A0A087WSE0_MOUSE Loading...

Serine (or cysteine) preptidase inhibitor, clade A, member 1B

AlphaFold DB , UniProt , Accession A0A087WSE0, Species MOUSE (Mus musculus, Mouse), Gene Serpina1b, Length 36 aa.

						>A0A087WSE0_MOUSE|A0A087WSE0|Serpina1b
MTPSISWGLLLLAGLCCMVPSFLAEDVQETDTSQKD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.4	Low	75.1	Confident	236 Å²	236	119.3 Å²	119.3	100%	1.163	66%	0.66	S	S	*	*				0	96.7	0	-73.1	159.2	158.3	0	107.9	P3	M1-P3 WeakPolarHBondContact O-CD 3.11Å
2	T	57	Low	76.2	Confident	116 Å²	116	118.7 Å²	118.7	71%	0.712	65%	0.654	S	S	*	*			trans	-112.6	65.7	173.2	45.1	0	0	0	109.6	S4	T2-S4 PolarHBondContact O-N 3.32Å
3	P	63	Low	76.9	Confident	97 Å²	97	113.5 Å²	113.5	63%	0.63	64%	0.636	S	S	*	*	H	α-helix	trans	-70.8	-13.2	-179.9	31	-35.9	0	0	112.9	M1	M1-P3 WeakPolarHBondContact O-CD 3.11Å
4	S	67.3	Low	77.5	Confident	100 Å²	100	108.4 Å²	108.4	70%	0.699	62%	0.622	S	S	*	*	H	α-helix	trans	-80	-39.5	-168.3	-162.2	0	0	0	113.5	T2 G8	T2-S4 PolarHBondContact O-N 3.32Å; S4-G8 PolarHBondContact O-N 3.4Å
5	I	72.1	Confident	77.9	Confident	123 Å²	123	108.7 Å²	108.7	63%	0.631	62%	0.62	S	S	*	*	H	α-helix	trans	-75.1	-42.9	-178.4	-87.6	157.2	0	0	111.9	W7 G8 L9	I5-W7 PolarHBondContact O-N 3.02Å; I5-G8 PolarHBondContact O-N 3.18Å; I5-L9 HydrophobicContact CG2-CD1 3.86Å; I5-L9 HydrophobicContact CG2-CG 4.36Å; I5-L9 WeakPolarHBondContact O-CG 3.49Å; I5-L9 PolarHBondContact O-N 3.29Å
6	S	79.4	Confident	78	Confident	80 Å²	80	106.8 Å²	106.8	56%	0.559	61%	0.614	S	S	*	*	H	α-helix	trans	-62.3	-33.5	-179.4	-57.7	0	0	0	112	L10	S6-L10 WeakPolarHBondContact O-CB 3.36Å; S6-L10 PolarHBondContact O-N 3.45Å; S6-L10 VanDerWaalsContact O-N 3.09Å
7	W	82.6	Confident	77.7	Confident	184 Å²	184	105.9 Å²	105.9	70%	0.697	62%	0.615	S	S	*	*	H	α-helix	trans	-74	-39.8	177.4	-158.7	19.4	0	0	112.4	I5 L9 L10 L11	I5-W7 PolarHBondContact O-N 3.02Å; W7-L9 PolarHBondContact O-N 2.77Å; W7-L10 PolarHBondContact O-N 3.39Å; W7-L11 WeakPolarHBondContact O-CG 3.44Å; W7-L11 PolarHBondContact O-N 3.14Å
8	G	88.3	Confident	77.2	Confident	40 Å²	40	108 Å²	108	41%	0.412	62%	0.62	S	S	.	*	H	α-helix	trans	-61.8	-41.4	173.9	0	0	0	0	112.8	S4 I5 L11 L12	S4-G8 PolarHBondContact O-N 3.4Å; I5-G8 PolarHBondContact O-N 3.18Å; G8-L11 PolarHBondContact O-N 3.21Å; G8-L12 WeakPolarHBondContact O-CB 3.38Å; G8-L12 PolarHBondContact O-N 3.42Å
9	L	87.2	Confident	76.7	Confident	109 Å²	109	107.2 Å²	107.2	57%	0.571	62%	0.617	S	S	*	*	H	α-helix	trans	-67.6	-36.5	176.2	-68	175.4	0	0	112.4	I5 W7 L12 A13	I5-L9 HydrophobicContact CG2-CD1 3.86Å; I5-L9 HydrophobicContact CG2-CG 4.36Å; I5-L9 WeakPolarHBondContact O-CG 3.49Å; I5-L9 PolarHBondContact O-N 3.29Å; W7-L9 PolarHBondContact O-N 2.77Å; L9-L12 PolarHBondContact O-N 3.07Å; L9-A13 PolarHBondContact O-N 2.94Å; L9-A13 WeakPolarHBondContact O-CB 3.3Å
10	L	86.9	Confident	76	Confident	126 Å²	126	105.1 Å²	105.1	66%	0.66	61%	0.607	S	S	*	*	H	α-helix	trans	-66.7	-41.2	176.8	-156.1	76.8	0	0	111.7	S6 W7 A13 G14	S6-L10 WeakPolarHBondContact O-CB 3.36Å; S6-L10 PolarHBondContact O-N 3.45Å; S6-L10 VanDerWaalsContact O-N 3.09Å; W7-L10 PolarHBondContact O-N 3.39Å; L10-A13 PolarHBondContact O-N 2.94Å; L10-G14 PolarHBondContact O-N 2.85Å
11	L	88.4	Confident	75.3	Confident	101 Å²	101	103.6 Å²	103.6	53%	0.529	60%	0.602	S	S	.	*	H	α-helix	trans	-63.4	-46	173.3	-70.6	172	0	0	111.1	W7 G8 A13 G14 L15	W7-L11 WeakPolarHBondContact O-CG 3.44Å; W7-L11 PolarHBondContact O-N 3.14Å; G8-L11 PolarHBondContact O-N 3.21Å; L11-A13 PolarHBondContact O-N 3.33Å; L11-G14 PolarHBondContact O-N 3.43Å; L11-L15 WeakPolarHBondContact O-CD1 3.08Å; L11-L15 PolarHBondContact O-N 3.48Å; L11-L15 VanDerWaalsContact O-N 3.07Å
12	L	88.3	Confident	75.7	Confident	112 Å²	112	99.6 Å²	99.6	59%	0.586	58%	0.579	S	S	*	*	H	α-helix	trans	-62.5	-41.7	178.4	-174	62.6	0	0	111.7	G8 L9 L15 C16	G8-L12 WeakPolarHBondContact O-CB 3.38Å; G8-L12 PolarHBondContact O-N 3.42Å; L9-L12 PolarHBondContact O-N 3.07Å; L12-L15 PolarHBondContact O-N 3.39Å; L12-C16 WeakPolarHBondContact O-CB 3.08Å; L12-C16 PolarHBondContact O-N 2.79Å
13	A	85.9	Confident	75.7	Confident	51 Å²	51	99.1 Å²	99.1	42%	0.421	57%	0.571	S	S	.	*	H	α-helix	trans	-62.7	-40	175.6	0	0	0	0	112	L9 L10 L11 C16 C17	L9-A13 PolarHBondContact O-N 2.94Å; L9-A13 WeakPolarHBondContact O-CB 3.3Å; L10-A13 PolarHBondContact O-N 2.94Å; L11-A13 PolarHBondContact O-N 3.33Å; A13-C16 CarbonylContact O-C 3.53Å; A13-C16 PolarHBondContact O-N 2.96Å; A13-C17 WeakPolarHBondContact O-CB 2.72Å; A13-C17 PolarHBondContact O-N 3.14Å; A13-C17 PolarHBondContact O-SG 3.26Å; A13-C17 VanDerWaalsContact O-SG 3.33Å
14	G	85.1	Confident	75.6	Confident	42 Å²	42	96.8 Å²	96.8	43%	0.433	56%	0.56	S	S	.	*	H	α-helix	trans	-61.3	-47	174.8	0	0	0	0	113	L10 L11 C17 M18	L10-G14 PolarHBondContact O-N 2.85Å; L11-G14 PolarHBondContact O-N 3.43Å; G14-C17 PolarHBondContact O-N 3.41Å; G14-M18 PolarHBondContact O-N 3.46Å
15	L	83.9	Confident	75.1	Confident	114 Å²	114	98 Å²	98	60%	0.597	56%	0.555	S	S	*	*	H	α-helix	trans	-66	-41.9	174.9	-83.7	86.9	0	0	111.8	L11 L12 C17 M18 V19	L11-L15 WeakPolarHBondContact O-CD1 3.08Å; L11-L15 PolarHBondContact O-N 3.48Å; L11-L15 VanDerWaalsContact O-N 3.07Å; L12-L15 PolarHBondContact O-N 3.39Å; L15-C17 PolarHBondContact O-N 3.29Å; L15-M18 PolarHBondContact O-N 3.34Å; L15-M18 VanDerWaalsContact O-N 3.14Å; L15-V19 WeakPolarHBondContact O-CG2 2.87Å; L15-V19 PolarHBondContact O-N 3.38Å
16	C	79.7	Confident	74.3	Confident	77 Å²	77	97 Å²	97	52%	0.52	55%	0.551	S	S	.	*	H	α-helix	trans	-70.9	-13.5	178.4	-163.6	0	0	0	112.7	L12 A13 P20	L12-C16 WeakPolarHBondContact O-CB 3.08Å; L12-C16 PolarHBondContact O-N 2.79Å; A13-C16 CarbonylContact O-C 3.53Å; A13-C16 PolarHBondContact O-N 2.96Å; C16-P20 WeakPolarHBondContact O-CD 3.11Å; C16-P20 WeakPolarHBondContact O-CG 3.41Å
17	C	72.3	Confident	73.3	Confident	93 Å²	93	97.5 Å²	97.5	63%	0.628	55%	0.55	S	S	*	*	H	α-helix	trans	-85	-34.3	167.2	-76.7	0	0	0	111.7	A13 G14 L15 S21	A13-C17 WeakPolarHBondContact O-CB 2.72Å; A13-C17 PolarHBondContact O-N 3.14Å; A13-C17 PolarHBondContact O-SG 3.26Å; A13-C17 VanDerWaalsContact O-SG 3.33Å; G14-C17 PolarHBondContact O-N 3.41Å; L15-C17 PolarHBondContact O-N 3.29Å; C17-S21 WeakPolarHBondContact O-CB 3.36Å; C17-S21 PolarHBondContact O-N 2.87Å
18	M	68.3	Low	72	Confident	143 Å²	143	95.4 Å²	95.4	70%	0.704	55%	0.548	S	S	*	.	H	α-helix	trans	-70	-41.3	175	-89.2	-168.8	84.2	0	112.9	G14 L15 S21 F22	G14-M18 PolarHBondContact O-N 3.46Å; L15-M18 PolarHBondContact O-N 3.34Å; L15-M18 VanDerWaalsContact O-N 3.14Å; M18-S21 PolarHBondContact O-N 3.4Å; M18-F22 PolarHBondContact O-N 3.4Å
19	V	67.4	Low	70.4	Confident	93 Å²	93	100.4 Å²	100.4	56%	0.564	56%	0.561	S	S	*	*	H	α-helix	trans	-59.5	-51.9	-177.1	167.4	0	0	0	113.4	L15 S21 F22 L23	L15-V19 WeakPolarHBondContact O-CG2 2.87Å; L15-V19 PolarHBondContact O-N 3.38Å; V19-S21 VanDerWaalsContact C-N 3.34Å; V19-F22 PolarHBondContact O-N 2.94Å; V19-L23 PolarHBondContact O-N 3.46Å; V19-L23 VanDerWaalsContact O-N 3.07Å
20	P	63.3	Low	68.7	Low	64 Å²	64	100.3 Å²	100.3	42%	0.416	57%	0.565	S	S	.	*	H	α-helix	trans	-71.6	-26.8	176.6	4.7	3.6	0	0	112.6	C16 L23 A24	C16-P20 WeakPolarHBondContact O-CD 3.11Å; C16-P20 WeakPolarHBondContact O-CG 3.41Å; P20-L23 PolarHBondContact O-N 3.5Å; P20-A24 WeakPolarHBondContact O-CB 3.4Å; P20-A24 PolarHBondContact O-N 3.23Å
21	S	61.6	Low	67.1	Low	74 Å²	74	100.8 Å²	100.8	52%	0.517	57%	0.568	S	S	.	*	H	α-helix	trans	-67.2	-39.9	173.5	-159.6	0	0	0	111.1	C17 M18 V19 A24 E25	C17-S21 WeakPolarHBondContact O-CB 3.36Å; C17-S21 PolarHBondContact O-N 2.87Å; M18-S21 PolarHBondContact O-N 3.4Å; V19-S21 VanDerWaalsContact C-N 3.34Å; S21-A24 PolarHBondContact O-N 3.33Å; S21-E25 VanDerWaalsContact O-CB 3.3Å; S21-E25 PolarHBondContact O-N 3.06Å; S21-E25 WeakPolarHBondContact O-CB 3.39Å
22	F	61.1	Low	65.4	Low	153 Å²	153	101.7 Å²	101.7	67%	0.671	58%	0.578	S	S	*	*	H	α-helix	trans	-66.6	-40.4	175.1	-148.3	-94.7	0	0	111.7	M18 V19 D26	M18-F22 PolarHBondContact O-N 3.4Å; V19-F22 PolarHBondContact O-N 2.94Å; F22-D26 WeakPolarHBondContact O-CB 3.42Å; F22-D26 PolarHBondContact O-N 2.95Å; F22-D26 VanDerWaalsContact O-N 3.14Å
23	L	58.5	Low	63.9	Low	106 Å²	106	101.6 Å²	101.6	56%	0.555	59%	0.586	S	S	*	*	H	α-helix	trans	-68.9	-37.1	174.7	-109.9	160.3	0	0	112.8	V19 P20 V27	V19-L23 PolarHBondContact O-N 3.46Å; V19-L23 VanDerWaalsContact O-N 3.07Å; P20-L23 PolarHBondContact O-N 3.5Å; L23-V27 HydrophobicContact CD2-CG2 4.46Å; L23-V27 WeakPolarHBondContact O-CB 3.45Å; L23-V27 WeakPolarHBondContact O-CG2 3.33Å; L23-V27 PolarHBondContact O-N 3.07Å
24	A	59	Low	62.3	Low	47 Å²	47	107.7 Å²	107.7	39%	0.388	61%	0.606	S	S	.	*	H	α-helix	trans	-77.4	-28.7	-179.6	0	0	0	0	112.8	P20 S21 Q28	P20-A24 WeakPolarHBondContact O-CB 3.4Å; P20-A24 PolarHBondContact O-N 3.23Å; S21-A24 PolarHBondContact O-N 3.33Å; A24-Q28 PolarHBondContact O-N 3.49Å; A24-Q28 WeakPolarHBondContact O-CB 3.15Å
25	E	57.4	Low	60.5	Low	126 Å²	126	115.1 Å²	115.1	59%	0.589	63%	0.627	S	S	*	*	H	α-helix	trans	-69.3	-47	170.6	-166.7	161	85	0	110.1	S21 V27 Q28 E29	S21-E25 VanDerWaalsContact O-CB 3.3Å; S21-E25 PolarHBondContact O-N 3.06Å; S21-E25 WeakPolarHBondContact O-CB 3.39Å; E25-V27 PolarHBondContact O-N 3.21Å; E25-Q28 PolarHBondContact O-N 3.02Å; E25-E29 WeakPolarHBondContact O-CG 3.39Å; E25-E29 PolarHBondContact O-N 3.27Å
26	D	56.5	Low	58.8	Low	102 Å²	102	120.5 Å²	120.5	55%	0.545	66%	0.656	S	S	.	*	H	α-helix	trans	-64	-35.7	177.5	-165.6	-102.3	0	0	113.2	F22 T30	F22-D26 WeakPolarHBondContact O-CB 3.42Å; F22-D26 PolarHBondContact O-N 2.95Å; F22-D26 VanDerWaalsContact O-N 3.14Å; D26-T30 PolarHBondContact O-OG1 3.3Å
27	V	58.4	Low	57.8	Low	90 Å²	90	122.7 Å²	122.7	55%	0.545	66%	0.663	S	S	.	*	H	α-helix	trans	-75.5	-33.4	177.5	173.1	0	0	0	112.5	L23 E25 T30	L23-V27 HydrophobicContact CD2-CG2 4.46Å; L23-V27 WeakPolarHBondContact O-CB 3.45Å; L23-V27 WeakPolarHBondContact O-CG2 3.33Å; L23-V27 PolarHBondContact O-N 3.07Å; E25-V27 PolarHBondContact O-N 3.21Å; V27-T30 PolarHBondContact O-N 3.32Å
28	Q	54.9	Low	57	Low	141 Å²	141	124.3 Å²	124.3	66%	0.659	67%	0.665	S	S	*	*	H	α-helix	trans	-76.5	-24.6	178.3	-87.8	-172.8	86.5	0	113.9	A24 E25 T30 T32	A24-Q28 PolarHBondContact O-N 3.49Å; A24-Q28 WeakPolarHBondContact O-CB 3.15Å; E25-Q28 PolarHBondContact O-N 3.02Å; Q28-T30 PolarHBondContact O-N 3.09Å; Q28-T32 PolarHBondContact O-OG1 3.29Å
29	E	53.7	Low	56.4	Low	145 Å²	145	123.2 Å²	123.2	68%	0.678	66%	0.663	S	S	*	*	H	α-helix	trans	-73.4	-14.5	174.1	-67.4	-165.4	126.1	0	113	E25	E25-E29 WeakPolarHBondContact O-CG 3.39Å; E25-E29 PolarHBondContact O-N 3.27Å
30	T	52.8	Low	55.7	Low	107 Å²	107	125 Å²	125	66%	0.656	67%	0.668	S	S	*	*	H	α-helix	trans	-98.8	-16.2	178.4	-45.9	0	0	0	113.6	D26 V27 Q28	D26-T30 PolarHBondContact O-OG1 3.3Å; V27-T30 PolarHBondContact O-N 3.32Å; Q28-T30 PolarHBondContact O-N 3.09Å
31	D	52.7	Low	55.2	Low	136 Å²	136	128.8 Å²	128.8	73%	0.727	68%	0.684	S	S	*	*	H	α-helix	trans	-93	-17.1	-179	-150.9	-105.8	0	0	113.4
32	T	52.5	Low	54.8	Low	119 Å²	119	132.5 Å²	132.5	73%	0.73	70%	0.695	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.1	-1.5	179	55.7	0	0	0	114.4	Q28	Q28-T32 PolarHBondContact O-OG1 3.29Å
33	S	56.5	Low	54.4	Low	110 Å²	110	131 Å²	131	77%	0.769	70%	0.697	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100	25.7	173.9	-156.8	0	0	0	113.2
34	Q	53.7	Low	54.1	Low	180 Å²	180	132.9 Å²	132.9	84%	0.841	71%	0.708	S	S	*	*			trans	-133.3	63.6	167.6	-162.7	-177.9	77.5	0	110.8
35	K	46.4	Very low	53.6	Low	197 Å²	197	140.1 Å²	140.1	86%	0.857	74%	0.735	S	S	*	*			trans	-146.6	94.4	154	-159.9	158.8	-175.7	154.4	110
36	D	48.3	Very low	53.3	Low	228 Å²	228	141.4 Å²	141.4	100%	1.219	75%	0.748	S	S	*	*			trans	-42.1	0	151.8	-172.4	-104.2	0	0	111.2

Retrieved 36 of 36 residues in 34.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).