A0A087WSD3_MOUSE Loading...

aspartyl aminopeptidase

AlphaFold DB , UniProt , Accession A0A087WSD3, Species MOUSE (Mus musculus, Mouse), Gene Dnpep, Length 92 aa.

						>A0A087WSD3_MOUSE|A0A087WSD3|Dnpep
MQMAMNGRARKEAIQATARELLKFVNRSPSPFHVVAECRSRLLQAGFRELKETEGWDIVPENKVKRKSRRSQVGYHQVGVETYGGGIWSTWF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.6	Very low	71.6	Confident	248 Å²	248	142.8 Å²	142.8	100%	1.222	73%	0.726	S	S	*	*				0	66.9	0	-170.5	160.9	104.8	0	0	110.1
2	Q	52.7	Low	73.6	Confident	172 Å²	172	140.3 Å²	140.3	80%	0.804	71%	0.709	S	S	*	*			trans	-149.5	-14.5	-179.3	-141	165.4	16.5	0	0	114
3	M	53.8	Low	75.2	Confident	180 Å²	180	133.8 Å²	133.8	89%	0.887	69%	0.69	S	S	*	*	S	Bend	trans	-81.5	-19.6	-175.4	-56.2	-147.9	91.7	0	0	115.2
4	A	56.9	Low	76.7	Confident	91 Å²	91	131.1 Å²	131.1	75%	0.752	68%	0.676	S	S	*	*	H	α-helix	trans	-78	-23.8	-179.8	0	0	0	0	0	113.9	N6	A4-N6 VanDerWaalsContact C-N 3.32Å; A4-N6 PolarHBondContact O-N 3.47Å
5	M	57.4	Low	78.1	Confident	149 Å²	149	128.2 Å²	128.2	73%	0.734	66%	0.659	S	S	*	*	H	α-helix	trans	-70.7	-26.4	-178.4	-70.5	-66.3	-162.2	0	0	112.9	A9	M5-A9 PolarHBondContact O-N 3.44Å
6	N	72.9	Confident	79.3	Confident	126 Å²	126	123.4 Å²	123.4	67%	0.674	64%	0.644	S	S	*	*	H	α-helix	trans	-74.2	-35	-174	-158.8	10.4	0	0	0	112.8	A4 R10	A4-N6 VanDerWaalsContact C-N 3.32Å; A4-N6 PolarHBondContact O-N 3.47Å; N6-R10 WeakPolarHBondContact O-CB 3.38Å; N6-R10 PolarHBondContact O-N 3.19Å
7	G	81	Confident	80.2	Confident	50 Å²	50	122.2 Å²	122.2	52%	0.515	64%	0.644	S	S	.	*	H	α-helix	trans	-70.3	-38.4	179.3	0	0	0	0	0	113.3	K11	G7-K11 PolarHBondContact O-N 3.25Å; G7-K11 VanDerWaalsContact O-N 3.15Å
8	R	87.6	Confident	81.2	Confident	180 Å²	180	117.8 Å²	117.8	68%	0.679	63%	0.627	S	S	*	*	H	α-helix	trans	-68.5	-49.6	179	-164.3	-174.7	-154.4	164.6	9.3	111.5	R10 K11 E12	R8-R10 VanDerWaalsContact C-N 3.3Å; R8-R10 PolarHBondContact O-N 3.48Å; R8-K11 PolarHBondContact O-N 2.75Å; R8-K11 VanDerWaalsContact O-N 3.12Å; R8-E12 WeakPolarHBondContact CG-OE1 3.3Å; R8-E12 IonicContact NE-OE1 3.72Å; R8-E12 WeakPolarHBondContact O-CG 3.3Å; R8-E12 PolarHBondContact O-N 2.84Å
9	A	89.8	Confident	82.1	Confident	50 Å²	50	119.7 Å²	119.7	41%	0.413	63%	0.625	S	S	.	*	H	α-helix	trans	-58.3	-41.7	178	0	0	0	0	0	112.1	M5 K11 E12 A13	M5-A9 PolarHBondContact O-N 3.44Å; A9-K11 PolarHBondContact O-N 2.75Å; A9-E12 PolarHBondContact O-N 2.94Å; A9-A13 WeakPolarHBondContact O-CB 3.31Å; A9-A13 PolarHBondContact O-N 3.36Å
10	R	93.3	Very high	82.8	Confident	179 Å²	179	118 Å²	118	68%	0.675	61%	0.614	S	S	*	*	H	α-helix	trans	-61.7	-44.5	175.2	-179.2	176.9	177.9	-177.9	-0.1	112.3	N6 R8 E12 A13 I14	N6-R10 WeakPolarHBondContact O-CB 3.38Å; N6-R10 PolarHBondContact O-N 3.19Å; R8-R10 VanDerWaalsContact C-N 3.3Å; R8-R10 PolarHBondContact O-N 3.48Å; R10-E12 VanDerWaalsContact C-N 3.33Å; R10-A13 PolarHBondContact O-N 3.17Å; R10-I14 HydrophobicContact CG-CD1 3.95Å; R10-I14 VanDerWaalsContact O-CG1 3.28Å; R10-I14 WeakPolarHBondContact O-CG1 3.48Å; R10-I14 PolarHBondContact O-N 3.26Å
11	K	93.8	Very high	83.5	Confident	146 Å²	146	117.5 Å²	117.5	64%	0.635	61%	0.611	S	S	*	*	H	α-helix	trans	-63	-42.3	178.6	-173.4	178.4	179.5	179.9	0	111.1	G7 R8 A9 I14 Q15	G7-K11 PolarHBondContact O-N 3.25Å; G7-K11 VanDerWaalsContact O-N 3.15Å; R8-K11 PolarHBondContact O-N 2.75Å; R8-K11 VanDerWaalsContact O-N 3.12Å; A9-K11 PolarHBondContact O-N 2.75Å; K11-I14 PolarHBondContact O-N 3.17Å; K11-Q15 WeakPolarHBondContact O-CB 3.49Å; K11-Q15 VanDerWaalsContact O-CG 3.25Å; K11-Q15 WeakPolarHBondContact O-CG 3.3Å; K11-Q15 PolarHBondContact O-N 2.98Å
12	E	95.6	Very high	85.8	Confident	112 Å²	112	110.8 Å²	110.8	52%	0.523	58%	0.58	S	S	.	*	H	α-helix	trans	-63	-44.5	177.1	-72.7	167.2	-173.6	0	0	111.7	R8 A9 R10 I14 Q15 A16	R8-E12 WeakPolarHBondContact CG-OE1 3.3Å; R8-E12 IonicContact NE-OE1 3.72Å; R8-E12 WeakPolarHBondContact O-CG 3.3Å; R8-E12 PolarHBondContact O-N 2.84Å; A9-E12 PolarHBondContact O-N 2.94Å; R10-E12 VanDerWaalsContact C-N 3.33Å; E12-I14 PolarHBondContact O-N 3.08Å; E12-Q15 PolarHBondContact O-N 3.23Å; E12-A16 WeakPolarHBondContact O-CB 3.36Å; E12-A16 PolarHBondContact O-N 3.01Å
13	A	94.7	Very high	87.9	Confident	56 Å²	56	107.5 Å²	107.5	46%	0.463	56%	0.563	S	S	.	*	H	α-helix	trans	-60.6	-43.5	175.2	0	0	0	0	0	112.4	A9 R10 Q15 A16 T17	A9-A13 WeakPolarHBondContact O-CB 3.31Å; A9-A13 PolarHBondContact O-N 3.36Å; R10-A13 PolarHBondContact O-N 3.17Å; A13-Q15 PolarHBondContact O-N 3.09Å; A13-A16 PolarHBondContact O-N 3.48Å; A13-T17 PolarHBondContact O-N 2.64Å; A13-T17 PolarHBondContact O-OG1 3.17Å; A13-T17 VanDerWaalsContact O-OG1 3.07Å
14	I	96.1	Very high	90	Very high	96 Å²	96	101 Å²	101	49%	0.492	53%	0.529	S	S	.	.	H	α-helix	trans	-62.5	-44.4	176.4	-68.3	165.2	0	0	0	110.7	R10 K11 E12 A16 T17 A18	R10-I14 HydrophobicContact CG-CD1 3.95Å; R10-I14 VanDerWaalsContact O-CG1 3.28Å; R10-I14 WeakPolarHBondContact O-CG1 3.48Å; R10-I14 PolarHBondContact O-N 3.26Å; K11-I14 PolarHBondContact O-N 3.17Å; E12-I14 PolarHBondContact O-N 3.08Å; I14-A16 VanDerWaalsContact C-N 3.35Å; I14-A16 PolarHBondContact O-N 2.96Å; I14-T17 PolarHBondContact O-N 2.93Å; I14-A18 WeakPolarHBondContact O-CB 3.46Å; I14-A18 PolarHBondContact O-N 2.99Å
15	Q	97.4	Very high	91.8	Very high	88 Å²	88	100.5 Å²	100.5	41%	0.411	52%	0.517	S	S	.	.	H	α-helix	trans	-64.8	-38.7	178.5	-73.5	-68.3	-44.4	0	0	112.1	K11 E12 A13 A18 R19	K11-Q15 WeakPolarHBondContact O-CB 3.49Å; K11-Q15 VanDerWaalsContact O-CG 3.25Å; K11-Q15 WeakPolarHBondContact O-CG 3.3Å; K11-Q15 PolarHBondContact O-N 2.98Å; E12-Q15 PolarHBondContact O-N 3.23Å; A13-Q15 PolarHBondContact O-N 3.09Å; Q15-A18 PolarHBondContact O-N 3.46Å; Q15-R19 WeakPolarHBondContact O-CB 3.35Å; Q15-R19 WeakPolarHBondContact O-CG 3.43Å; Q15-R19 PolarHBondContact O-N 3.22Å
16	A	96.8	Very high	93.7	Very high	52 Å²	52	99.7 Å²	99.7	43%	0.43	52%	0.516	S	S	.	.	H	α-helix	trans	-62.1	-49.5	175	0	0	0	0	0	111	E12 A13 I14 A18 R19 E20	E12-A16 WeakPolarHBondContact O-CB 3.36Å; E12-A16 PolarHBondContact O-N 3.01Å; A13-A16 PolarHBondContact O-N 3.48Å; I14-A16 VanDerWaalsContact C-N 3.35Å; I14-A16 PolarHBondContact O-N 2.96Å; A16-A18 PolarHBondContact O-N 3.22Å; A16-R19 PolarHBondContact O-N 3.4Å; A16-E20 PolarHBondContact O-N 3.24Å
17	T	95.6	Very high	94.6	Very high	103 Å²	103	100.7 Å²	100.7	63%	0.632	51%	0.51	S	S	*	.	H	α-helix	trans	-60.2	-43.6	177.5	-57.6	0	0	0	0	112.1	A13 I14 R19 E20 L21	A13-T17 PolarHBondContact O-N 2.64Å; A13-T17 PolarHBondContact O-OG1 3.17Å; A13-T17 VanDerWaalsContact O-OG1 3.07Å; I14-T17 PolarHBondContact O-N 2.93Å; T17-R19 PolarHBondContact O-N 2.96Å; T17-E20 PolarHBondContact O-N 2.78Å; T17-L21 PolarHBondContact O-N 3.25Å
18	A	97.6	Very high	95.2	Very high	42 Å²	42	99 Å²	99	35%	0.347	49%	0.49	S	S	.	.	H	α-helix	trans	-62.5	-42.3	177.3	0	0	0	0	0	112	I14 Q15 A16 E20 L21 L22	I14-A18 WeakPolarHBondContact O-CB 3.46Å; I14-A18 PolarHBondContact O-N 2.99Å; Q15-A18 PolarHBondContact O-N 3.46Å; A16-A18 PolarHBondContact O-N 3.22Å; A18-E20 VanDerWaalsContact C-N 3.34Å; A18-E20 PolarHBondContact O-N 3.22Å; A18-L21 WeakPolarHBondContact O-CB 3.06Å; A18-L21 PolarHBondContact O-N 2.86Å; A18-L22 WeakPolarHBondContact O-CG 3.19Å; A18-L22 PolarHBondContact O-N 3.19Å
19	R	97.9	Very high	95.5	Very high	154 Å²	154	95.5 Å²	95.5	58%	0.581	49%	0.491	S	S	*	.	H	α-helix	trans	-63.9	-39.4	176.2	-72.5	169.9	-168.8	-87.3	-1.6	112	Q15 A16 T17 L21 L22 K23	Q15-R19 WeakPolarHBondContact O-CB 3.35Å; Q15-R19 WeakPolarHBondContact O-CG 3.43Å; Q15-R19 PolarHBondContact O-N 3.22Å; A16-R19 PolarHBondContact O-N 3.4Å; T17-R19 PolarHBondContact O-N 2.96Å; R19-L21 VanDerWaalsContact C-N 3.34Å; R19-L22 PolarHBondContact O-N 2.96Å; R19-K23 WeakPolarHBondContact O-CG 3.49Å; R19-K23 PolarHBondContact O-N 3.48Å
20	E	97	Very high	95.7	Very high	86 Å²	86	94.8 Å²	94.8	40%	0.402	48%	0.483	S	S	.	.	H	α-helix	trans	-66.3	-35.9	175.5	-73.7	-52.7	128.2	0	0	112.7	A16 T17 A18 K23 F24	A16-E20 PolarHBondContact O-N 3.24Å; T17-E20 PolarHBondContact O-N 2.78Å; A18-E20 VanDerWaalsContact C-N 3.34Å; A18-E20 PolarHBondContact O-N 3.22Å; E20-K23 PolarHBondContact O-N 2.92Å; E20-K23 WeakPolarHBondContact OE1-CD 3.32Å; E20-K23 WeakPolarHBondContact OE1-CE 3.45Å; E20-K23 IonicContact OE1-NZ 2.69Å; E20-K23 PolarHBondContact OE1-NZ 3.34Å; E20-F24 PolarHBondContact O-N 3.47Å
21	L	96.8	Very high	95.6	Very high	108 Å²	108	90.7 Å²	90.7	57%	0.565	48%	0.479	S	S	*	.	H	α-helix	trans	-63.9	-45.6	172	177.9	62	0	0	0	111.4	T17 A18 R19 K23 F24 V25	T17-L21 PolarHBondContact O-N 3.25Å; A18-L21 WeakPolarHBondContact O-CB 3.06Å; A18-L21 PolarHBondContact O-N 2.86Å; R19-L21 VanDerWaalsContact C-N 3.34Å; L21-K23 VanDerWaalsContact C-N 3.31Å; L21-K23 PolarHBondContact O-N 3.5Å; L21-F24 WeakPolarHBondContact O-CB 3.46Å; L21-F24 PolarHBondContact O-N 3.45Å; L21-F24 VanDerWaalsContact O-N 3.07Å; L21-V25 HydrophobicContact CD1-CG2 4.19Å; L21-V25 HydrophobicContact CG-CG2 4.46Å; L21-V25 WeakPolarHBondContact O-CG2 3.45Å; L21-V25 PolarHBondContact O-N 3.41Å
22	L	97.6	Very high	95.5	Very high	107 Å²	107	89.8 Å²	89.8	56%	0.56	48%	0.476	S	S	*	.	H	α-helix	trans	-59.7	-43.1	177	-69.3	174	0	0	0	111.5	A18 R19 F24 V25 N26	A18-L22 WeakPolarHBondContact O-CG 3.19Å; A18-L22 PolarHBondContact O-N 3.19Å; R19-L22 PolarHBondContact O-N 2.96Å; L22-F24 VanDerWaalsContact C-N 3.29Å; L22-F24 PolarHBondContact O-N 3.35Å; L22-V25 PolarHBondContact O-N 3.03Å; L22-N26 WeakPolarHBondContact O-CB 3.37Å; L22-N26 PolarHBondContact O-N 2.85Å; L22-N26 PolarHBondContact O-ND2 3.31Å
23	K	96.9	Very high	95.3	Very high	102 Å²	102	88.9 Å²	88.9	44%	0.443	47%	0.472	S	S	.	.	H	α-helix	trans	-59.3	-40.6	173.9	-71.5	174.3	-172.3	172.8	0	111.9	R19 E20 L21 R27	R19-K23 WeakPolarHBondContact O-CG 3.49Å; R19-K23 PolarHBondContact O-N 3.48Å; E20-K23 PolarHBondContact O-N 2.92Å; E20-K23 WeakPolarHBondContact OE1-CD 3.32Å; E20-K23 WeakPolarHBondContact OE1-CE 3.45Å; E20-K23 IonicContact OE1-NZ 2.69Å; E20-K23 PolarHBondContact OE1-NZ 3.34Å; L21-K23 VanDerWaalsContact C-N 3.31Å; L21-K23 PolarHBondContact O-N 3.5Å; K23-R27 VanDerWaalsContact O-CG 3.3Å; K23-R27 WeakPolarHBondContact O-CG 3.42Å; K23-R27 PolarHBondContact O-N 3.18Å
24	F	96.5	Very high	95.2	Very high	43 Å²	43	88.7 Å²	88.7	19%	0.189	46%	0.464	C	S	.	.	H	α-helix	trans	-64.6	-48.7	177.7	-178.9	-98.5	0	0	0	112.3	E20 L21 L22 R27 S28 V34 E37	E20-F24 PolarHBondContact O-N 3.47Å; L21-F24 WeakPolarHBondContact O-CB 3.46Å; L21-F24 PolarHBondContact O-N 3.45Å; L21-F24 VanDerWaalsContact O-N 3.07Å; L22-F24 VanDerWaalsContact C-N 3.29Å; L22-F24 PolarHBondContact O-N 3.35Å; F24-R27 PolarHBondContact O-N 3.48Å; F24-S28 VanDerWaalsContact O-CB 3.3Å; F24-S28 WeakPolarHBondContact O-CB 3.35Å; F24-S28 PolarHBondContact O-N 2.74Å; F24-S28 PolarHBondContact O-OG 3.39Å; F24-V34 HydrophobicContact CE1-CG1 4.41Å; F24-V34 HydrophobicContact CZ-CG1 3.98Å; F24-E37 HydrophobicContact CD2-CB 4.42Å; F24-E37 HydrophobicContact CD2-CG 3.46Å; F24-E37 VanDerWaalsContact CD2-CG 3.46Å; F24-E37 HydrophobicContact CE2-CB 4.06Å; F24-E37 HydrophobicContact CE2-CG 3.53Å
25	V	95.8	Very high	95	Very high	82 Å²	82	88.2 Å²	88.2	50%	0.497	47%	0.466	S	S	.	.	H	α-helix	trans	-61.6	-46.2	179.7	172.5	0	0	0	0	110.6	L21 L22 R27 S28	L21-V25 HydrophobicContact CD1-CG2 4.19Å; L21-V25 HydrophobicContact CG-CG2 4.46Å; L21-V25 WeakPolarHBondContact O-CG2 3.45Å; L21-V25 PolarHBondContact O-N 3.41Å; L22-V25 PolarHBondContact O-N 3.03Å; V25-R27 PolarHBondContact O-N 3.05Å; V25-S28 CarbonylContact O-C 3.56Å; V25-S28 PolarHBondContact O-N 3.19Å
26	N	96	Very high	94.7	Very high	131 Å²	131	86.7 Å²	86.7	70%	0.701	47%	0.468	S	S	*	.	H	α-helix	trans	-63.7	-27.7	179.8	-70.9	-13.6	0	0	0	113.4	L22 S28	L22-N26 WeakPolarHBondContact O-CB 3.37Å; L22-N26 PolarHBondContact O-N 2.85Å; L22-N26 PolarHBondContact O-ND2 3.31Å; N26-S28 VanDerWaalsContact C-N 3.34Å
27	R	93.6	Very high	94.6	Very high	147 Å²	147	85.4 Å²	85.4	56%	0.555	45%	0.453	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.5	-7.9	174.6	-71.2	176.7	-179.1	-179.5	-0.3	113.5	K23 F24 V25 P29 E37	K23-R27 VanDerWaalsContact O-CG 3.3Å; K23-R27 WeakPolarHBondContact O-CG 3.42Å; K23-R27 PolarHBondContact O-N 3.18Å; F24-R27 PolarHBondContact O-N 3.48Å; V25-R27 PolarHBondContact O-N 3.05Å; R27-P29 VanDerWaalsContact O-CD 3.3Å; R27-P29 WeakPolarHBondContact O-CD 3.44Å; R27-E37 IonicContact NH1-OE1 3.46Å; R27-E37 PolarHBondContact NH1-OE1 3.26Å
28	S	93.4	Very high	94.4	Very high	15 Å²	15	83 Å²	83	11%	0.105	44%	0.44	C	S	.	.			trans	-123.9	60.2	-168.9	-52.7	0	0	0	0	113.2	F24 V25 N26 S30	F24-S28 VanDerWaalsContact O-CB 3.3Å; F24-S28 WeakPolarHBondContact O-CB 3.35Å; F24-S28 PolarHBondContact O-N 2.74Å; F24-S28 PolarHBondContact O-OG 3.39Å; V25-S28 CarbonylContact O-C 3.56Å; V25-S28 PolarHBondContact O-N 3.19Å; N26-S28 VanDerWaalsContact C-N 3.34Å; S28-S30 PolarHBondContact O-N 2.76Å; S28-S30 VanDerWaalsContact O-N 3.17Å
29	P	93.4	Very high	94.2	Very high	106 Å²	106	85.9 Å²	85.9	69%	0.688	44%	0.442	S	S	*	.	S	Bend	trans	-70.5	-11	-175.8	30.3	-37.7	0	0	0	113.9	R27 H33	R27-P29 VanDerWaalsContact O-CD 3.3Å; R27-P29 WeakPolarHBondContact O-CD 3.44Å; P29-H33 HydrophobicContact CG-CB 4.42Å
30	S	94.1	Very high	94	Very high	35 Å²	35	80.7 Å²	80.7	25%	0.245	43%	0.429	C	S	.	.	S	Bend	trans	-143.4	161.6	174.9	82	0	0	0	0	111.4	S28 F32 H33 V34	S28-S30 PolarHBondContact O-N 2.76Å; S28-S30 VanDerWaalsContact O-N 3.17Å; S30-F32 PolarHBondContact O-N 3.04Å; S30-F32 VanDerWaalsContact O-N 3.08Å; S30-H33 PolarHBondContact O-N 3.38Å; S30-H33 PolarHBondContact OG-ND1 3.44Å; S30-V34 PolarHBondContact O-N 2.69Å
31	P	90.4	Very high	93.8	Very high	93 Å²	93	80.6 Å²	80.6	60%	0.604	43%	0.425	S	S	*	.	H	α-helix	trans	-53.8	-31.4	177.5	-27.4	35.3	0	0	0	113.7	V34 V35	P31-V34 WeakPolarHBondContact O-CB 3.45Å; P31-V34 PolarHBondContact O-N 3.34Å; P31-V35 WeakPolarHBondContact O-CG2 3.38Å; P31-V35 PolarHBondContact O-N 2.89Å
32	F	91.4	Very high	93.6	Very high	127 Å²	127	78 Å²	78	56%	0.557	41%	0.411	S	S	*	.	H	α-helix	trans	-69.2	-39.5	176.2	-57.3	-72.4	0	0	0	112.4	S30 V35 A36	S30-F32 PolarHBondContact O-N 3.04Å; S30-F32 VanDerWaalsContact O-N 3.08Å; F32-V35 PolarHBondContact O-N 3.05Å; F32-A36 PolarHBondContact O-N 3.4Å
33	H	93.1	Very high	93.4	Very high	94 Å²	94	76.3 Å²	76.3	44%	0.435	40%	0.403	S	S	.	.	H	α-helix	trans	-69.3	-36.1	175.3	-64.7	96.6	0	0	0	111.7	P29 S30 V35 A36 E37	P29-H33 HydrophobicContact CG-CB 4.42Å; S30-H33 PolarHBondContact O-N 3.38Å; S30-H33 PolarHBondContact OG-ND1 3.44Å; H33-V35 VanDerWaalsContact C-N 3.31Å; H33-V35 PolarHBondContact O-N 2.99Å; H33-A36 PolarHBondContact O-N 3.4Å; H33-E37 WeakPolarHBondContact O-CB 3.37Å; H33-E37 PolarHBondContact O-N 2.99Å
34	V	91.2	Very high	93.2	Very high	51 Å²	51	78.6 Å²	78.6	31%	0.309	42%	0.415	S	S	.	.	H	α-helix	trans	-54.7	-49.2	171.5	175.7	0	0	0	0	110.3	F24 S30 P31 A36 E37 C38	F24-V34 HydrophobicContact CE1-CG1 4.41Å; F24-V34 HydrophobicContact CZ-CG1 3.98Å; S30-V34 PolarHBondContact O-N 2.69Å; P31-V34 WeakPolarHBondContact O-CB 3.45Å; P31-V34 PolarHBondContact O-N 3.34Å; V34-A36 PolarHBondContact O-N 3.43Å; V34-E37 PolarHBondContact O-N 3.43Å; V34-C38 WeakPolarHBondContact O-CB 3.22Å; V34-C38 PolarHBondContact O-N 2.99Å; V34-C38 PolarHBondContact O-SG 2.96Å; V34-C38 VanDerWaalsContact O-SG 3.34Å
35	V	92.4	Very high	93	Very high	87 Å²	87	80 Å²	80	53%	0.527	43%	0.434	S	S	.	.	H	α-helix	trans	-63.8	-41	178.9	172.9	0	0	0	0	111.4	P31 F32 H33 C38 R39	P31-V35 WeakPolarHBondContact O-CG2 3.38Å; P31-V35 PolarHBondContact O-N 2.89Å; F32-V35 PolarHBondContact O-N 3.05Å; H33-V35 VanDerWaalsContact C-N 3.31Å; H33-V35 PolarHBondContact O-N 2.99Å; V35-C38 PolarHBondContact O-N 3Å; V35-R39 WeakPolarHBondContact O-CB 3.36Å; V35-R39 PolarHBondContact O-N 3.44Å
36	A	91.3	Very high	92.8	Very high	55 Å²	55	79 Å²	79	46%	0.455	44%	0.441	S	S	.	.	H	α-helix	trans	-64.6	-43.9	178.1	0	0	0	0	0	112.7	F32 H33 V34 R39 S40	F32-A36 PolarHBondContact O-N 3.4Å; H33-A36 PolarHBondContact O-N 3.4Å; V34-A36 PolarHBondContact O-N 3.43Å; A36-R39 PolarHBondContact O-N 3.21Å; A36-S40 PolarHBondContact O-N 2.98Å
37	E	93.7	Very high	92.5	Very high	25 Å²	25	75.3 Å²	75.3	12%	0.117	42%	0.419	C	S	.	.	H	α-helix	trans	-65.6	-43.9	176.7	179.7	66.3	-170.5	0	0	110.8	F24 R27 H33 V34 R39 S40 R41	F24-E37 HydrophobicContact CD2-CB 4.42Å; F24-E37 HydrophobicContact CD2-CG 3.46Å; F24-E37 VanDerWaalsContact CD2-CG 3.46Å; F24-E37 HydrophobicContact CE2-CB 4.06Å; F24-E37 HydrophobicContact CE2-CG 3.53Å; R27-E37 IonicContact NH1-OE1 3.46Å; R27-E37 PolarHBondContact NH1-OE1 3.26Å; H33-E37 WeakPolarHBondContact O-CB 3.37Å; H33-E37 PolarHBondContact O-N 2.99Å; V34-E37 PolarHBondContact O-N 3.43Å; E37-R39 PolarHBondContact O-N 3.39Å; E37-S40 WeakPolarHBondContact O-CB 3.21Å; E37-S40 PolarHBondContact O-N 2.92Å; E37-R41 WeakPolarHBondContact O-CG 3.44Å; E37-R41 PolarHBondContact O-N 2.95Å; E37-R41 IonicContact OE1-CZ 3.38Å; E37-R41 IonicContact OE1-NE 2.89Å; E37-R41 PolarHBondContact OE1-NE 3.49Å; E37-R41 IonicContact OE1-NH2 2.96Å; E37-R41 PolarHBondContact OE1-NH2 2.98Å
38	C	92.9	Very high	92.2	Very high	53 Å²	53	74.7 Å²	74.7	36%	0.358	42%	0.417	S	S	.	.	H	α-helix	trans	-57.4	-46.3	172.9	-78.1	0	0	0	0	112	V34 V35 S40 R41 L42	V34-C38 WeakPolarHBondContact O-CB 3.22Å; V34-C38 PolarHBondContact O-N 2.99Å; V34-C38 PolarHBondContact O-SG 2.96Å; V34-C38 VanDerWaalsContact O-SG 3.34Å; V35-C38 PolarHBondContact O-N 3Å; C38-S40 PolarHBondContact O-N 3.07Å; C38-R41 PolarHBondContact O-N 3.44Å; C38-L42 WeakPolarHBondContact O-CB 3.47Å; C38-L42 WeakPolarHBondContact O-CG 3.46Å; C38-L42 PolarHBondContact O-N 2.97Å
39	R	92.3	Very high	91.8	Very high	103 Å²	103	77.1 Å²	77.1	39%	0.389	43%	0.426	S	S	.	.	H	α-helix	trans	-58.6	-47.9	175.7	-177.6	-143.7	-178.5	-158.1	-2.3	110.9	V35 A36 E37 R41 L42 L43 E49 K67	V35-R39 WeakPolarHBondContact O-CB 3.36Å; V35-R39 PolarHBondContact O-N 3.44Å; A36-R39 PolarHBondContact O-N 3.21Å; E37-R39 PolarHBondContact O-N 3.39Å; R39-R41 VanDerWaalsContact C-N 3.35Å; R39-R41 PolarHBondContact O-N 3.35Å; R39-L42 PolarHBondContact O-N 3.48Å; R39-L43 HydrophobicContact CG-CD1 4.11Å; R39-L43 HydrophobicContact CG-CG 4.43Å; R39-L43 WeakPolarHBondContact O-CG 3.43Å; R39-L43 PolarHBondContact O-N 3.33Å; R39-E49 IonicContact CZ-OE1 3.57Å; R39-E49 IonicContact CZ-OE2 3.21Å; R39-E49 VanDerWaalsContact NE-CD 3.29Å; R39-E49 IonicContact NE-OE1 2.93Å; R39-E49 PolarHBondContact NE-OE1 2.92Å; R39-E49 IonicContact NE-OE2 2.99Å; R39-E49 PolarHBondContact NE-OE2 3.38Å; R39-E49 IonicContact NH2-OE1 3.54Å; R39-E49 IonicContact NH2-OE2 2.64Å; R39-E49 PolarHBondContact NH2-OE2 3.4Å; R39-K67 VanDerWaalsContact CD-NZ 3.31Å
40	S	93.5	Very high	91.4	Very high	45 Å²	45	72.7 Å²	72.7	32%	0.315	40%	0.397	S	S	.	.	H	α-helix	trans	-57.1	-47.4	179.6	-176.4	0	0	0	0	111.9	A36 E37 C38 L42 L43 Q44	A36-S40 PolarHBondContact O-N 2.98Å; E37-S40 WeakPolarHBondContact O-CB 3.21Å; E37-S40 PolarHBondContact O-N 2.92Å; C38-S40 PolarHBondContact O-N 3.07Å; S40-L42 VanDerWaalsContact C-N 3.33Å; S40-L42 PolarHBondContact O-N 3.29Å; S40-L43 PolarHBondContact O-N 3.02Å; S40-Q44 WeakPolarHBondContact O-CG 3.19Å; S40-Q44 PolarHBondContact O-N 3.42Å; S40-Q44 PolarHBondContact OG-NE2 3.35Å
41	R	94.3	Very high	90.8	Very high	83 Å²	83	77.1 Å²	77.1	31%	0.313	41%	0.412	S	S	.	.	H	α-helix	trans	-63.5	-38.4	177.8	-68.8	179.4	-175.3	-141.8	-3.2	112.7	E37 C38 R39 Q44 A45	E37-R41 WeakPolarHBondContact O-CG 3.44Å; E37-R41 PolarHBondContact O-N 2.95Å; E37-R41 IonicContact OE1-CZ 3.38Å; E37-R41 IonicContact OE1-NE 2.89Å; E37-R41 PolarHBondContact OE1-NE 3.49Å; E37-R41 IonicContact OE1-NH2 2.96Å; E37-R41 PolarHBondContact OE1-NH2 2.98Å; C38-R41 PolarHBondContact O-N 3.44Å; R39-R41 VanDerWaalsContact C-N 3.35Å; R39-R41 PolarHBondContact O-N 3.35Å; R41-Q44 PolarHBondContact O-N 3.03Å; R41-A45 WeakPolarHBondContact O-CB 3.35Å; R41-A45 PolarHBondContact O-N 3.27Å
42	L	92.9	Very high	90.2	Very high	53 Å²	53	76.2 Å²	76.2	28%	0.277	40%	0.4	S	S	.	.	H	α-helix	trans	-67.2	-44.1	177.1	-70.5	169	0	0	0	111.6	C38 R39 S40 Q44 A45 G46 F47 K65	C38-L42 WeakPolarHBondContact O-CB 3.47Å; C38-L42 WeakPolarHBondContact O-CG 3.46Å; C38-L42 PolarHBondContact O-N 2.97Å; R39-L42 PolarHBondContact O-N 3.48Å; S40-L42 VanDerWaalsContact C-N 3.33Å; S40-L42 PolarHBondContact O-N 3.29Å; L42-Q44 VanDerWaalsContact C-N 3.3Å; L42-Q44 PolarHBondContact O-N 3.11Å; L42-A45 CarbonylContact O-C 3.58Å; L42-A45 PolarHBondContact O-N 2.99Å; L42-A45 VanDerWaalsContact O-N 3.11Å; L42-G46 PolarHBondContact O-N 2.92Å; L42-F47 HydrophobicContact CB-CB 4.15Å; L42-F47 HydrophobicContact CB-CD2 3.83Å; L42-F47 HydrophobicContact CB-CG 4.34Å; L42-F47 HydrophobicContact CD2-CD2 3.41Å; L42-F47 VanDerWaalsContact CD2-CD2 3.41Å; L42-F47 HydrophobicContact CD2-CE2 3.65Å; L42-F47 HydrophobicContact CD2-CG 4.22Å; L42-F47 HydrophobicContact CG-CD2 4.22Å; L42-F47 WeakPolarHBondContact O-CB 3.4Å; L42-F47 WeakPolarHBondContact O-CD2 3.44Å; L42-F47 PolarHBondContact O-N 3.43Å; L42-K65 HydrophobicContact CD1-CB 4.5Å; L42-K65 HydrophobicContact CD1-CD 4.39Å; L42-K65 HydrophobicContact CD1-CG 3.53Å
43	L	92.9	Very high	89.6	Confident	73 Å²	73	76.3 Å²	76.3	38%	0.382	41%	0.411	S	S	.	.	H	α-helix	trans	-60	-42	175	-68.6	173.9	0	0	0	111.5	R39 S40 A45 G46 F47 E49	R39-L43 HydrophobicContact CG-CD1 4.11Å; R39-L43 HydrophobicContact CG-CG 4.43Å; R39-L43 WeakPolarHBondContact O-CG 3.43Å; R39-L43 PolarHBondContact O-N 3.33Å; S40-L43 PolarHBondContact O-N 3.02Å; L43-A45 VanDerWaalsContact C-N 3.27Å; L43-A45 PolarHBondContact O-N 3.23Å; L43-G46 PolarHBondContact O-N 3.48Å; L43-F47 WeakPolarHBondContact CD2-O 3.49Å; L43-E49 HydrophobicContact CD2-CB 4.2Å
44	Q	92.1	Very high	88.9	Confident	150 Å²	150	76.6 Å²	76.6	70%	0.701	41%	0.412	S	S	*	.	H	α-helix	trans	-63.6	-31.3	175.5	-71.8	169.1	40.5	0	0	113	S40 R41 L42 G46	S40-Q44 WeakPolarHBondContact O-CG 3.19Å; S40-Q44 PolarHBondContact O-N 3.42Å; S40-Q44 PolarHBondContact OG-NE2 3.35Å; R41-Q44 PolarHBondContact O-N 3.03Å; L42-Q44 VanDerWaalsContact C-N 3.3Å; L42-Q44 PolarHBondContact O-N 3.11Å; Q44-G46 PolarHBondContact O-N 3.01Å
45	A	93.1	Very high	87.8	Confident	71 Å²	71	78.1 Å²	78.1	59%	0.587	44%	0.438	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.9	5.4	174.9	0	0	0	0	0	113.5	R41 L42 L43 F47	R41-A45 WeakPolarHBondContact O-CB 3.35Å; R41-A45 PolarHBondContact O-N 3.27Å; L42-A45 CarbonylContact O-C 3.58Å; L42-A45 PolarHBondContact O-N 2.99Å; L42-A45 VanDerWaalsContact O-N 3.11Å; L43-A45 VanDerWaalsContact C-N 3.27Å; L43-A45 PolarHBondContact O-N 3.23Å; A45-F47 HydrophobicContact CB-CD2 3.9Å; A45-F47 HydrophobicContact CB-CE2 3.77Å
46	G	91.4	Very high	87	Confident	63 Å²	63	79.2 Å²	79.2	65%	0.649	43%	0.433	S	S	*	.	T	Hydrogen-bonded Turn	trans	86.7	10.6	177.6	0	0	0	0	0	114.8	L42 L43 Q44	L42-G46 PolarHBondContact O-N 2.92Å; L43-G46 PolarHBondContact O-N 3.48Å; Q44-G46 PolarHBondContact O-N 3.01Å
47	F	89.9	Confident	85.8	Confident	52 Å²	52	82.9 Å²	82.9	23%	0.228	45%	0.445	C	S	.	.	P	Polyproline II helix	trans	-72	141.1	173.9	-65.3	-66.8	0	0	0	111.3	L42 L43 A45 K63	L42-F47 HydrophobicContact CB-CB 4.15Å; L42-F47 HydrophobicContact CB-CD2 3.83Å; L42-F47 HydrophobicContact CB-CG 4.34Å; L42-F47 HydrophobicContact CD2-CD2 3.41Å; L42-F47 VanDerWaalsContact CD2-CD2 3.41Å; L42-F47 HydrophobicContact CD2-CE2 3.65Å; L42-F47 HydrophobicContact CD2-CG 4.22Å; L42-F47 HydrophobicContact CG-CD2 4.22Å; L42-F47 WeakPolarHBondContact O-CB 3.4Å; L42-F47 WeakPolarHBondContact O-CD2 3.44Å; L42-F47 PolarHBondContact O-N 3.43Å; L43-F47 WeakPolarHBondContact CD2-O 3.49Å; A45-F47 HydrophobicContact CB-CD2 3.9Å; A45-F47 HydrophobicContact CB-CE2 3.77Å; F47-K63 HydrophobicContact CD1-CB 3.55Å; F47-K63 HydrophobicContact CD1-CD 4.44Å; F47-K63 HydrophobicContact CD1-CG 4.13Å; F47-K63 WeakPolarHBondContact CD1-O 3.34Å; F47-K63 HydrophobicContact CE1-CB 3.31Å; F47-K63 HydrophobicContact CE1-CD 3.38Å; F47-K63 HydrophobicContact CE1-CG 3.4Å; F47-K63 VanDerWaalsContact CE1-CG 3.4Å; F47-K63 HydrophobicContact CZ-CB 4.28Å; F47-K63 HydrophobicContact CZ-CD 3.65Å; F47-K63 HydrophobicContact CZ-CG 4.21Å
48	R	86.6	Confident	84.5	Confident	134 Å²	134	86 Å²	86	51%	0.506	46%	0.462	S	S	.	.	P	Polyproline II helix	trans	-90	129.9	173.2	-173.3	171.1	68.2	120.7	-6.5	110.3	L50	R48-L50 HydrophobicContact CG-CD2 4.5Å; R48-L50 VanDerWaalsContact CZ-CD2 3.47Å
49	E	85.4	Confident	82.9	Confident	66 Å²	66	87.4 Å²	87.4	31%	0.308	47%	0.468	S	S	.	.	P	Polyproline II helix	trans	-76	133.8	171.4	-172.1	171	-153.5	0	0	110	R39 L43 K67	R39-E49 IonicContact CZ-OE1 3.57Å; R39-E49 IonicContact CZ-OE2 3.21Å; R39-E49 VanDerWaalsContact NE-CD 3.29Å; R39-E49 IonicContact NE-OE1 2.93Å; R39-E49 PolarHBondContact NE-OE1 2.92Å; R39-E49 IonicContact NE-OE2 2.99Å; R39-E49 PolarHBondContact NE-OE2 3.38Å; R39-E49 IonicContact NH2-OE1 3.54Å; R39-E49 IonicContact NH2-OE2 2.64Å; R39-E49 PolarHBondContact NH2-OE2 3.4Å; L43-E49 HydrophobicContact CD2-CB 4.2Å; E49-K67 VanDerWaalsContact OE1-CD 3.31Å; E49-K67 WeakPolarHBondContact OE1-CD 3.45Å; E49-K67 WeakPolarHBondContact OE1-CE 3.28Å; E49-K67 IonicContact OE1-NZ 2.75Å; E49-K67 PolarHBondContact OE1-NZ 2.95Å
50	L	84.6	Confident	81.1	Confident	14 Å²	14	88.9 Å²	88.9	7%	0.073	49%	0.491	C	S	.	.			trans	-111.3	143.1	173.6	-64.6	-170.5	0	0	0	110.4	R48 W56 V64	R48-L50 HydrophobicContact CG-CD2 4.5Å; R48-L50 VanDerWaalsContact CZ-CD2 3.47Å; L50-W56 HydrophobicContact CD1-CB 4.22Å; L50-W56 HydrophobicContact CD1-CD2 4.07Å; L50-W56 HydrophobicContact CD1-CG 3.84Å; L50-V64 HydrophobicContact CB-CG1 3.82Å; L50-V64 HydrophobicContact CD1-CB 4.27Å; L50-V64 HydrophobicContact CD1-CG1 3.23Å; L50-V64 HydrophobicContact CD1-CG2 4.01Å; L50-V64 HydrophobicContact CG-CG1 3.53Å
51	K	80.7	Confident	79.2	Confident	127 Å²	127	95.5 Å²	95.5	55%	0.552	52%	0.517	S	S	*	.			trans	-88.5	137.3	170.5	-64	-169.4	-149.9	136.2	0	109.8	T53 E54 W56	K51-T53 PolarHBondContact O-N 3.45Å; K51-E54 HydrophobicContact CB-CB 4.5Å; K51-E54 HydrophobicContact CB-CG 4.15Å; K51-E54 WeakPolarHBondContact CD-OE1 3.25Å; K51-E54 IonicContact NZ-OE1 2.75Å; K51-E54 PolarHBondContact NZ-OE1 3.49Å; K51-E54 PolarHBondContact O-N 3.25Å; K51-W56 PolarHBondContact O-NE1 2.95Å
52	E	78.1	Confident	76.9	Confident	75 Å²	75	94.8 Å²	94.8	35%	0.35	52%	0.52	S	S	.	.	T	Hydrogen-bonded Turn	trans	-65.1	-20.1	179.8	-56.1	-172.1	175.1	0	0	113.5	R66 K67	E52-R66 VanDerWaalsContact CD-NH2 3.34Å; E52-R66 HydrophobicContact CG-CB 4.43Å; E52-R66 HydrophobicContact CG-CG 4.03Å; E52-R66 WeakPolarHBondContact OE1-CB 3.43Å; E52-R66 WeakPolarHBondContact OE1-CG 3.43Å; E52-R66 IonicContact OE1-CZ 3.54Å; E52-R66 IonicContact OE1-NE 2.76Å; E52-R66 PolarHBondContact OE1-NE 3.07Å; E52-R66 IonicContact OE1-NH2 3.51Å; E52-R66 IonicContact OE2-CZ 3.48Å; E52-R66 IonicContact OE2-NE 3.39Å; E52-R66 PolarHBondContact OE2-NE 3.16Å; E52-R66 IonicContact OE2-NH2 2.74Å; E52-R66 PolarHBondContact OE2-NH2 2.8Å; E52-K67 PolarHBondContact OE1-N 3.4Å
53	T	79.3	Confident	74.9	Confident	129 Å²	129	99.5 Å²	99.5	79%	0.791	54%	0.538	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.1	-2.9	-176.3	56.9	0	0	0	0	113.7	K51	K51-T53 PolarHBondContact O-N 3.45Å
54	E	77.7	Confident	72.8	Confident	99 Å²	99	98.2 Å²	98.2	46%	0.463	53%	0.533	S	S	.	.	S	Bend	trans	-107.9	150.4	-178.3	-67.6	172.6	-173.9	0	0	110	K51 W56	K51-E54 HydrophobicContact CB-CB 4.5Å; K51-E54 HydrophobicContact CB-CG 4.15Å; K51-E54 WeakPolarHBondContact CD-OE1 3.25Å; K51-E54 IonicContact NZ-OE1 2.75Å; K51-E54 PolarHBondContact NZ-OE1 3.49Å; K51-E54 PolarHBondContact O-N 3.25Å; E54-W56 PolarHBondContact O-N 2.85Å; E54-W56 PolarHBondContact O-NE1 3.01Å
55	G	69.1	Low	70.5	Confident	83 Å²	83	97.9 Å²	97.9	86%	0.856	53%	0.529	S	S	*	.			trans	-66	130.5	172.8	0	0	0	0	0	110.6
56	W	75.6	Confident	68.2	Low	110 Å²	110	102.6 Å²	102.6	42%	0.417	53%	0.532	S	S	.	.			trans	-94.9	112.8	-175.6	-60.5	-9.8	0	0	0	110.8	L50 K51 E54 I58 R66	L50-W56 HydrophobicContact CD1-CB 4.22Å; L50-W56 HydrophobicContact CD1-CD2 4.07Å; L50-W56 HydrophobicContact CD1-CG 3.84Å; K51-W56 PolarHBondContact O-NE1 2.95Å; E54-W56 PolarHBondContact O-N 2.85Å; E54-W56 PolarHBondContact O-NE1 3.01Å; W56-I58 HydrophobicContact CB-CD1 4.08Å; W56-I58 HydrophobicContact CB-CG1 3.83Å; W56-I58 HydrophobicContact CE3-CD1 3.91Å; W56-I58 PolarHBondContact O-N 3.39Å; W56-R66 HydrophobicContact CH2-CG 3.95Å; W56-R66 HydrophobicContact CZ2-CG 4.3Å
57	D	66	Low	66.3	Low	133 Å²	133	103.8 Å²	103.8	71%	0.711	52%	0.519	S	S	*	.			trans	-90.5	91.3	165.4	-167.7	12.2	0	0	0	108.7
58	I	65.8	Low	64	Low	91 Å²	91	107 Å²	107	47%	0.467	55%	0.548	S	S	.	.			trans	-94.1	101.1	-175.5	-55.5	177.7	0	0	0	108.8	W56	W56-I58 HydrophobicContact CB-CD1 4.08Å; W56-I58 HydrophobicContact CB-CG1 3.83Å; W56-I58 HydrophobicContact CE3-CD1 3.91Å; W56-I58 PolarHBondContact O-N 3.39Å
59	V	58.7	Low	62.1	Low	81 Å²	81	112.5 Å²	112.5	49%	0.491	57%	0.568	S	S	.	*			trans	-81.5	144.9	168	-128.8	0	0	0	0	109.4	E61 N62	V59-E61 PolarHBondContact O-N 3.35Å; V59-N62 PolarHBondContact O-N 3.5Å; V59-N62 VanDerWaalsContact O-N 3.16Å
60	P	54.5	Low	60.6	Low	135 Å²	135	118.4 Å²	118.4	88%	0.877	59%	0.588	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.7	-1.4	-166.8	-24.9	35	0	0	0	117.8
61	E	55.2	Low	59.1	Low	183 Å²	183	123.3 Å²	123.3	86%	0.855	62%	0.623	S	S	*	*	T	Hydrogen-bonded Turn	trans	-105.8	-2.8	-179.9	-64.6	-166.1	169.8	0	0	114.6	V59	V59-E61 PolarHBondContact O-N 3.35Å
62	N	44.4	Very low	57.5	Low	69 Å²	69	126.3 Å²	126.3	37%	0.369	64%	0.639	S	S	.	*			trans	-101.2	113.1	-175.6	-77.6	-49.4	0	0	0	112.5	V59 V64	V59-N62 PolarHBondContact O-N 3.5Å; V59-N62 VanDerWaalsContact O-N 3.16Å; N62-V64 WeakPolarHBondContact O-CG2 3.44Å
63	K	51	Low	56.1	Low	151 Å²	151	129.9 Å²	129.9	66%	0.657	67%	0.666	S	S	*	*			trans	-84.1	135.1	170.6	-39.8	179.1	-165.6	171.4	0	110.3	F47	F47-K63 HydrophobicContact CD1-CB 3.55Å; F47-K63 HydrophobicContact CD1-CD 4.44Å; F47-K63 HydrophobicContact CD1-CG 4.13Å; F47-K63 WeakPolarHBondContact CD1-O 3.34Å; F47-K63 HydrophobicContact CE1-CB 3.31Å; F47-K63 HydrophobicContact CE1-CD 3.38Å; F47-K63 HydrophobicContact CE1-CG 3.4Å; F47-K63 VanDerWaalsContact CE1-CG 3.4Å; F47-K63 HydrophobicContact CZ-CB 4.28Å; F47-K63 HydrophobicContact CZ-CD 3.65Å; F47-K63 HydrophobicContact CZ-CG 4.21Å
64	V	49.3	Very low	54.6	Low	47 Å²	47	127.1 Å²	127.1	29%	0.285	66%	0.663	S	S	.	*			trans	-119.6	145.3	-163.6	-168.8	0	0	0	0	111.6	L50 N62	L50-V64 HydrophobicContact CB-CG1 3.82Å; L50-V64 HydrophobicContact CD1-CB 4.27Å; L50-V64 HydrophobicContact CD1-CG1 3.23Å; L50-V64 HydrophobicContact CD1-CG2 4.01Å; L50-V64 HydrophobicContact CG-CG1 3.53Å; N62-V64 WeakPolarHBondContact O-CG2 3.44Å
65	K	43.6	Very low	53.3	Low	143 Å²	143	133.6 Å²	133.6	62%	0.622	69%	0.685	S	S	*	*			trans	-133.4	144	168.6	-73.6	-63.2	-172.1	176.9	0	113	L42	L42-K65 HydrophobicContact CD1-CB 4.5Å; L42-K65 HydrophobicContact CD1-CD 4.39Å; L42-K65 HydrophobicContact CD1-CG 3.53Å
66	R	46.3	Very low	52.3	Low	169 Å²	169	138.2 Å²	138.2	64%	0.638	68%	0.684	S	S	*	*			trans	-90.6	161.2	-178.5	-89	-173	73.9	178	9.9	113.4	E52 W56	E52-R66 VanDerWaalsContact CD-NH2 3.34Å; E52-R66 HydrophobicContact CG-CB 4.43Å; E52-R66 HydrophobicContact CG-CG 4.03Å; E52-R66 WeakPolarHBondContact OE1-CB 3.43Å; E52-R66 WeakPolarHBondContact OE1-CG 3.43Å; E52-R66 IonicContact OE1-CZ 3.54Å; E52-R66 IonicContact OE1-NE 2.76Å; E52-R66 PolarHBondContact OE1-NE 3.07Å; E52-R66 IonicContact OE1-NH2 3.51Å; E52-R66 IonicContact OE2-CZ 3.48Å; E52-R66 IonicContact OE2-NE 3.39Å; E52-R66 PolarHBondContact OE2-NE 3.16Å; E52-R66 IonicContact OE2-NH2 2.74Å; E52-R66 PolarHBondContact OE2-NH2 2.8Å; W56-R66 HydrophobicContact CH2-CG 3.95Å; W56-R66 HydrophobicContact CZ2-CG 4.3Å
67	K	50	Low	50.9	Low	89 Å²	89	142.6 Å²	142.6	39%	0.387	71%	0.709	S	S	.	*			trans	-153.3	143.1	178.6	-107	-159.3	-166.2	161.2	0	114.3	R39 E49 E52	R39-K67 VanDerWaalsContact CD-NZ 3.31Å; E49-K67 VanDerWaalsContact OE1-CD 3.31Å; E49-K67 WeakPolarHBondContact OE1-CD 3.45Å; E49-K67 WeakPolarHBondContact OE1-CE 3.28Å; E49-K67 IonicContact OE1-NZ 2.75Å; E49-K67 PolarHBondContact OE1-NZ 2.95Å; E52-K67 PolarHBondContact OE1-N 3.4Å
68	S	42	Very low	50.3	Low	118 Å²	118	142.2 Å²	142.2	83%	0.825	71%	0.711	S	S	*	*			trans	-113.4	155.4	169.3	61.1	0	0	0	0	113.1
69	R	45.9	Very low	49.9	Very low	250 Å²	250	141.4 Å²	141.4	94%	0.943	73%	0.726	S	S	*	*			trans	-90.6	149.2	-170	-169.7	179.4	-171.4	-176.8	2.6	113.2
70	R	54	Low	50.4	Low	191 Å²	191	143.7 Å²	143.7	72%	0.721	74%	0.739	S	S	*	*			trans	-155.2	148.5	170.4	-136.9	177	-173.3	-164.3	-0.8	115.2
71	S	54.8	Low	51.5	Low	116 Å²	116	146.2 Å²	146.2	81%	0.811	74%	0.739	S	S	*	*			trans	-147.5	156	172.8	56.4	0	0	0	0	111.3
72	Q	46.4	Very low	52.6	Low	190 Å²	190	142.3 Å²	142.3	89%	0.888	73%	0.728	S	S	*	*			trans	-168.5	155.1	158.3	-138.5	173.9	-2.9	0	0	114.1
73	V	48.3	Very low	54.4	Low	150 Å²	150	149.6 Å²	149.6	91%	0.909	75%	0.752	S	S	*	*			trans	-132.3	144.4	-179	176.2	0	0	0	0	110.8
74	G	48.3	Very low	56.1	Low	71 Å²	71	145.2 Å²	145.2	73%	0.732	75%	0.75	S	S	*	*			trans	119.9	145.2	162.3	0	0	0	0	0	116.8
75	Y	49.6	Very low	58	Low	235 Å²	235	147 Å²	147	92%	0.922	78%	0.777	S	S	*	*			trans	-98.1	136.3	179.7	-58	-87.5	0	0	0	112.9
76	H	48.1	Very low	60	Low	180 Å²	180	141.8 Å²	141.8	83%	0.833	76%	0.764	S	S	*	*			trans	-147.7	156.5	175.6	-80.9	-21.3	0	0	0	113	V78	H76-V78 PolarHBondContact O-N 3.36Å
77	Q	46.8	Very low	62.1	Low	203 Å²	203	139.6 Å²	139.6	95%	0.949	76%	0.764	S	S	*	*			trans	-52.2	134.1	166	-85	176.5	-23.7	0	0	110	G79	Q77-G79 PolarHBondContact O-N 2.97Å
78	V	53.5	Low	63.7	Low	124 Å²	124	140.4 Å²	140.4	75%	0.752	77%	0.765	S	S	*	*			trans	-99.9	94.7	-170.4	-171	0	0	0	0	110	H76 V80	H76-V78 PolarHBondContact O-N 3.36Å; V78-V80 HydrophobicContact CG1-CG1 3.86Å
79	G	57.1	Low	65.8	Low	75 Å²	75	139.1 Å²	139.1	77%	0.773	76%	0.756	S	S	*	*	P	Polyproline II helix	trans	-70.2	124.3	153.1	0	0	0	0	0	108.2	Q77	Q77-G79 PolarHBondContact O-N 2.97Å
80	V	69	Low	67.9	Low	129 Å²	129	132.1 Å²	132.1	78%	0.782	74%	0.741	S	S	*	*	P	Polyproline II helix	trans	-94.2	130.1	175	-64.8	0	0	0	0	109.4	V78	V78-V80 HydrophobicContact CG1-CG1 3.86Å
81	E	77.3	Confident	69.2	Low	187 Å²	187	132.6 Å²	132.6	87%	0.874	74%	0.743	S	S	*	*	P	Polyproline II helix	trans	-92.2	132.6	170.7	-69.6	179.3	-177.8	0	0	109.4	Y83	E81-Y83 PolarHBondContact O-N 3.37Å
82	T	79.3	Confident	70	Confident	101 Å²	101	138.7 Å²	138.7	62%	0.62	76%	0.756	S	S	*	*	P	Polyproline II helix	trans	-67.1	118.3	173.7	51	0	0	0	0	109.7	W88	T82-W88 VanDerWaalsContact CB-CZ2 3.45Å; T82-W88 HydrophobicContact CG2-CD2 3.98Å; T82-W88 HydrophobicContact CG2-CE3 3.91Å; T82-W88 HydrophobicContact CG2-CH2 3.63Å; T82-W88 HydrophobicContact CG2-CZ2 3.67Å; T82-W88 HydrophobicContact CG2-CZ3 3.73Å
83	Y	80.9	Confident	71.1	Confident	222 Å²	222	136.2 Å²	136.2	87%	0.871	75%	0.749	S	S	*	*			trans	-105.2	120	173.2	-176.2	-98.5	0	0	0	110.4	E81	E81-Y83 PolarHBondContact O-N 3.37Å
84	G	87.1	Confident	72.3	Confident	60 Å²	60	135.4 Å²	135.4	62%	0.619	74%	0.74	S	S	*	*	S	Bend	trans	79.4	-164.2	-177.8	0	0	0	0	0	113.9	W88	G84-W88 WeakPolarHBondContact O-CZ2 3.49Å
85	G	88.8	Confident	73.7	Confident	83 Å²	83	139 Å²	139	86%	0.856	74%	0.741	S	S	*	*	S	Bend	trans	-108.1	53.7	-177.8	0	0	0	0	0	113.3
86	G	85.8	Confident	75.1	Confident	34 Å²	34	133.4 Å²	133.4	35%	0.351	73%	0.73	S	S	.	*			trans	-67.8	156.4	-178.9	0	0	0	0	0	113.4	W88	G86-W88 PolarHBondContact O-N 3.5Å; G86-W88 VanDerWaalsContact O-N 3.09Å; G86-W88 PolarHBondContact O-NE1 3.15Å
87	I	90.6	Very high	76.8	Confident	123 Å²	123	130.4 Å²	130.4	63%	0.631	72%	0.724	S	S	*	*			trans	-78.2	91.3	169.5	-55.8	176.7	0	0	0	107.6	S89 T90	I87-S89 WeakPolarHBondContact CG2-OG 3.4Å; I87-S89 PolarHBondContact O-N 3.02Å; I87-T90 HydrophobicContact CB-CG2 4.31Å; I87-T90 HydrophobicContact CG2-CG2 3.98Å; I87-T90 PolarHBondContact O-N 3.35Å; I87-T90 PolarHBondContact O-OG1 3.34Å
88	W	83.7	Confident	78.8	Confident	106 Å²	106	125.6 Å²	125.6	40%	0.402	71%	0.709	S	S	.	*	G	3₁₀ helix	trans	-64	-23.4	-170.2	-51.3	112.6	0	0	0	114.3	T82 G84 G86 T90 W91	T82-W88 VanDerWaalsContact CB-CZ2 3.45Å; T82-W88 HydrophobicContact CG2-CD2 3.98Å; T82-W88 HydrophobicContact CG2-CE3 3.91Å; T82-W88 HydrophobicContact CG2-CH2 3.63Å; T82-W88 HydrophobicContact CG2-CZ2 3.67Å; T82-W88 HydrophobicContact CG2-CZ3 3.73Å; G84-W88 WeakPolarHBondContact O-CZ2 3.49Å; G86-W88 PolarHBondContact O-N 3.5Å; G86-W88 VanDerWaalsContact O-N 3.09Å; G86-W88 PolarHBondContact O-NE1 3.15Å; W88-T90 PolarHBondContact O-N 3.12Å; W88-W91 PolarHBondContact O-N 3.19Å
89	S	86.5	Confident	80.6	Confident	91 Å²	91	125.7 Å²	125.7	64%	0.636	71%	0.706	S	S	*	*	G	3₁₀ helix	trans	-65.9	-19.3	176.8	56.6	0	0	0	0	113.9	I87 W91	I87-S89 WeakPolarHBondContact CG2-OG 3.4Å; I87-S89 PolarHBondContact O-N 3.02Å; S89-W91 PolarHBondContact O-N 3.43Å
90	T	91.1	Very high	82.4	Confident	104 Å²	104	129.6 Å²	129.6	64%	0.638	70%	0.701	S	S	*	*	G	3₁₀ helix	trans	-81.9	-2.5	176.8	68.1	0	0	0	0	113.5	I87 W88	I87-T90 HydrophobicContact CB-CG2 4.31Å; I87-T90 HydrophobicContact CG2-CG2 3.98Å; I87-T90 PolarHBondContact O-N 3.35Å; I87-T90 PolarHBondContact O-OG1 3.34Å; W88-T90 PolarHBondContact O-N 3.12Å
91	W	81.3	Confident	83.5	Confident	201 Å²	201	129.7 Å²	129.7	76%	0.761	69%	0.694	S	S	*	*	G	3₁₀ helix	trans	-97.3	-0.8	180	-70.8	73.8	0	0	0	113	W88 S89	W88-W91 PolarHBondContact O-N 3.19Å; S89-W91 PolarHBondContact O-N 3.43Å
92	F	69.9	Low	84.1	Confident	244 Å²	244	124.5 Å²	124.5	100%	1.07	68%	0.678	S	S	*	*			trans	-113.8	0	175.3	-67.5	-80.9	0	0	0	111.2

Retrieved 92 of 92 residues in 179.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).