A0A087WSF3_MOUSE Loading...

Secreted phosphoprotein 24

Could coordinate an aspect of bone turnover.

AlphaFold DB , UniProt , Accession A0A087WSF3, Species MOUSE (Mus musculus, Mouse), Gene Spp2, Length 78 aa.

						>A0A087WSF3_MOUSE|A0A087WSF3|Spp2
YLFRATRSSLKRVNVLDEDTLVMNLEFSVQETTCLRDSGDPSTCAFQRGYSVMMFGDMARSHRRRNDYLLESASPFHP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	Y	82	Confident	89.3	Confident	127 Å²	127	92 Å²	92	50%	0.498	45%	0.45	S	S	.	.				0	156.6	0	-61.1	-84.8	0	0	0	110	E31 C34 L35	Y1-E31 WeakPolarHBondContact CB-OE1 3.43Å; Y1-E31 WeakPolarHBondContact CD2-OE1 3.2Å; Y1-E31 HydrophobicContact CG-CG 4.3Å; Y1-C34 CarbonylContact C-O 3.59Å; Y1-C34 WeakPolarHBondContact CA-O 3.25Å; Y1-L35 HydrophobicContact CD1-CD2 4.11Å; Y1-L35 HydrophobicContact CE1-CD2 3.84Å
2	L	88.6	Confident	89.5	Confident	31 Å²	31	97.8 Å²	97.8	16%	0.162	46%	0.463	C	S	.	.			trans	-84.6	147.3	172.1	-71	173.3	0	0	0	110.4	T32 C34 L35 R36 P41	L2-T32 WeakPolarHBondContact CB-OG1 3.45Å; L2-T32 WeakPolarHBondContact O-CB 2.92Å; L2-T32 PolarHBondContact O-N 3.24Å; L2-T32 PolarHBondContact O-OG1 3.08Å; L2-C34 HydrophobicContact CB-CB 4.45Å; L2-C34 HydrophobicContact CD1-CB 4.02Å; L2-C34 PolarHBondContact N-O 3.08Å; L2-L35 WeakPolarHBondContact CG-O 3.28Å; L2-R36 HydrophobicContact CD2-CG 4.36Å; L2-P41 HydrophobicContact CB-CB 4.3Å; L2-P41 HydrophobicContact CD1-CB 4.13Å
3	F	89.6	Confident	89.6	Confident	127 Å²	127	96 Å²	96	56%	0.557	46%	0.463	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-109.3	146.1	172.1	-68.9	-92.7	0	0	0	109.3	Q30 E31	F3-Q30 WeakPolarHBondContact CA-O 3.4Å; F3-E31 HydrophobicContact CD1-CB 4.13Å; F3-E31 HydrophobicContact CE1-CB 3.75Å; F3-E31 HydrophobicContact CE1-CG 4.13Å; F3-E31 HydrophobicContact CZ-CB 4.34Å; F3-E31 HydrophobicContact CZ-CG 4.22Å
4	R	89.4	Confident	89.6	Confident	87 Å²	87	92.9 Å²	92.9	33%	0.328	45%	0.449	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.7	138.2	175.8	-178.1	-178.7	176.4	-178.2	6.4	110.1	Q30 T32 P41 S42 F46	R4-Q30 PolarHBondContact N-O 2.99Å; R4-Q30 PolarHBondContact O-N 2.89Å; R4-T32 HydrophobicContact CB-CG2 3.79Å; R4-P41 WeakPolarHBondContact CD-O 3.32Å; R4-S42 PolarHBondContact NH1-O 3.33Å; R4-F46 HydrophobicContact CB-CE1 3.91Å; R4-F46 HydrophobicContact CB-CZ 4.42Å; R4-F46 HydrophobicContact CG-CE1 4.27Å; R4-F46 HydrophobicContact CG-CZ 4.28Å
5	A	89.9	Confident	89.6	Confident	58 Å²	58	93.9 Å²	93.9	48%	0.479	46%	0.463	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.9	138.6	171.7	0	0	0	0	0	110.7	F27 S28	A5-F27 HydrophobicContact CB-CD2 4.01Å; A5-S28 CarbonylContact C-O 3.43Å; A5-S28 VanDerWaalsContact CA-O 3.28Å; A5-S28 WeakPolarHBondContact CA-O 3.24Å
6	T	89.3	Confident	89.3	Confident	29 Å²	29	95.8 Å²	95.8	18%	0.178	48%	0.475	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.1	154.8	-179.8	123.4	0	0	0	0	107.9	S8 S28 Q30 F46	T6-S8 PolarHBondContact O-N 2.94Å; T6-S28 PolarHBondContact N-O 3.26Å; T6-S28 PolarHBondContact O-N 2.82Å; T6-S28 VanDerWaalsContact O-O 3.11Å; T6-Q30 HydrophobicContact CG2-CB 4.05Å; T6-F46 HydrophobicContact CG2-CE1 3.64Å; T6-F46 HydrophobicContact CG2-CZ 3.67Å
7	R	88.2	Confident	88.9	Confident	215 Å²	215	96.2 Å²	96.2	81%	0.811	48%	0.48	S	S	*	.	E	Extended strand (participates in β ladder)	trans	51.4	51.9	175.7	-66.3	172.7	164	-106.9	-1.7	113.4
8	S	88.8	Confident	88.5	Confident	94 Å²	94	101.2 Å²	101.2	66%	0.657	50%	0.501	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-77.4	132	176.7	55.1	0	0	0	0	111.7	T6 E26	T6-S8 PolarHBondContact O-N 2.94Å; S8-E26 CarbonylContact C-O 3.44Å; S8-E26 WeakPolarHBondContact CA-O 2.91Å
9	S	91.7	Very high	88.3	Confident	54 Å²	54	100 Å²	100	38%	0.378	50%	0.497	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.3	132	175.4	-177.1	0	0	0	0	109.9	K11 L25 E26	S9-K11 PolarHBondContact O-N 3.03Å; S9-L25 WeakPolarHBondContact O-CA 3.07Å; S9-E26 PolarHBondContact N-O 3.48Å; S9-E26 PolarHBondContact O-N 3.23Å
10	L	92	Very high	88	Confident	86 Å²	86	97 Å²	97	45%	0.45	48%	0.484	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.2	117.8	172.4	-172.3	144.3	0	0	0	109	V13 M23 L25	L10-V13 HydrophobicContact CD1-CG2 4Å; L10-V13 HydrophobicContact CD2-CG2 3.58Å; L10-V13 HydrophobicContact CG-CG2 4.33Å; L10-M23 HydrophobicContact CD1-CB 4.02Å; L10-M23 HydrophobicContact CD1-CG 3.97Å; L10-M23 HydrophobicContact CD1-SD 3.76Å; L10-L25 HydrophobicContact CB-CD2 4.17Å
11	K	92.6	Very high	88.1	Confident	104 Å²	104	94.2 Å²	94.2	45%	0.452	47%	0.471	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.1	-39.5	-178.8	-64.3	-65.7	175.5	159.8	0	112	S9 N24 E26	S9-K11 PolarHBondContact O-N 3.03Å; K11-N24 PolarHBondContact N-O 3.05Å; K11-E26 HydrophobicContact CD-CB 4.23Å; K11-E26 WeakPolarHBondContact CE-OE1 2.95Å; K11-E26 WeakPolarHBondContact CE-OE2 3.39Å; K11-E26 HydrophobicContact CG-CB 3.81Å; K11-E26 IonicContact NZ-OE1 2.84Å; K11-E26 PolarHBondContact NZ-OE1 3.14Å; K11-E26 IonicContact NZ-OE2 2.79Å; K11-E26 PolarHBondContact NZ-OE2 2.85Å
12	R	91.4	Very high	88.5	Confident	161 Å²	161	88.8 Å²	88.8	61%	0.608	45%	0.451	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-152.6	148.7	-178.4	-156	177.7	175.5	-176.1	-1	111.4	N14 M23 N24	R12-N14 VanDerWaalsContact CD-OD1 3.28Å; R12-N14 WeakPolarHBondContact CD-OD1 3.45Å; R12-N14 WeakPolarHBondContact CG-OD1 3.39Å; R12-M23 CarbonylContact O-C 3.57Å; R12-M23 WeakPolarHBondContact O-CA 2.97Å; R12-N24 HydrophobicContact CB-CB 3.96Å; R12-N24 PolarHBondContact N-O 3.27Å; R12-N24 PolarHBondContact O-N 2.92Å
13	V	91.7	Very high	88.6	Confident	75 Å²	75	88.8 Å²	88.8	46%	0.455	45%	0.45	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.1	130.4	165.1	-171.7	0	0	0	0	107.9	L10 L21 M23	L10-V13 HydrophobicContact CD1-CG2 4Å; L10-V13 HydrophobicContact CD2-CG2 3.58Å; L10-V13 HydrophobicContact CG-CG2 4.33Å; V13-L21 HydrophobicContact CG1-CD2 4.5Å; V13-M23 HydrophobicContact CG1-CG 4.4Å; V13-M23 HydrophobicContact CG2-CG 4.36Å
14	N	89.6	Confident	88.7	Confident	52 Å²	52	85.3 Å²	85.3	28%	0.278	44%	0.437	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.4	128.1	177.3	-72.8	68.6	0	0	0	108.4	R12 L21 V22	R12-N14 VanDerWaalsContact CD-OD1 3.28Å; R12-N14 WeakPolarHBondContact CD-OD1 3.45Å; R12-N14 WeakPolarHBondContact CG-OD1 3.39Å; N14-L21 CarbonylContact O-C 3.59Å; N14-L21 WeakPolarHBondContact O-CA 3.2Å; N14-V22 PolarHBondContact N-O 2.86Å; N14-V22 PolarHBondContact O-N 2.77Å
15	V	89.3	Confident	88.8	Confident	108 Å²	108	82.3 Å²	82.3	66%	0.655	43%	0.428	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-87.9	114	171.4	-172.4	0	0	0	0	106.7	D17 L21	V15-D17 VanDerWaalsContact CG1-O 3.28Å; V15-D17 WeakPolarHBondContact CG1-O 3.45Å; V15-L21 HydrophobicContact CB-CD2 4.2Å; V15-L21 HydrophobicContact CG1-CD2 4.18Å; V15-L21 HydrophobicContact CG2-CD2 3.72Å
16	L	84.3	Confident	89	Confident	124 Å²	124	81.9 Å²	81.9	65%	0.649	42%	0.416	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-85.4	-37.6	173.6	-89.6	121.9	0	0	0	111.4	T20 V22	L16-T20 HydrophobicContact CB-CG2 4.49Å; L16-T20 PolarHBondContact N-O 3.26Å; L16-V22 HydrophobicContact CD1-CB 3.55Å; L16-V22 HydrophobicContact CD1-CG2 3.09Å
17	D	83.8	Confident	89.1	Confident	104 Å²	104	81.5 Å²	81.5	56%	0.556	41%	0.412	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-153.4	170.5	179.8	-166	-163.1	0	0	0	109.9	V15 D19 T20	V15-D17 VanDerWaalsContact CG1-O 3.28Å; V15-D17 WeakPolarHBondContact CG1-O 3.45Å; D17-D19 PolarHBondContact O-N 3.34Å; D17-T20 PolarHBondContact N-O 3.27Å; D17-T20 PolarHBondContact O-N 2.01Å
18	E	80.8	Confident	89.3	Confident	185 Å²	185	71.8 Å²	71.8	86%	0.864	38%	0.377	S	S	*	.	T	Hydrogen-bonded Turn	trans	-50.3	-35.5	-178.4	-82.1	-155.1	103	0	0	113.1
19	D	84.1	Confident	89.4	Confident	79 Å²	79	68.9 Å²	68.9	42%	0.422	36%	0.355	S	S	.	.	T	Hydrogen-bonded Turn	trans	-105.7	-1.7	-178.5	-71	-61.5	0	0	0	114	D17 S61 H62	D17-D19 PolarHBondContact O-N 3.34Å; D19-S61 CarbonylContact O-C 3.56Å; D19-S61 VanDerWaalsContact O-CA 3.25Å; D19-S61 WeakPolarHBondContact O-CA 3.28Å; D19-H62 HydrophobicContact CB-CB 4.24Å; D19-H62 PolarHBondContact O-N 3.48Å
20	T	83.8	Confident	89.5	Confident	39 Å²	39	67.9 Å²	67.9	24%	0.239	35%	0.345	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.6	122.6	-169.8	-52.8	0	0	0	0	112.6	L16 D17	L16-T20 HydrophobicContact CB-CG2 4.49Å; L16-T20 PolarHBondContact N-O 3.26Å; D17-T20 PolarHBondContact N-O 3.27Å; D17-T20 PolarHBondContact O-N 2.01Å
21	L	89	Confident	89.5	Confident	40 Å²	40	67 Å²	67	21%	0.209	34%	0.338	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.2	137.2	177.7	-56	176.3	0	0	0	109.5	V13 N14 V15 A59 R60	V13-L21 HydrophobicContact CG1-CD2 4.5Å; N14-L21 CarbonylContact O-C 3.59Å; N14-L21 WeakPolarHBondContact O-CA 3.2Å; V15-L21 HydrophobicContact CB-CD2 4.2Å; V15-L21 HydrophobicContact CG1-CD2 4.18Å; V15-L21 HydrophobicContact CG2-CD2 3.72Å; L21-A59 CarbonylContact O-C 3.51Å; L21-A59 WeakPolarHBondContact O-CA 3.44Å; L21-R60 PolarHBondContact N-O 2.73Å; L21-R60 PolarHBondContact O-N 2.92Å
22	V	90.3	Very high	89.5	Confident	13 Å²	13	62 Å²	62	8%	0.079	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.3	127.3	165.5	167.5	0	0	0	0	109.1	N14 L16 D57 M58 A59 E71	N14-V22 PolarHBondContact N-O 2.86Å; N14-V22 PolarHBondContact O-N 2.77Å; L16-V22 HydrophobicContact CD1-CB 3.55Å; L16-V22 HydrophobicContact CD1-CG2 3.09Å; V22-D57 HydrophobicContact CG1-CB 4.02Å; V22-M58 CarbonylContact C-O 3.47Å; V22-M58 WeakPolarHBondContact CA-O 3.5Å; V22-A59 HydrophobicContact CG2-CB 4.18Å; V22-E71 WeakPolarHBondContact CG2-OE2 3.01Å
23	M	90.7	Very high	89.5	Confident	30 Å²	30	58.1 Å²	58.1	15%	0.148	31%	0.31	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.2	119.5	179.2	-61.9	178.6	-67.4	0	0	108.9	L10 R12 V13 M58 Y68	L10-M23 HydrophobicContact CD1-CB 4.02Å; L10-M23 HydrophobicContact CD1-CG 3.97Å; L10-M23 HydrophobicContact CD1-SD 3.76Å; R12-M23 CarbonylContact O-C 3.57Å; R12-M23 WeakPolarHBondContact O-CA 2.97Å; V13-M23 HydrophobicContact CG1-CG 4.4Å; V13-M23 HydrophobicContact CG2-CG 4.36Å; M23-M58 HydrophobicContact CE-CB 4.2Å; M23-M58 PolarHBondContact N-O 2.86Å; M23-M58 PolarHBondContact O-N 2.84Å; M23-Y68 HydrophobicContact CE-CD1 3.56Å; M23-Y68 HydrophobicContact CE-CE1 3.68Å
24	N	91.8	Very high	89.4	Confident	54 Å²	54	55.3 Å²	55.3	29%	0.289	29%	0.294	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.1	122.4	168.5	-93.1	-125.6	0	0	0	109	K11 R12 D57	K11-N24 PolarHBondContact N-O 3.05Å; R12-N24 HydrophobicContact CB-CB 3.96Å; R12-N24 PolarHBondContact N-O 3.27Å; R12-N24 PolarHBondContact O-N 2.92Å; N24-D57 VanDerWaalsContact CG-OD1 3.25Å; N24-D57 PolarHBondContact ND2-OD1 2.79Å
25	L	91.8	Very high	89.4	Confident	25 Å²	25	58.1 Å²	58.1	13%	0.131	31%	0.308	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.2	136	-178.2	-67.3	156	0	0	0	109	S9 L10 F27 F55 G56 M58	S9-L25 WeakPolarHBondContact O-CA 3.07Å; L10-L25 HydrophobicContact CB-CD2 4.17Å; L25-F27 HydrophobicContact CB-CD1 4.15Å; L25-F55 CarbonylContact O-C 3.2Å; L25-F55 WeakPolarHBondContact O-CA 3.49Å; L25-G56 PolarHBondContact N-O 2.8Å; L25-G56 PolarHBondContact O-N 2.85Å; L25-M58 HydrophobicContact CD1-CB 3.73Å; L25-M58 HydrophobicContact CD1-CE 4.15Å; L25-M58 HydrophobicContact CD1-CG 3.43Å; L25-M58 VanDerWaalsContact CD1-CG 3.43Å; L25-M58 HydrophobicContact CD1-SD 3.25Å; L25-M58 WeakPolarHBondContact CD1-SD 3.26Å
26	E	93.7	Very high	89.1	Confident	49 Å²	49	62.2 Å²	62.2	23%	0.229	31%	0.312	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104	127	161.8	-178.8	-174	91.6	0	0	106.9	S8 S9 K11 M54 F55	S8-E26 CarbonylContact C-O 3.44Å; S8-E26 WeakPolarHBondContact CA-O 2.91Å; S9-E26 PolarHBondContact N-O 3.48Å; S9-E26 PolarHBondContact O-N 3.23Å; K11-E26 HydrophobicContact CD-CB 4.23Å; K11-E26 WeakPolarHBondContact CE-OE1 2.95Å; K11-E26 WeakPolarHBondContact CE-OE2 3.39Å; K11-E26 HydrophobicContact CG-CB 3.81Å; K11-E26 IonicContact NZ-OE1 2.84Å; K11-E26 PolarHBondContact NZ-OE1 3.14Å; K11-E26 IonicContact NZ-OE2 2.79Å; K11-E26 PolarHBondContact NZ-OE2 2.85Å; E26-M54 WeakPolarHBondContact CA-O 3.29Å; E26-F55 HydrophobicContact CB-CD1 4.39Å; E26-F55 HydrophobicContact CB-CE1 4.02Å; E26-F55 HydrophobicContact CB-CE2 4.46Å; E26-F55 HydrophobicContact CB-CZ 4.1Å; E26-F55 HydrophobicContact CG-CE1 4.19Å; E26-F55 HydrophobicContact CG-CE2 3.84Å; E26-F55 HydrophobicContact CG-CZ 3.74Å; E26-F55 WeakPolarHBondContact OE2-CZ 3.45Å
27	F	92.8	Very high	89.1	Confident	21 Å²	21	63.9 Å²	63.9	9%	0.092	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.5	156.1	179.3	60.8	-82.8	0	0	0	109.7	A5 L25 V29 M54 A73	A5-F27 HydrophobicContact CB-CD2 4.01Å; L25-F27 HydrophobicContact CB-CD1 4.15Å; F27-V29 HydrophobicContact CD2-CG1 3.82Å; F27-V29 HydrophobicContact CE2-CG1 3.57Å; F27-M54 HydrophobicContact CD2-CB 4.2Å; F27-M54 HydrophobicContact CE1-CB 4.18Å; F27-M54 HydrophobicContact CE2-CB 3.82Å; F27-M54 HydrophobicContact CE2-CG 4.18Å; F27-M54 HydrophobicContact CZ-CB 3.81Å; F27-M54 PolarHBondContact N-O 2.78Å; F27-M54 WeakPolarHBondContact O-CA 3.45Å; F27-M54 PolarHBondContact O-N 3.43Å; F27-A73 HydrophobicContact CZ-CB 4.18Å
28	S	91.8	Very high	88.9	Confident	10 Å²	10	62.2 Å²	62.2	7%	0.07	32%	0.318	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.6	145.6	171.9	-57.5	0	0	0	0	109.9	A5 T6 V52	A5-S28 CarbonylContact C-O 3.43Å; A5-S28 VanDerWaalsContact CA-O 3.28Å; A5-S28 WeakPolarHBondContact CA-O 3.24Å; T6-S28 PolarHBondContact N-O 3.26Å; T6-S28 PolarHBondContact O-N 2.82Å; T6-S28 VanDerWaalsContact O-O 3.11Å; S28-V52 CarbonylContact C-O 3.56Å; S28-V52 VanDerWaalsContact CA-O 3.26Å; S28-V52 WeakPolarHBondContact CA-O 3.23Å
29	V	91.5	Very high	88.9	Confident	34 Å²	34	55.9 Å²	55.9	21%	0.206	30%	0.302	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.9	139.4	168.8	-66.2	0	0	0	0	109.9	F27 S51 V52 M54	F27-V29 HydrophobicContact CD2-CG1 3.82Å; F27-V29 HydrophobicContact CE2-CG1 3.57Å; V29-S51 WeakPolarHBondContact O-CA 3.32Å; V29-V52 HydrophobicContact CG2-CB 4.18Å; V29-V52 PolarHBondContact N-O 3.21Å; V29-V52 PolarHBondContact O-N 3.28Å; V29-M54 HydrophobicContact CG1-CG 4.14Å; V29-M54 HydrophobicContact CG2-CG 3.73Å; V29-M54 HydrophobicContact CG2-SD 4.2Å
30	Q	92.4	Very high	88.9	Confident	33 Å²	33	56 Å²	56	15%	0.154	30%	0.303	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.4	142.4	176.4	-172.8	168	65.6	0	0	110.6	F3 R4 T6 F46 G49	F3-Q30 WeakPolarHBondContact CA-O 3.4Å; R4-Q30 PolarHBondContact N-O 2.99Å; R4-Q30 PolarHBondContact O-N 2.89Å; T6-Q30 HydrophobicContact CG2-CB 4.05Å; Q30-F46 HydrophobicContact CB-CD1 3.8Å; Q30-F46 HydrophobicContact CB-CE1 4.04Å; Q30-F46 HydrophobicContact CG-CB 4.49Å; Q30-F46 HydrophobicContact CG-CD1 3.89Å; Q30-F46 VanDerWaalsContact OE1-CD1 3.23Å; Q30-G49 PolarHBondContact NE2-O 3.07Å
31	E	92.3	Very high	88.8	Confident	67 Å²	67	56.1 Å²	56.1	31%	0.313	30%	0.304	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.3	142.3	174.5	-165.8	171	-159.5	0	0	110.6	Y1 F3 Q47	Y1-E31 WeakPolarHBondContact CB-OE1 3.43Å; Y1-E31 WeakPolarHBondContact CD2-OE1 3.2Å; Y1-E31 HydrophobicContact CG-CG 4.3Å; F3-E31 HydrophobicContact CD1-CB 4.13Å; F3-E31 HydrophobicContact CE1-CB 3.75Å; F3-E31 HydrophobicContact CE1-CG 4.13Å; F3-E31 HydrophobicContact CZ-CB 4.34Å; F3-E31 HydrophobicContact CZ-CG 4.22Å; E31-Q47 VanDerWaalsContact CG-OE1 3.24Å; E31-Q47 PolarHBondContact O-N 2.95Å; E31-Q47 PolarHBondContact OE2-OE1 3.22Å
32	T	92.3	Very high	88.7	Confident	0 Å²	0	57.1 Å²	57.1	0%	0	32%	0.315	C	S	.	.	B	Isolated β-bridge	trans	-109.3	163.5	179.8	70.3	0	0	0	0	110.8	L2 R4 C34 C44 A45 F46	L2-T32 WeakPolarHBondContact CB-OG1 3.45Å; L2-T32 WeakPolarHBondContact O-CB 2.92Å; L2-T32 PolarHBondContact O-N 3.24Å; L2-T32 PolarHBondContact O-OG1 3.08Å; R4-T32 HydrophobicContact CB-CG2 3.79Å; T32-C34 PolarHBondContact O-N 3.43Å; T32-C44 HydrophobicContact CG2-CB 4.14Å; T32-A45 CarbonylContact C-O 3.48Å; T32-A45 WeakPolarHBondContact CA-O 3.47Å; T32-A45 WeakPolarHBondContact CB-O 3.43Å; T32-F46 HydrophobicContact CG2-CD1 4.28Å
33	T	91.6	Very high	88.6	Confident	78 Å²	78	62 Å²	62	48%	0.479	35%	0.345	S	S	.	.	S	Bend	trans	-70.1	-13.9	177.5	56.3	0	0	0	0	112.9	A45 Q47	T33-A45 HydrophobicContact CG2-CB 4.41Å; T33-A45 PolarHBondContact N-O 3.17Å; T33-A45 PolarHBondContact OG1-O 2.95Å; T33-Q47 HydrophobicContact CG2-CG 3.75Å
34	C	90.6	Very high	88.5	Confident	17 Å²	17	60.9 Å²	60.9	12%	0.115	34%	0.34	C	S	.	.	S	Bend	trans	-77.4	140.6	-178.7	-72.3	0	0	0	0	112.9	Y1 L2 T32 C44	Y1-C34 CarbonylContact C-O 3.59Å; Y1-C34 WeakPolarHBondContact CA-O 3.25Å; L2-C34 HydrophobicContact CB-CB 4.45Å; L2-C34 HydrophobicContact CD1-CB 4.02Å; L2-C34 PolarHBondContact N-O 3.08Å; T32-C34 PolarHBondContact O-N 3.43Å; C34-C44 HydrophobicContact CB-CB 3.75Å; C34-C44 WeakPolarHBondContact CB-SG 2.99Å; C34-C44 WeakPolarHBondContact SG-CB 3.4Å; C34-C44 CovalentContact SG-SG 2.01Å; C34-C44 PolarHBondContact SG-SG 3.26Å
35	L	88.4	Confident	88.5	Confident	110 Å²	110	61.2 Å²	61.2	58%	0.576	35%	0.35	S	S	*	.			trans	-72.3	160.6	166.8	-62	176.5	0	0	0	110.2	Y1 L2 D37 S38	Y1-L35 HydrophobicContact CD1-CD2 4.11Å; Y1-L35 HydrophobicContact CE1-CD2 3.84Å; L2-L35 WeakPolarHBondContact CG-O 3.28Å; L35-D37 PolarHBondContact O-N 3.14Å; L35-D37 VanDerWaalsContact O-N 3.08Å; L35-S38 WeakPolarHBondContact O-CB 3.36Å; L35-S38 PolarHBondContact O-N 2.97Å; L35-S38 VanDerWaalsContact O-N 3.08Å
36	R	83.7	Confident	88.5	Confident	194 Å²	194	63.9 Å²	63.9	73%	0.732	36%	0.361	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.2	-30.8	-174.8	-102.7	-176.3	169.6	-151	-2.2	113.6	L2	L2-R36 HydrophobicContact CD2-CG 4.36Å
37	D	83.1	Confident	88.4	Confident	159 Å²	159	64.1 Å²	64.1	85%	0.85	36%	0.362	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97.6	9.2	-174.3	-47.5	-58.8	0	0	0	113.3	L35 G39	L35-D37 PolarHBondContact O-N 3.14Å; L35-D37 VanDerWaalsContact O-N 3.08Å; D37-G39 PolarHBondContact O-N 3.09Å
38	S	81.3	Confident	88.1	Confident	70 Å²	70	75.6 Å²	75.6	49%	0.49	41%	0.405	S	S	.	.	S	Bend	trans	-77.1	0.4	-174.1	-170.9	0	0	0	0	114.6	L35	L35-S38 WeakPolarHBondContact O-CB 3.36Å; L35-S38 PolarHBondContact O-N 2.97Å; L35-S38 VanDerWaalsContact O-N 3.08Å
39	G	79.6	Confident	87.6	Confident	51 Å²	51	78 Å²	78	53%	0.526	43%	0.43	S	S	.	.	S	Bend	trans	92.1	-133.3	-179.3	0	0	0	0	0	113.6	D37 P41	D37-G39 PolarHBondContact O-N 3.09Å; G39-P41 WeakPolarHBondContact O-CD 3.45Å
40	D	83.6	Confident	87.1	Confident	82 Å²	82	85 Å²	85	44%	0.439	46%	0.455	S	S	.	.			trans	-72.5	118.5	-171.5	175.1	68.4	0	0	0	112.6	S42 T43	D40-S42 PolarHBondContact O-N 2.86Å; D40-S42 VanDerWaalsContact O-N 3.14Å; D40-S42 PolarHBondContact OD1-OG 2.76Å; D40-S42 VanDerWaalsContact OD1-OG 3.05Å; D40-S42 VanDerWaalsContact OD2-CA 3.24Å; D40-S42 WeakPolarHBondContact OD2-CA 3.25Å; D40-S42 WeakPolarHBondContact OD2-CB 3.27Å; D40-S42 PolarHBondContact OD2-N 3.31Å; D40-S42 PolarHBondContact OD2-OG 3.01Å; D40-T43 PolarHBondContact O-N 2.99Å; D40-T43 PolarHBondContact O-OG1 3.48Å; D40-T43 PolarHBondContact OD2-N 3.36Å
41	P	83.6	Confident	87	Confident	41 Å²	41	85.1 Å²	85.1	27%	0.266	46%	0.459	S	S	.	.	G	3₁₀ helix	trans	-66.1	-15.6	-179.3	26.2	-33.2	0	0	0	113.3	L2 R4 G39 T43 C44	L2-P41 HydrophobicContact CB-CB 4.3Å; L2-P41 HydrophobicContact CD1-CB 4.13Å; R4-P41 WeakPolarHBondContact CD-O 3.32Å; G39-P41 WeakPolarHBondContact O-CD 3.45Å; P41-T43 VanDerWaalsContact C-N 3.3Å; P41-T43 PolarHBondContact O-N 2.74Å; P41-C44 WeakPolarHBondContact O-CB 3.39Å; P41-C44 PolarHBondContact O-N 2.81Å
42	S	85.2	Confident	86.9	Confident	62 Å²	62	85 Å²	85	43%	0.434	46%	0.463	S	S	.	.	G	3₁₀ helix	trans	-72.9	-24.6	-178.4	-32.9	0	0	0	0	112.7	R4 D40 C44	R4-S42 PolarHBondContact NH1-O 3.33Å; D40-S42 PolarHBondContact O-N 2.86Å; D40-S42 VanDerWaalsContact O-N 3.14Å; D40-S42 PolarHBondContact OD1-OG 2.76Å; D40-S42 VanDerWaalsContact OD1-OG 3.05Å; D40-S42 VanDerWaalsContact OD2-CA 3.24Å; D40-S42 WeakPolarHBondContact OD2-CA 3.25Å; D40-S42 WeakPolarHBondContact OD2-CB 3.27Å; D40-S42 PolarHBondContact OD2-N 3.31Å; D40-S42 PolarHBondContact OD2-OG 3.01Å; S42-C44 VanDerWaalsContact C-N 3.33Å
43	T	88.7	Confident	86.9	Confident	116 Å²	116	88.7 Å²	88.7	71%	0.712	48%	0.481	S	S	*	.	G	3₁₀ helix	trans	-81.9	-11.4	174	65.6	0	0	0	0	113.7	D40 P41	D40-T43 PolarHBondContact O-N 2.99Å; D40-T43 PolarHBondContact O-OG1 3.48Å; D40-T43 PolarHBondContact OD2-N 3.36Å; P41-T43 VanDerWaalsContact C-N 3.3Å; P41-T43 PolarHBondContact O-N 2.74Å
44	C	89.4	Confident	86.9	Confident	6 Å²	6	86.5 Å²	86.5	4%	0.041	47%	0.466	C	S	.	.	S	Bend	trans	-83.1	136.4	-174	-60.4	0	0	0	0	111.7	T32 C34 P41 S42	T32-C44 HydrophobicContact CG2-CB 4.14Å; C34-C44 HydrophobicContact CB-CB 3.75Å; C34-C44 WeakPolarHBondContact CB-SG 2.99Å; C34-C44 WeakPolarHBondContact SG-CB 3.4Å; C34-C44 CovalentContact SG-SG 2.01Å; C34-C44 PolarHBondContact SG-SG 3.26Å; P41-C44 WeakPolarHBondContact O-CB 3.39Å; P41-C44 PolarHBondContact O-N 2.81Å; S42-C44 VanDerWaalsContact C-N 3.33Å
45	A	91.3	Very high	86.9	Confident	61 Å²	61	88.5 Å²	88.5	50%	0.504	47%	0.472	S	S	.	.	P	Polyproline II helix	trans	-70.8	147.5	169.8	0	0	0	0	0	110.2	T32 T33	T32-A45 CarbonylContact C-O 3.48Å; T32-A45 WeakPolarHBondContact CA-O 3.47Å; T32-A45 WeakPolarHBondContact CB-O 3.43Å; T33-A45 HydrophobicContact CG2-CB 4.41Å; T33-A45 PolarHBondContact N-O 3.17Å; T33-A45 PolarHBondContact OG1-O 2.95Å
46	F	92.1	Very high	87	Confident	80 Å²	80	83.4 Å²	83.4	35%	0.351	45%	0.446	S	S	.	.	B	Isolated β-bridge	trans	-71.3	140.7	173.2	-68	-69.9	0	0	0	110.9	R4 T6 Q30 T32	R4-F46 HydrophobicContact CB-CE1 3.91Å; R4-F46 HydrophobicContact CB-CZ 4.42Å; R4-F46 HydrophobicContact CG-CE1 4.27Å; R4-F46 HydrophobicContact CG-CZ 4.28Å; T6-F46 HydrophobicContact CG2-CE1 3.64Å; T6-F46 HydrophobicContact CG2-CZ 3.67Å; Q30-F46 HydrophobicContact CB-CD1 3.8Å; Q30-F46 HydrophobicContact CB-CE1 4.04Å; Q30-F46 HydrophobicContact CG-CB 4.49Å; Q30-F46 HydrophobicContact CG-CD1 3.89Å; Q30-F46 VanDerWaalsContact OE1-CD1 3.23Å; T32-F46 HydrophobicContact CG2-CD1 4.28Å
47	Q	90.3	Very high	87.4	Confident	55 Å²	55	76.3 Å²	76.3	26%	0.257	42%	0.423	S	S	.	.	P	Polyproline II helix	trans	-71	149.1	166.9	-82.7	179	-13.7	0	0	110	E31 T33 G49	E31-Q47 VanDerWaalsContact CG-OE1 3.24Å; E31-Q47 PolarHBondContact O-N 2.95Å; E31-Q47 PolarHBondContact OE2-OE1 3.22Å; T33-Q47 HydrophobicContact CG2-CG 3.75Å; Q47-G49 PolarHBondContact O-N 2.95Å
48	R	86.4	Confident	87.6	Confident	262 Å²	262	71.6 Å²	71.6	99%	0.989	40%	0.397	S	S	*	.	S	Bend	trans	-66.2	115.4	170	-78.8	-175.3	175.7	-175.5	-0.9	108.3
49	G	81.3	Confident	87.9	Confident	59 Å²	59	69.1 Å²	69.1	61%	0.608	38%	0.381	S	S	*	.	S	Bend	trans	175	-172.5	-177.1	0	0	0	0	0	112.6	Q30 Q47	Q30-G49 PolarHBondContact NE2-O 3.07Å; Q47-G49 PolarHBondContact O-N 2.95Å
50	Y	82.9	Confident	88.2	Confident	182 Å²	182	69.5 Å²	69.5	71%	0.714	37%	0.366	S	S	*	.	P	Polyproline II helix	trans	-86.2	141.3	-180	-177	-101.4	0	0	0	111.2	V52	Y50-V52 HydrophobicContact CD1-CG2 4.07Å; Y50-V52 HydrophobicContact CE1-CG2 4.16Å
51	S	89.5	Confident	88.1	Confident	35 Å²	35	67 Å²	67	25%	0.245	36%	0.355	C	S	.	.	P	Polyproline II helix	trans	-97.8	128.8	171	60.8	0	0	0	0	109.7	V29	V29-S51 WeakPolarHBondContact O-CA 3.32Å
52	V	90.6	Very high	87.7	Confident	64 Å²	64	69.7 Å²	69.7	39%	0.388	36%	0.364	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.9	125.8	178.3	-174.7	0	0	0	0	108.9	S28 V29 Y50 M54	S28-V52 CarbonylContact C-O 3.56Å; S28-V52 VanDerWaalsContact CA-O 3.26Å; S28-V52 WeakPolarHBondContact CA-O 3.23Å; V29-V52 HydrophobicContact CG2-CB 4.18Å; V29-V52 PolarHBondContact N-O 3.21Å; V29-V52 PolarHBondContact O-N 3.28Å; Y50-V52 HydrophobicContact CD1-CG2 4.07Å; Y50-V52 HydrophobicContact CE1-CG2 4.16Å; V52-M54 HydrophobicContact CB-SD 4.32Å; V52-M54 HydrophobicContact CG1-SD 3.69Å
53	M	91.9	Very high	87.2	Confident	78 Å²	78	77.2 Å²	77.2	38%	0.384	38%	0.383	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.1	132.8	171.8	-69.9	-172.3	-67.2	0	0	109.8	F76	M53-F76 HydrophobicContact CB-CB 3.93Å; M53-F76 HydrophobicContact CE-CD1 3.93Å; M53-F76 HydrophobicContact CE-CE1 4.43Å; M53-F76 WeakPolarHBondContact O-CB 3.41Å; M53-F76 PolarHBondContact O-N 2.91Å
54	M	90.7	Very high	86.2	Confident	32 Å²	32	80.1 Å²	80.1	16%	0.158	38%	0.381	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.3	145.9	-178	-51.6	-62.3	-81.4	0	0	109.1	E26 F27 V29 V52 S74 P75	E26-M54 WeakPolarHBondContact CA-O 3.29Å; F27-M54 HydrophobicContact CD2-CB 4.2Å; F27-M54 HydrophobicContact CE1-CB 4.18Å; F27-M54 HydrophobicContact CE2-CB 3.82Å; F27-M54 HydrophobicContact CE2-CG 4.18Å; F27-M54 HydrophobicContact CZ-CB 3.81Å; F27-M54 PolarHBondContact N-O 2.78Å; F27-M54 WeakPolarHBondContact O-CA 3.45Å; F27-M54 PolarHBondContact O-N 3.43Å; V29-M54 HydrophobicContact CG1-CG 4.14Å; V29-M54 HydrophobicContact CG2-CG 3.73Å; V29-M54 HydrophobicContact CG2-SD 4.2Å; V52-M54 HydrophobicContact CB-SD 4.32Å; V52-M54 HydrophobicContact CG1-SD 3.69Å; M54-S74 CarbonylContact C-O 3.55Å; M54-S74 VanDerWaalsContact CA-O 3.29Å; M54-S74 WeakPolarHBondContact CA-O 3.36Å; M54-P75 HydrophobicContact CE-CG 4.18Å; M54-P75 HydrophobicContact SD-CB 4.18Å; M54-P75 HydrophobicContact SD-CG 4.35Å
55	F	92.1	Very high	85.1	Confident	59 Å²	59	90.6 Å²	90.6	26%	0.259	42%	0.419	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.4	133.9	165.7	-79.4	-103	0	0	0	107.9	L25 E26 A73 S74 F76	L25-F55 CarbonylContact O-C 3.2Å; L25-F55 WeakPolarHBondContact O-CA 3.49Å; E26-F55 HydrophobicContact CB-CD1 4.39Å; E26-F55 HydrophobicContact CB-CE1 4.02Å; E26-F55 HydrophobicContact CB-CE2 4.46Å; E26-F55 HydrophobicContact CB-CZ 4.1Å; E26-F55 HydrophobicContact CG-CE1 4.19Å; E26-F55 HydrophobicContact CG-CE2 3.84Å; E26-F55 HydrophobicContact CG-CZ 3.74Å; E26-F55 WeakPolarHBondContact OE2-CZ 3.45Å; F55-A73 CarbonylContact O-C 3.56Å; F55-A73 VanDerWaalsContact O-CA 3.23Å; F55-A73 WeakPolarHBondContact O-CA 3.36Å; F55-S74 PolarHBondContact N-O 2.74Å; F55-S74 PolarHBondContact O-N 2.84Å; F55-F76 HydrophobicContact CD2-CB 3.88Å; F55-F76 AromaticContact CD2-CD2 3.47Å; F55-F76 HydrophobicContact CD2-CD2 3.47Å; F55-F76 VanDerWaalsContact CD2-CD2 3.47Å; F55-F76 HydrophobicContact CD2-CE2 4.32Å; F55-F76 HydrophobicContact CD2-CG 4.05Å; F55-F76 HydrophobicContact CE2-CB 3.83Å; F55-F76 AromaticContact CE2-CD2 2.92Å; F55-F76 HydrophobicContact CE2-CD2 2.92Å; F55-F76 AromaticContact CE2-CE2 3.46Å; F55-F76 HydrophobicContact CE2-CE2 3.46Å; F55-F76 VanDerWaalsContact CE2-CE2 3.46Å; F55-F76 AromaticContact CE2-CG 3.56Å; F55-F76 HydrophobicContact CE2-CG 3.56Å; F55-F76 HydrophobicContact CE2-CZ 4.49Å; F55-F76 AromaticContact CZ-CD2 3.69Å; F55-F76 HydrophobicContact CZ-CD2 3.69Å; F55-F76 AromaticContact CZ-CE2 3.73Å; F55-F76 HydrophobicContact CZ-CE2 3.73Å
56	G	90.7	Very high	83.9	Confident	3 Å²	3	92.9 Å²	92.9	3%	0.031	42%	0.423	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.7	155.3	176.9	0	0	0	0	0	113.4	L25 S72	L25-G56 PolarHBondContact N-O 2.8Å; L25-G56 PolarHBondContact O-N 2.85Å; G56-S72 CarbonylContact C-O 3.56Å; G56-S72 WeakPolarHBondContact CA-O 3.2Å
57	D	90.9	Very high	83.1	Confident	46 Å²	46	93.1 Å²	93.1	25%	0.246	43%	0.428	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.4	122.3	176.9	-62.1	-56.7	0	0	0	108.8	V22 N24 L70 E71 S72	V22-D57 HydrophobicContact CG1-CB 4.02Å; N24-D57 VanDerWaalsContact CG-OD1 3.25Å; N24-D57 PolarHBondContact ND2-OD1 2.79Å; D57-L70 CarbonylContact O-C 3.58Å; D57-E71 PolarHBondContact O-N 2.82Å; D57-S72 PolarHBondContact N-O 3.33Å; D57-S72 PolarHBondContact O-N 2.85Å; D57-S72 PolarHBondContact OD2-OG 2.83Å
58	M	88.6	Confident	82.7	Confident	60 Å²	60	95.7 Å²	95.7	30%	0.296	44%	0.436	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109	121.1	171.3	-83.2	-171.8	175	0	0	110.8	V22 M23 L25 L69 L70	V22-M58 CarbonylContact C-O 3.47Å; V22-M58 WeakPolarHBondContact CA-O 3.5Å; M23-M58 HydrophobicContact CE-CB 4.2Å; M23-M58 PolarHBondContact N-O 2.86Å; M23-M58 PolarHBondContact O-N 2.84Å; L25-M58 HydrophobicContact CD1-CB 3.73Å; L25-M58 HydrophobicContact CD1-CE 4.15Å; L25-M58 HydrophobicContact CD1-CG 3.43Å; L25-M58 VanDerWaalsContact CD1-CG 3.43Å; L25-M58 HydrophobicContact CD1-SD 3.25Å; L25-M58 WeakPolarHBondContact CD1-SD 3.26Å; M58-L69 CarbonylContact C-O 3.51Å; M58-L69 VanDerWaalsContact CA-O 3.27Å; M58-L69 WeakPolarHBondContact CA-O 3.01Å; M58-L70 HydrophobicContact CE-CB 4.37Å; M58-L70 HydrophobicContact CE-CD1 4.23Å; M58-L70 HydrophobicContact CG-CB 4.41Å; M58-L70 HydrophobicContact CG-CD1 3.89Å
59	A	87.3	Confident	82.4	Confident	18 Å²	18	89 Å²	89	15%	0.149	42%	0.419	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85	140.8	170	0	0	0	0	0	111.4	L21 V22 L69 E71	L21-A59 CarbonylContact O-C 3.51Å; L21-A59 WeakPolarHBondContact O-CA 3.44Å; V22-A59 HydrophobicContact CG2-CB 4.18Å; A59-L69 PolarHBondContact N-O 2.65Å; A59-L69 PolarHBondContact O-N 2.79Å; A59-L69 VanDerWaalsContact O-N 3.14Å; A59-E71 VanDerWaalsContact CB-CD 3.4Å; A59-E71 HydrophobicContact CB-CG 3.69Å; A59-E71 VanDerWaalsContact CB-OE2 3.32Å; A59-E71 WeakPolarHBondContact CB-OE2 3.36Å
60	R	84.9	Confident	82.5	Confident	59 Å²	59	90.4 Å²	90.4	22%	0.223	41%	0.412	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.7	127.9	164.6	-170.9	-164.8	-171	169.9	0.8	108.5	L21 N66 Y68	L21-R60 PolarHBondContact N-O 2.73Å; L21-R60 PolarHBondContact O-N 2.92Å; R60-N66 PolarHBondContact NH2-OD1 2.82Å; R60-Y68 HydrophobicContact CB-CD1 3.95Å; R60-Y68 HydrophobicContact CB-CE1 4.03Å; R60-Y68 VanDerWaalsContact CD-CE1 3.46Å; R60-Y68 HydrophobicContact CG-CD1 3.98Å; R60-Y68 HydrophobicContact CG-CE1 3.76Å; R60-Y68 PolarHBondContact NE-OH 2.95Å; R60-Y68 PolarHBondContact NH1-OH 3.34Å; R60-Y68 PolarHBondContact NH2-OH 2.86Å
61	S	81.9	Confident	82.5	Confident	28 Å²	28	87.7 Å²	87.7	20%	0.196	41%	0.406	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.1	125.8	171.2	-178.7	0	0	0	0	110.3	D19 R63 R64	D19-S61 CarbonylContact O-C 3.56Å; D19-S61 VanDerWaalsContact O-CA 3.25Å; D19-S61 WeakPolarHBondContact O-CA 3.28Å; S61-R63 PolarHBondContact O-N 2.89Å; S61-R63 PolarHBondContact OG-N 2.78Å; S61-R64 CarbonylContact O-C 3.57Å; S61-R64 WeakPolarHBondContact O-CA 3.42Å; S61-R64 PolarHBondContact O-N 2.68Å
62	H	74.1	Confident	82.1	Confident	99 Å²	99	88.1 Å²	88.1	46%	0.458	41%	0.409	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.2	-26.1	175.4	-78.7	-91.8	0	0	0	112.6	D19 R64	D19-H62 HydrophobicContact CB-CB 4.24Å; D19-H62 PolarHBondContact O-N 3.48Å; H62-R64 VanDerWaalsContact C-N 3.26Å; H62-R64 PolarHBondContact O-N 2.78Å
63	R	75.9	Confident	82	Confident	220 Å²	220	87.3 Å²	87.3	83%	0.83	41%	0.409	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.6	-27.7	171.3	-167	170.6	-177.1	166.7	1.6	112.7	S61	S61-R63 PolarHBondContact O-N 2.89Å; S61-R63 PolarHBondContact OG-N 2.78Å
64	R	67.8	Low	81.8	Confident	177 Å²	177	86.8 Å²	86.8	67%	0.668	41%	0.413	S	S	*	.	S	Bend	trans	-106.8	81.6	175.5	-64.4	-76.8	-173.1	152.9	1.2	108.1	S61 H62 N66 D67	S61-R64 CarbonylContact O-C 3.57Å; S61-R64 WeakPolarHBondContact O-CA 3.42Å; S61-R64 PolarHBondContact O-N 2.68Å; H62-R64 VanDerWaalsContact C-N 3.26Å; H62-R64 PolarHBondContact O-N 2.78Å; R64-N66 PolarHBondContact O-N 3.03Å; R64-D67 HydrophobicContact CB-CB 4.11Å; R64-D67 PolarHBondContact O-N 3.29Å; R64-D67 VanDerWaalsContact O-N 3.09Å
65	R	66.9	Low	81.6	Confident	226 Å²	226	88.7 Å²	88.7	85%	0.853	43%	0.428	S	S	*	.	T	Hydrogen-bonded Turn	trans	-40.7	110.6	-174.4	-82.4	-174.6	-80.1	-149	-5.4	112.4	D67	R65-D67 PolarHBondContact O-N 3Å
66	N	64.6	Low	81.1	Confident	108 Å²	108	90.1 Å²	90.1	58%	0.578	43%	0.434	S	S	*	.	T	Hydrogen-bonded Turn	trans	56.6	25	174.2	-66.3	-18.5	0	0	0	116.1	R60 R64 Y68	R60-N66 PolarHBondContact NH2-OD1 2.82Å; R64-N66 PolarHBondContact O-N 3.03Å; N66-Y68 WeakPolarHBondContact O-CD2 3.41Å
67	D	76.8	Confident	80	Confident	86 Å²	86	97.8 Å²	97.8	46%	0.46	47%	0.469	S	S	.	.			trans	-85	116.4	169.5	-71	-41.2	0	0	0	109.4	R64 R65	R64-D67 HydrophobicContact CB-CB 4.11Å; R64-D67 PolarHBondContact O-N 3.29Å; R64-D67 VanDerWaalsContact O-N 3.09Å; R65-D67 PolarHBondContact O-N 3Å
68	Y	81	Confident	78.6	Confident	108 Å²	108	103.9 Å²	103.9	42%	0.424	51%	0.511	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.8	117.9	172.2	-60.2	-90.6	0	0	0	108.2	M23 R60 N66	M23-Y68 HydrophobicContact CE-CD1 3.56Å; M23-Y68 HydrophobicContact CE-CE1 3.68Å; R60-Y68 HydrophobicContact CB-CD1 3.95Å; R60-Y68 HydrophobicContact CB-CE1 4.03Å; R60-Y68 VanDerWaalsContact CD-CE1 3.46Å; R60-Y68 HydrophobicContact CG-CD1 3.98Å; R60-Y68 HydrophobicContact CG-CE1 3.76Å; R60-Y68 PolarHBondContact NE-OH 2.95Å; R60-Y68 PolarHBondContact NH1-OH 3.34Å; R60-Y68 PolarHBondContact NH2-OH 2.86Å; N66-Y68 WeakPolarHBondContact O-CD2 3.41Å
69	L	80.6	Confident	78	Confident	123 Å²	123	106.1 Å²	106.1	64%	0.644	52%	0.522	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-120.4	134.2	179	-63.9	176.6	0	0	0	109.5	M58 A59 E71	M58-L69 CarbonylContact C-O 3.51Å; M58-L69 VanDerWaalsContact CA-O 3.27Å; M58-L69 WeakPolarHBondContact CA-O 3.01Å; A59-L69 PolarHBondContact N-O 2.65Å; A59-L69 PolarHBondContact O-N 2.79Å; A59-L69 VanDerWaalsContact O-N 3.14Å; L69-E71 PolarHBondContact O-N 2.79Å
70	L	83.3	Confident	77.6	Confident	87 Å²	87	110.7 Å²	110.7	46%	0.455	54%	0.541	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.6	108.5	170.3	-172.5	69.3	0	0	0	108	D57 M58 S72 A73	D57-L70 CarbonylContact O-C 3.58Å; M58-L70 HydrophobicContact CE-CB 4.37Å; M58-L70 HydrophobicContact CE-CD1 4.23Å; M58-L70 HydrophobicContact CG-CB 4.41Å; M58-L70 HydrophobicContact CG-CD1 3.89Å; L70-S72 WeakPolarHBondContact CD1-O 3.28Å; L70-A73 HydrophobicContact CD1-CB 4.46Å; L70-A73 HydrophobicContact CD2-CB 3.95Å; L70-A73 HydrophobicContact CG-CB 4.4Å
71	E	81.8	Confident	77.2	Confident	126 Å²	126	113.6 Å²	113.6	59%	0.589	56%	0.559	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-80.1	-38.9	179.6	-67.4	-165.9	105.5	0	0	111.5	V22 D57 A59 L69	V22-E71 WeakPolarHBondContact CG2-OE2 3.01Å; D57-E71 PolarHBondContact O-N 2.82Å; A59-E71 VanDerWaalsContact CB-CD 3.4Å; A59-E71 HydrophobicContact CB-CG 3.69Å; A59-E71 VanDerWaalsContact CB-OE2 3.32Å; A59-E71 WeakPolarHBondContact CB-OE2 3.36Å; L69-E71 PolarHBondContact O-N 2.79Å
72	S	82.3	Confident	76.9	Confident	44 Å²	44	118.6 Å²	118.6	31%	0.308	58%	0.581	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-147	147.3	-178	97.3	0	0	0	0	110.1	G56 D57 L70	G56-S72 CarbonylContact C-O 3.56Å; G56-S72 WeakPolarHBondContact CA-O 3.2Å; D57-S72 PolarHBondContact N-O 3.33Å; D57-S72 PolarHBondContact O-N 2.85Å; D57-S72 PolarHBondContact OD2-OG 2.83Å; L70-S72 WeakPolarHBondContact CD1-O 3.28Å
73	A	87.1	Confident	77	Confident	47 Å²	47	119.9 Å²	119.9	39%	0.388	59%	0.588	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-148.2	132	166.4	0	0	0	0	0	110.9	F27 F55 L70	F27-A73 HydrophobicContact CZ-CB 4.18Å; F55-A73 CarbonylContact O-C 3.56Å; F55-A73 VanDerWaalsContact O-CA 3.23Å; F55-A73 WeakPolarHBondContact O-CA 3.36Å; L70-A73 HydrophobicContact CD1-CB 4.46Å; L70-A73 HydrophobicContact CD2-CB 3.95Å; L70-A73 HydrophobicContact CG-CB 4.4Å
74	S	88.1	Confident	77.1	Confident	67 Å²	67	113.2 Å²	113.2	47%	0.469	57%	0.572	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-128.8	144.1	-178.4	-61.4	0	0	0	0	110.6	M54 F55	M54-S74 CarbonylContact C-O 3.55Å; M54-S74 VanDerWaalsContact CA-O 3.29Å; M54-S74 WeakPolarHBondContact CA-O 3.36Å; F55-S74 PolarHBondContact N-O 2.74Å; F55-S74 PolarHBondContact O-N 2.84Å
75	P	87.3	Confident	77.8	Confident	71 Å²	71	108.6 Å²	108.6	46%	0.461	57%	0.565	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-58.8	140.1	168.8	-16.7	29	0	0	0	110.4	M54 H77	M54-P75 HydrophobicContact CE-CG 4.18Å; M54-P75 HydrophobicContact SD-CB 4.18Å; M54-P75 HydrophobicContact SD-CG 4.35Å; P75-H77 PolarHBondContact O-N 2.79Å
76	F	80.8	Confident	78.6	Confident	90 Å²	90	99.6 Å²	99.6	40%	0.395	54%	0.543	S	S	.	.			trans	-66.8	121.6	170.9	-174.6	-118.9	0	0	0	109.9	M53 F55 P78	M53-F76 HydrophobicContact CB-CB 3.93Å; M53-F76 HydrophobicContact CE-CD1 3.93Å; M53-F76 HydrophobicContact CE-CE1 4.43Å; M53-F76 WeakPolarHBondContact O-CB 3.41Å; M53-F76 PolarHBondContact O-N 2.91Å; F55-F76 HydrophobicContact CD2-CB 3.88Å; F55-F76 AromaticContact CD2-CD2 3.47Å; F55-F76 HydrophobicContact CD2-CD2 3.47Å; F55-F76 VanDerWaalsContact CD2-CD2 3.47Å; F55-F76 HydrophobicContact CD2-CE2 4.32Å; F55-F76 HydrophobicContact CD2-CG 4.05Å; F55-F76 HydrophobicContact CE2-CB 3.83Å; F55-F76 AromaticContact CE2-CD2 2.92Å; F55-F76 HydrophobicContact CE2-CD2 2.92Å; F55-F76 AromaticContact CE2-CE2 3.46Å; F55-F76 HydrophobicContact CE2-CE2 3.46Å; F55-F76 VanDerWaalsContact CE2-CE2 3.46Å; F55-F76 AromaticContact CE2-CG 3.56Å; F55-F76 HydrophobicContact CE2-CG 3.56Å; F55-F76 HydrophobicContact CE2-CZ 4.49Å; F55-F76 AromaticContact CZ-CD2 3.69Å; F55-F76 HydrophobicContact CZ-CD2 3.69Å; F55-F76 AromaticContact CZ-CE2 3.73Å; F55-F76 HydrophobicContact CZ-CE2 3.73Å; F76-P78 HydrophobicContact CE1-CB 4.47Å
77	H	68.6	Low	79.8	Confident	163 Å²	163	98.9 Å²	98.9	76%	0.755	54%	0.54	S	S	*	.			trans	-105.7	124.1	165.4	-80	122.4	0	0	0	108.5	P75	P75-H77 PolarHBondContact O-N 2.79Å
78	P	59.9	Low	80.1	Confident	175 Å²	175	100.1 Å²	100.1	100%	1.136	55%	0.548	S	S	*	.			trans	-68.4	0	178.4	29.9	-34.8	0	0	0	113.1	F76	F76-P78 HydrophobicContact CE1-CB 4.47Å

Retrieved 78 of 78 residues in 141.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).