A43-L50 PolarHBondContact N-O 2.86Å; A43-L50 PolarHBondContact O-N 3.46Å
44	C	89.6	Confident	89.9	Confident	89 Å²	89	74.1 Å²	74.1	60%	0.601	40%	0.404	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-109.8	124.4	-179	-55.2	0	0	0	0	109.4
45	G	87	Confident	90.5	Very high	32 Å²	32	73.9 Å²	73.9	33%	0.33	40%	0.402	S	S	.	.			trans	-90	-169	163.4	0	0	0	0	0	111.2	H48	G45-H48 WeakPolarHBondContact CA-O 3.1Å; G45-H48 PolarHBondContact N-O 2.84Å
46	E	87.1	Confident	90.9	Very high	174 Å²	174	79.6 Å²	79.6	81%	0.813	42%	0.417	S	S	*	.	S	Bend	trans	-66.6	-47.1	177.2	-172.4	172.7	-173.7	0	0	111.8	Q9	Q9-E46 PolarHBondContact NE2-O 3.35Å
47	E	89.4	Confident	91.1	Very high	96 Å²	96	79.6 Å²	79.6	45%	0.449	40%	0.403	S	S	.	.	S	Bend	trans	-122.3	2.6	-174.3	-63.5	-168.9	157.9	0	0	114	A7 G62 T63	A7-E47 HydrophobicContact CB-CB 3.72Å; A7-E47 HydrophobicContact CB-CG 4.17Å; A7-E47 WeakPolarHBondContact CB-O 3.34Å; E47-G62 CarbonylContact O-C 3.18Å; E47-G62 WeakPolarHBondContact O-CA 3.37Å; E47-T63 CarbonylContact C-O 3.59Å; E47-T63 WeakPolarHBondContact CB-O 3.27Å; E47-T63 PolarHBondContact O-N 3.09Å
48	H	88.6	Confident	91.1	Very high	23 Å²	23	84.7 Å²	84.7	11%	0.106	43%	0.428	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.5	157.1	-178.4	66.9	-86	0	0	0	112.1	G45 W61 Q66 L67	G45-H48 WeakPolarHBondContact CA-O 3.1Å; G45-H48 PolarHBondContact N-O 2.84Å; H48-W61 WeakPolarHBondContact CA-O 3.26Å; H48-Q66 PolarHBondContact CE1-OE1 2.71Å; H48-Q66 PolarHBondContact NE2-OE1 2.83Å; H48-L67 HydrophobicContact CB-CD2 4.34Å
49	T	90.8	Very high	91	Very high	1 Å²	1	78.8 Å²	78.8	1%	0.006	41%	0.406	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.2	137.1	173.3	-56.8	0	0	0	0	109.7	M1 Q9 L42 A43 A60 W61	M1-T49 HydrophobicContact CE-CG2 4.07Å; M1-T49 WeakPolarHBondContact CE-OG1 3.22Å; Q9-T49 PolarHBondContact O-OG1 2.96Å; L42-T49 HydrophobicContact CD2-CG2 4.35Å; A43-T49 WeakPolarHBondContact O-CA 3.38Å; T49-A60 WeakPolarHBondContact O-CA 3.26Å; T49-W61 VanDerWaalsContact CB-CE2 3.49Å; T49-W61 HydrophobicContact CG2-CH2 3.72Å; T49-W61 HydrophobicContact CG2-CZ2 3.27Å; T49-W61 PolarHBondContact N-O 3.34Å; T49-W61 PolarHBondContact O-N 2.95Å; T49-W61 VanDerWaalsContact O-N 3.09Å
50	L	91.9	Very high	90.9	Very high	59 Å²	59	78.3 Å²	78.3	31%	0.309	41%	0.411	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.9	139	175.8	-64.7	165.7	0	0	0	109.4	L42 A43 I58 W59 A60	L42-L50 CarbonylContact C-O 3.06Å; L42-L50 WeakPolarHBondContact CA-O 3.43Å; A43-L50 HydrophobicContact CB-CB 4.47Å; A43-L50 PolarHBondContact N-O 2.86Å; A43-L50 PolarHBondContact O-N 3.46Å; L50-I58 HydrophobicContact CD2-CG2 4.16Å; L50-W59 CarbonylContact C-O 3.47Å; L50-W59 WeakPolarHBondContact CA-O 3.35Å; L50-A60 HydrophobicContact CD2-CB 3.57Å
51	A	92.4	Very high	90.7	Very high	1 Å²	1	75 Å²	75	1%	0.008	39%	0.39	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.5	128.3	175.8	0	0	0	0	0	111.1	I26 I39 Q41 L42 I58 W59 W61	I26-A51 HydrophobicContact CD1-CB 4.02Å; I39-A51 HydrophobicContact CD1-CB 3.91Å; I39-A51 HydrophobicContact CG1-CB 4.35Å; I39-A51 HydrophobicContact CG2-CB 4.01Å; Q41-A51 WeakPolarHBondContact O-CA 3.37Å; L42-A51 HydrophobicContact CD2-CB 3.41Å; L42-A51 VanDerWaalsContact CD2-CB 3.41Å; A51-I58 WeakPolarHBondContact O-CA 3.17Å; A51-W59 HydrophobicContact CB-CB 4.27Å; A51-W59 PolarHBondContact N-O 3.2Å; A51-W59 PolarHBondContact O-N 3.48Å; A51-W61 HydrophobicContact CB-CH2 3.85Å; A51-W61 HydrophobicContact CB-CZ3 3.67Å
52	L	93.8	Very high	90.4	Very high	62 Å²	62	70 Å²	70	33%	0.325	37%	0.373	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95	119.8	172.8	178.5	63.3	0	0	0	109.1	L40 Q41 I58	L40-L52 HydrophobicContact CD2-CD2 4.26Å; L40-L52 PolarHBondContact N-O 3Å; Q41-L52 HydrophobicContact CB-CB 4.4Å; Q41-L52 PolarHBondContact N-O 2.92Å; Q41-L52 PolarHBondContact O-N 2.9Å; L52-I58 HydrophobicContact CD1-CG1 4.24Å
53	S	92.7	Very high	89.7	Confident	1 Å²	1	69.2 Å²	69.2	1%	0.007	37%	0.372	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81	162.6	175.7	75.5	0	0	0	0	112.6	V37 R38 S55 R56 E57	V37-S53 VanDerWaalsContact CG1-CB 3.42Å; R38-S53 CarbonylContact O-C 3.36Å; R38-S53 WeakPolarHBondContact O-CA 3.45Å; S53-S55 PolarHBondContact O-N 2.82Å; S53-S55 PolarHBondContact OG-N 3.2Å; S53-S55 PolarHBondContact OG-OG 2.9Å; S53-R56 PolarHBondContact O-N 2.61Å; S53-R56 PolarHBondContact OG-N 2.77Å; S53-E57 PolarHBondContact N-O 3.2Å; S53-E57 WeakPolarHBondContact OG-CB 3.49Å; S53-E57 PolarHBondContact OG-N 3.39Å; S53-E57 PolarHBondContact OG-O 2.84Å; S53-E57 PolarHBondContact OG-OE2 3.17Å
54	L	91.6	Very high	88.5	Confident	98 Å²	98	68.6 Å²	68.6	51%	0.513	37%	0.37	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.5	-27.5	170.5	-73.5	-179.9	0	0	0	112.9	R38 L40 R56	R38-L54 HydrophobicContact CB-CB 4.43Å; R38-L54 HydrophobicContact CB-CD1 3.62Å; R38-L54 HydrophobicContact CB-CG 4.05Å; R38-L54 HydrophobicContact CG-CD1 4.44Å; R38-L54 PolarHBondContact O-N 2.94Å; L40-L54 HydrophobicContact CB-CD2 4.12Å; L40-L54 HydrophobicContact CD1-CD2 3.85Å; L40-L54 HydrophobicContact CG-CD2 4.44Å; L54-R56 PolarHBondContact O-N 3.21Å
55	S	89.5	Confident	86.8	Confident	75 Å²	75	71 Å²	71	52%	0.524	39%	0.386	S	S	.	.	T	Hydrogen-bonded Turn	trans	-74.3	0.9	172.6	32.7	0	0	0	0	113.3	S53 E57	S53-S55 PolarHBondContact O-N 2.82Å; S53-S55 PolarHBondContact OG-N 3.2Å; S53-S55 PolarHBondContact OG-OG 2.9Å; S55-E57 VanDerWaalsContact C-N 3.29Å; S55-E57 WeakPolarHBondContact CB-OE2 3.25Å; S55-E57 PolarHBondContact OG-OE2 2.81Å
56	R	90.9	Very high	85.4	Confident	224 Å²	224	76.5 Å²	76.5	85%	0.845	40%	0.404	S	S	*	.	S	Bend	trans	66.3	27.8	-176.5	-51.9	179.9	172	-130.6	-1	113.8	S53 L54	S53-R56 PolarHBondContact O-N 2.61Å; S53-R56 PolarHBondContact OG-N 2.77Å; L54-R56 PolarHBondContact O-N 3.21Å
57	E	91	Very high	83.9	Confident	82 Å²	82	71 Å²	71	38%	0.383	38%	0.379	S	S	.	.			trans	-92.2	146.1	171.5	-59	156.3	145.4	0	0	109.2	S53 S55	S53-E57 PolarHBondContact N-O 3.2Å; S53-E57 WeakPolarHBondContact OG-CB 3.49Å; S53-E57 PolarHBondContact OG-N 3.39Å; S53-E57 PolarHBondContact OG-O 2.84Å; S53-E57 PolarHBondContact OG-OE2 3.17Å; S55-E57 VanDerWaalsContact C-N 3.29Å; S55-E57 WeakPolarHBondContact CB-OE2 3.25Å; S55-E57 PolarHBondContact OG-OE2 2.81Å
58	I	90.9	Very high	81.9	Confident	130 Å²	130	69.8 Å²	69.8	67%	0.667	39%	0.393	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-105.7	124.5	175	-61.1	175.9	0	0	0	107.8	L50 A51 L52	L50-I58 HydrophobicContact CD2-CG2 4.16Å; A51-I58 WeakPolarHBondContact O-CA 3.17Å; L52-I58 HydrophobicContact CD1-CG1 4.24Å
59	W	90	Very high	79.7	Confident	66 Å²	66	80.2 Å²	80.2	25%	0.25	45%	0.448	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.9	139.4	174.8	-61.7	76.4	0	0	0	108.5	I26 D28 V37 L50 A51 W61	I26-W59 HydrophobicContact CG2-CD2 3.68Å; I26-W59 HydrophobicContact CG2-CE3 3.69Å; I26-W59 HydrophobicContact CG2-CG 4.11Å; I26-W59 HydrophobicContact CG2-CZ3 4.16Å; D28-W59 HydrophobicContact CB-CH2 3.86Å; D28-W59 HydrophobicContact CB-CZ2 4.09Å; V37-W59 HydrophobicContact CG2-CH2 4.34Å; V37-W59 HydrophobicContact CG2-CZ2 3.74Å; L50-W59 CarbonylContact C-O 3.47Å; L50-W59 WeakPolarHBondContact CA-O 3.35Å; A51-W59 HydrophobicContact CB-CB 4.27Å; A51-W59 PolarHBondContact N-O 3.2Å; A51-W59 PolarHBondContact O-N 3.48Å; W59-W61 HydrophobicContact CB-CZ3 4.47Å
60	A	90.4	Very high	79.2	Confident	51 Å²	51	84.2 Å²	84.2	42%	0.421	47%	0.47	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.1	138.7	-178.2	0	0	0	0	0	110.2	T49 L50 L67	T49-A60 WeakPolarHBondContact O-CA 3.26Å; L50-A60 HydrophobicContact CD2-CB 3.57Å; A60-L67 HydrophobicContact CB-CD2 3.62Å
61	W	89.5	Confident	78.5	Confident	44 Å²	44	85.5 Å²	85.5	17%	0.167	48%	0.478	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.8	167.9	171.9	64.4	87.7	0	0	0	110.3	G8 Q9 A11 I26 L42 H48 T49 A51 W59	G8-W61 VanDerWaalsContact O-CD1 3.3Å; Q9-W61 PolarHBondContact O-NE1 3.16Å; A11-W61 HydrophobicContact CB-CD2 4.37Å; A11-W61 HydrophobicContact CB-CG 4.24Å; I26-W61 HydrophobicContact CD1-CH2 3.85Å; I26-W61 HydrophobicContact CD1-CZ3 3.56Å; L42-W61 HydrophobicContact CD2-CH2 3.94Å; H48-W61 WeakPolarHBondContact CA-O 3.26Å; T49-W61 VanDerWaalsContact CB-CE2 3.49Å; T49-W61 HydrophobicContact CG2-CH2 3.72Å; T49-W61 HydrophobicContact CG2-CZ2 3.27Å; T49-W61 PolarHBondContact N-O 3.34Å; T49-W61 PolarHBondContact O-N 2.95Å; T49-W61 VanDerWaalsContact O-N 3.09Å; A51-W61 HydrophobicContact CB-CH2 3.85Å; A51-W61 HydrophobicContact CB-CZ3 3.67Å; W59-W61 HydrophobicContact CB-CZ3 4.47Å
62	G	86.4	Confident	77.8	Confident	23 Å²	23	90.2 Å²	90.2	24%	0.237	51%	0.505	C	S	.	.	E	Extended strand (participates in β ladder)	trans	103.7	-155.2	-170.4	0	0	0	0	0	111.3	A7 E47 L67	A7-G62 CarbonylContact O-C 3.17Å; A7-G62 WeakPolarHBondContact O-CA 3.13Å; E47-G62 CarbonylContact O-C 3.18Å; E47-G62 WeakPolarHBondContact O-CA 3.37Å; G62-L67 WeakPolarHBondContact O-CD1 3.23Å
63	T	78.6	Confident	76.8	Confident	75 Å²	75	91.8 Å²	91.8	46%	0.46	52%	0.515	S	S	.	.	S	Bend	trans	-129.5	147.4	179.9	-48.1	0	0	0	0	110.6	A7 E47	A7-T63 PolarHBondContact O-N 2.97Å; A7-T63 PolarHBondContact O-OG1 2.85Å; E47-T63 CarbonylContact C-O 3.59Å; E47-T63 WeakPolarHBondContact CB-O 3.27Å; E47-T63 PolarHBondContact O-N 3.09Å
64	G	66.4	Low	75.8	Confident	34 Å²	34	97.5 Å²	97.5	35%	0.351	55%	0.547	S	S	.	.	S	Bend	trans	143.1	155.7	174.7	0	0	0	0	0	114.3	Q66 L67	G64-Q66 PolarHBondContact O-N 3.11Å; G64-Q66 VanDerWaalsContact O-N 3.12Å; G64-L67 WeakPolarHBondContact O-CB 3.19Å; G64-L67 WeakPolarHBondContact O-CG 3.43Å; G64-L67 PolarHBondContact O-N 3.19Å; G64-L67 VanDerWaalsContact O-N 3.16Å
65	C	54.6	Low	74.8	Confident	139 Å²	139	97.5 Å²	97.5	94%	0.939	55%	0.549	S	S	*	.	G	3₁₀ helix	trans	-64.5	-14.5	179.8	-51.1	0	0	0	0	113.8	L67	C65-L67 PolarHBondContact O-N 3.48Å
66	Q	56.3	Low	73.7	Confident	149 Å²	149	99.1 Å²	99.1	70%	0.696	55%	0.551	S	S	*	*	G	3₁₀ helix	trans	-77.1	-1.9	176.8	-67.3	175.2	19.5	0	0	113	H48 G64 G68	H48-Q66 PolarHBondContact CE1-OE1 2.71Å; H48-Q66 PolarHBondContact NE2-OE1 2.83Å; G64-Q66 PolarHBondContact O-N 3.11Å; G64-Q66 VanDerWaalsContact O-N 3.12Å; Q66-G68 PolarHBondContact O-N 2.8Å
67	L	56.6	Low	72.4	Confident	57 Å²	57	89.5 Å²	89.5	30%	0.298	53%	0.528	S	S	.	.	G	3₁₀ helix	trans	-77.9	-3.1	174.4	-64.3	171.5	0	0	0	113.6	H48 A60 G62 G64 C65 L69	H48-L67 HydrophobicContact CB-CD2 4.34Å; A60-L67 HydrophobicContact CB-CD2 3.62Å; G62-L67 WeakPolarHBondContact O-CD1 3.23Å; G64-L67 WeakPolarHBondContact O-CB 3.19Å; G64-L67 WeakPolarHBondContact O-CG 3.43Å; G64-L67 PolarHBondContact O-N 3.19Å; G64-L67 VanDerWaalsContact O-N 3.16Å; C65-L67 PolarHBondContact O-N 3.48Å; L67-L69 PolarHBondContact O-N 2.77Å
68	G	46.8	Very low	70.8	Confident	71 Å²	71	90.1 Å²	90.1	73%	0.732	54%	0.54	S	S	*	.			trans	64.2	34.1	163.6	0	0	0	0	0	116	Q66	Q66-G68 PolarHBondContact O-N 2.8Å
69	L	43.7	Very low	69	Low	242 Å²	242	86.5 Å²	86.5	100%	1.267	53%	0.529	S	S	*	.			trans	-90.5	0	164.4	-88	159.8	0	0	0	111	L67	L67-L69 PolarHBondContact O-N 2.77Å

Retrieved 69 of 69 residues in 110.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).