A0A087WSJ3_MOUSE Loading...

RIKEN cDNA 2510002D24 gene

AlphaFold DB , UniProt , Accession A0A087WSJ3, Species MOUSE (Mus musculus, Mouse), Gene 2510002D24Rik, Length 49 aa.

						>A0A087WSJ3_MOUSE|A0A087WSJ3|2510002D24Rik
MAVAGSWQRSLCESEQVRVQAAQKHTLVWALRQRPPTDWNLPLPQEKDK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	40.7	Very low	71.8	Confident	237 Å²	237	116.8 Å²	116.8	100%	1.167	64%	0.641	S	S	*	*				0	106.3	0	-66.9	-168.9	-71.2	0	0	107.6	V3	M1-V3 PolarHBondContact O-N 3.43Å
2	A	53.8	Low	73.4	Confident	107 Å²	107	114.5 Å²	114.5	88%	0.884	64%	0.638	S	S	*	*			trans	-72.2	108.2	178.1	0	0	0	0	0	108.2	A4	A2-A4 PolarHBondContact O-N 3.46Å
3	V	60.5	Low	75	Confident	124 Å²	124	114.8 Å²	114.8	75%	0.752	63%	0.632	S	S	*	*			trans	-66.4	104.6	166.8	170.4	0	0	0	0	105.6	M1 G5	M1-V3 PolarHBondContact O-N 3.43Å; V3-G5 PolarHBondContact O-N 3Å
4	A	57.9	Low	76.2	Confident	44 Å²	44	111.5 Å²	111.5	36%	0.364	62%	0.621	S	S	.	*			trans	-54.1	117	174.3	0	0	0	0	0	108.3	A2 Q8 R9	A2-A4 PolarHBondContact O-N 3.46Å; A4-Q8 HydrophobicContact CB-CB 3.92Å; A4-Q8 HydrophobicContact CB-CG 4.44Å; A4-Q8 VanDerWaalsContact CB-OE1 3.26Å; A4-R9 PolarHBondContact O-NH2 2.94Å
5	G	69.6	Low	77.2	Confident	34 Å²	34	110 Å²	110	35%	0.351	61%	0.607	S	S	.	*			trans	-58.2	156.5	179.8	0	0	0	0	0	110.8	V3 W7 Q8	V3-G5 PolarHBondContact O-N 3Å; G5-W7 PolarHBondContact O-N 3Å; G5-Q8 PolarHBondContact O-N 3.5Å
6	S	74.4	Confident	78.1	Confident	77 Å²	77	110.6 Å²	110.6	54%	0.538	60%	0.604	S	S	.	*	H	α-helix	trans	-42.1	-38.1	-176.8	47.8	0	0	0	0	114.3	Q8 R9 S10	S6-Q8 PolarHBondContact O-N 3.25Å; S6-R9 WeakPolarHBondContact O-CB 3.43Å; S6-R9 PolarHBondContact O-N 3.02Å; S6-R9 VanDerWaalsContact O-N 3.16Å; S6-S10 PolarHBondContact O-N 3.19Å; S6-S10 PolarHBondContact O-OG 2.9Å
7	W	79.3	Confident	78.8	Confident	214 Å²	214	109.6 Å²	109.6	81%	0.811	60%	0.602	S	S	*	*	H	α-helix	trans	-58	-39.8	177	-68.7	105	0	0	0	115	G5 R9 S10 L11	G5-W7 PolarHBondContact O-N 3Å; W7-R9 VanDerWaalsContact C-N 3.31Å; W7-S10 PolarHBondContact O-N 3.46Å; W7-L11 WeakPolarHBondContact O-CB 3.32Å; W7-L11 PolarHBondContact O-N 3.03Å
8	Q	86.4	Confident	79.1	Confident	111 Å²	111	112.4 Å²	112.4	52%	0.519	60%	0.602	S	S	.	*	H	α-helix	trans	-69.8	-33.4	178.8	-73.1	147.6	-39	0	0	111.2	A4 G5 S6 C12	A4-Q8 HydrophobicContact CB-CB 3.92Å; A4-Q8 HydrophobicContact CB-CG 4.44Å; A4-Q8 VanDerWaalsContact CB-OE1 3.26Å; G5-Q8 PolarHBondContact O-N 3.5Å; S6-Q8 PolarHBondContact O-N 3.25Å; Q8-C12 PolarHBondContact O-N 3.05Å; Q8-C12 VanDerWaalsContact O-N 3.09Å
9	R	88.3	Confident	79.3	Confident	142 Å²	142	109.9 Å²	109.9	54%	0.536	59%	0.591	S	S	.	*	H	α-helix	trans	-68.5	-48	172.4	-86.1	177.9	-93	171.2	-7.9	111.6	A4 S6 W7 L11 C12 E13	A4-R9 PolarHBondContact O-NH2 2.94Å; S6-R9 WeakPolarHBondContact O-CB 3.43Å; S6-R9 PolarHBondContact O-N 3.02Å; S6-R9 VanDerWaalsContact O-N 3.16Å; W7-R9 VanDerWaalsContact C-N 3.31Å; R9-L11 VanDerWaalsContact C-N 3.28Å; R9-L11 PolarHBondContact O-N 3.12Å; R9-C12 WeakPolarHBondContact O-CB 2.97Å; R9-C12 PolarHBondContact O-N 3.14Å; R9-C12 VanDerWaalsContact O-N 3.15Å; R9-E13 WeakPolarHBondContact O-CG 3.26Å; R9-E13 PolarHBondContact O-N 3.39Å
10	S	89.8	Confident	79.5	Confident	65 Å²	65	109.9 Å²	109.9	46%	0.455	59%	0.587	S	S	.	*	H	α-helix	trans	-60.7	-36.8	177	-57.9	0	0	0	0	112.7	S6 W7 S14	S6-S10 PolarHBondContact O-N 3.19Å; S6-S10 PolarHBondContact O-OG 2.9Å; W7-S10 PolarHBondContact O-N 3.46Å; S10-S14 VanDerWaalsContact O-CB 3.32Å; S10-S14 WeakPolarHBondContact O-CB 3.32Å; S10-S14 PolarHBondContact O-N 3.25Å
11	L	88.8	Confident	79.6	Confident	130 Å²	130	107 Å²	107	68%	0.681	58%	0.578	S	S	*	*	H	α-helix	trans	-64.3	-48.2	173.7	-170.1	84.6	0	0	0	111.4	W7 R9 E13 S14 E15	W7-L11 WeakPolarHBondContact O-CB 3.32Å; W7-L11 PolarHBondContact O-N 3.03Å; R9-L11 VanDerWaalsContact C-N 3.28Å; R9-L11 PolarHBondContact O-N 3.12Å; L11-E13 PolarHBondContact O-N 3.05Å; L11-S14 PolarHBondContact O-N 3.35Å; L11-E15 WeakPolarHBondContact O-CB 3.21Å; L11-E15 PolarHBondContact O-N 3.38Å
12	C	91.8	Very high	81.1	Confident	89 Å²	89	98.2 Å²	98.2	60%	0.601	54%	0.544	S	S	*	.	H	α-helix	trans	-59.2	-46.1	177.3	-101.8	0	0	0	0	112.1	Q8 R9 E15 Q16	Q8-C12 PolarHBondContact O-N 3.05Å; Q8-C12 VanDerWaalsContact O-N 3.09Å; R9-C12 WeakPolarHBondContact O-CB 2.97Å; R9-C12 PolarHBondContact O-N 3.14Å; R9-C12 VanDerWaalsContact O-N 3.15Å; C12-E15 PolarHBondContact O-N 2.73Å; C12-Q16 WeakPolarHBondContact O-CB 3.02Å; C12-Q16 PolarHBondContact O-N 3.35Å
13	E	93.6	Very high	81.9	Confident	119 Å²	119	99 Å²	99	56%	0.556	53%	0.529	S	S	*	.	H	α-helix	trans	-63.6	-45.1	179.4	-72.8	168.2	-172.7	0	0	111.4	R9 L11 E15 Q16 V17	R9-E13 WeakPolarHBondContact O-CG 3.26Å; R9-E13 PolarHBondContact O-N 3.39Å; L11-E13 PolarHBondContact O-N 3.05Å; E13-E15 VanDerWaalsContact C-N 3.35Å; E13-E15 PolarHBondContact O-N 3.08Å; E13-Q16 PolarHBondContact O-N 2.95Å; E13-V17 WeakPolarHBondContact O-CG2 3.32Å; E13-V17 PolarHBondContact O-N 3.28Å
14	S	91.6	Very high	82.2	Confident	68 Å²	68	101.6 Å²	101.6	48%	0.476	53%	0.53	S	S	.	.	H	α-helix	trans	-60.5	-44.4	176.2	-175.6	0	0	0	0	111.8	S10 L11 V17 R18	S10-S14 VanDerWaalsContact O-CB 3.32Å; S10-S14 WeakPolarHBondContact O-CB 3.32Å; S10-S14 PolarHBondContact O-N 3.25Å; L11-S14 PolarHBondContact O-N 3.35Å; S14-V17 PolarHBondContact O-N 3.14Å; S14-R18 WeakPolarHBondContact O-CG 3.45Å; S14-R18 PolarHBondContact O-N 3.31Å
15	E	92.3	Very high	82.5	Confident	89 Å²	89	105.2 Å²	105.2	42%	0.416	54%	0.539	S	S	.	.	H	α-helix	trans	-68	-38.9	179.8	-167.3	60.5	-165.7	0	0	111.8	L11 C12 E13 V17 R18 V19	L11-E15 WeakPolarHBondContact O-CB 3.21Å; L11-E15 PolarHBondContact O-N 3.38Å; C12-E15 PolarHBondContact O-N 2.73Å; E13-E15 VanDerWaalsContact C-N 3.35Å; E13-E15 PolarHBondContact O-N 3.08Å; E15-V17 VanDerWaalsContact C-N 3.32Å; E15-V17 PolarHBondContact O-N 3.23Å; E15-R18 PolarHBondContact O-N 3.4Å; E15-R18 IonicContact OE1-NH1 3.69Å; E15-R18 IonicContact OE2-CZ 3.64Å; E15-R18 IonicContact OE2-NE 3.98Å; E15-R18 IonicContact OE2-NH1 2.72Å; E15-R18 PolarHBondContact OE2-NH1 3.03Å; E15-V19 WeakPolarHBondContact O-CG2 3.07Å; E15-V19 PolarHBondContact O-N 3.17Å
16	Q	90.2	Very high	82	Confident	119 Å²	119	106.7 Å²	106.7	56%	0.556	54%	0.542	S	S	*	.	H	α-helix	trans	-61.4	-41.3	175.7	-168.2	173.5	12.8	0	0	111.6	C12 E13 V19 Q20	C12-Q16 WeakPolarHBondContact O-CB 3.02Å; C12-Q16 PolarHBondContact O-N 3.35Å; E13-Q16 PolarHBondContact O-N 2.95Å; Q16-V19 PolarHBondContact O-N 3.41Å; Q16-Q20 WeakPolarHBondContact O-CB 3.25Å; Q16-Q20 WeakPolarHBondContact O-CG 3.36Å; Q16-Q20 PolarHBondContact O-N 3.49Å
17	V	91.1	Very high	81.4	Confident	94 Å²	94	109.7 Å²	109.7	57%	0.57	55%	0.551	S	S	*	*	H	α-helix	trans	-63.6	-43.8	174.7	171.1	0	0	0	0	111.2	E13 S14 E15 Q20 A21	E13-V17 WeakPolarHBondContact O-CG2 3.32Å; E13-V17 PolarHBondContact O-N 3.28Å; S14-V17 PolarHBondContact O-N 3.14Å; E15-V17 VanDerWaalsContact C-N 3.32Å; E15-V17 PolarHBondContact O-N 3.23Å; V17-Q20 PolarHBondContact O-N 3.34Å; V17-A21 WeakPolarHBondContact O-CB 3.2Å; V17-A21 PolarHBondContact O-N 2.92Å
18	R	84.6	Confident	80.6	Confident	160 Å²	160	102.6 Å²	102.6	60%	0.604	53%	0.531	S	S	*	.	H	α-helix	trans	-61.3	-45	176.7	-73	177.2	66.8	-149.6	3.8	111.9	S14 E15 A21 A22	S14-R18 WeakPolarHBondContact O-CG 3.45Å; S14-R18 PolarHBondContact O-N 3.31Å; E15-R18 PolarHBondContact O-N 3.4Å; E15-R18 IonicContact OE1-NH1 3.69Å; E15-R18 IonicContact OE2-CZ 3.64Å; E15-R18 IonicContact OE2-NE 3.98Å; E15-R18 IonicContact OE2-NH1 2.72Å; E15-R18 PolarHBondContact OE2-NH1 3.03Å; R18-A21 PolarHBondContact O-N 3.4Å; R18-A22 WeakPolarHBondContact O-CB 3.37Å; R18-A22 PolarHBondContact O-N 2.72Å
19	V	82.8	Confident	79.3	Confident	66 Å²	66	105.8 Å²	105.8	40%	0.4	54%	0.539	S	S	.	.	H	α-helix	trans	-64.2	-43.6	178.3	169.8	0	0	0	0	111.1	E15 Q16 A21 A22 Q23	E15-V19 WeakPolarHBondContact O-CG2 3.07Å; E15-V19 PolarHBondContact O-N 3.17Å; Q16-V19 PolarHBondContact O-N 3.41Å; V19-A21 PolarHBondContact O-N 2.95Å; V19-A22 PolarHBondContact O-N 3.2Å; V19-Q23 WeakPolarHBondContact O-CB 3.32Å; V19-Q23 WeakPolarHBondContact O-CG 3.48Å; V19-Q23 PolarHBondContact O-N 2.88Å
20	Q	83.1	Confident	78.1	Confident	109 Å²	109	101.2 Å²	101.2	51%	0.509	53%	0.531	S	S	.	.	H	α-helix	trans	-64.6	-38.3	175.8	-74.4	-179.1	-4.9	0	0	112.6	Q16 V17 Q23 K24	Q16-Q20 WeakPolarHBondContact O-CB 3.25Å; Q16-Q20 WeakPolarHBondContact O-CG 3.36Å; Q16-Q20 PolarHBondContact O-N 3.49Å; V17-Q20 PolarHBondContact O-N 3.34Å; Q20-Q23 WeakPolarHBondContact O-CB 3.49Å; Q20-Q23 PolarHBondContact O-N 3.35Å; Q20-K24 PolarHBondContact O-N 3.44Å
21	A	80.4	Confident	76.8	Confident	48 Å²	48	105.1 Å²	105.1	40%	0.397	55%	0.546	S	S	.	.	H	α-helix	trans	-66.8	-42.4	174.8	0	0	0	0	0	111.8	V17 R18 V19 Q23 K24	V17-A21 WeakPolarHBondContact O-CB 3.2Å; V17-A21 PolarHBondContact O-N 2.92Å; R18-A21 PolarHBondContact O-N 3.4Å; V19-A21 PolarHBondContact O-N 2.95Å; A21-Q23 VanDerWaalsContact C-N 3.27Å; A21-Q23 PolarHBondContact O-N 3.44Å; A21-K24 WeakPolarHBondContact O-CB 3.25Å; A21-K24 PolarHBondContact O-N 3.42Å
22	A	73.8	Confident	75.7	Confident	54 Å²	54	106.4 Å²	106.4	45%	0.446	54%	0.542	S	S	.	.	H	α-helix	trans	-63.2	-35	173.9	0	0	0	0	0	111.7	R18 V19 K24 H25 T26	R18-A22 WeakPolarHBondContact O-CB 3.37Å; R18-A22 PolarHBondContact O-N 2.72Å; V19-A22 PolarHBondContact O-N 3.2Å; A22-K24 PolarHBondContact O-N 2.85Å; A22-H25 CarbonylContact O-C 3.5Å; A22-H25 WeakPolarHBondContact O-CA 3.46Å; A22-H25 PolarHBondContact O-N 3.35Å; A22-T26 PolarHBondContact O-N 3.09Å; A22-T26 PolarHBondContact O-OG1 3.48Å
23	Q	68.9	Low	74.5	Confident	124 Å²	124	109.9 Å²	109.9	58%	0.579	55%	0.549	S	S	*	.	H	α-helix	trans	-58.6	-34.2	175.9	-80.8	178.6	26.7	0	0	113.4	V19 Q20 A21 H25 T26	V19-Q23 WeakPolarHBondContact O-CB 3.32Å; V19-Q23 WeakPolarHBondContact O-CG 3.48Å; V19-Q23 PolarHBondContact O-N 2.88Å; Q20-Q23 WeakPolarHBondContact O-CB 3.49Å; Q20-Q23 PolarHBondContact O-N 3.35Å; A21-Q23 VanDerWaalsContact C-N 3.27Å; A21-Q23 PolarHBondContact O-N 3.44Å; Q23-H25 PolarHBondContact O-N 2.87Å; Q23-T26 WeakPolarHBondContact CA-OG1 3.35Å; Q23-T26 VanDerWaalsContact O-CB 3.25Å; Q23-T26 WeakPolarHBondContact O-CB 3.41Å; Q23-T26 PolarHBondContact O-N 3.25Å; Q23-T26 VanDerWaalsContact O-N 3.14Å; Q23-T26 PolarHBondContact O-OG1 2.9Å
24	K	67.1	Low	73.3	Confident	178 Å²	178	114.5 Å²	114.5	77%	0.774	56%	0.561	S	S	*	*	H	α-helix	trans	-64.6	-26.5	174.8	-63.5	178.5	-179.6	178.9	0	112.9	Q20 A21 A22	Q20-K24 PolarHBondContact O-N 3.44Å; A21-K24 WeakPolarHBondContact O-CB 3.25Å; A21-K24 PolarHBondContact O-N 3.42Å; A22-K24 PolarHBondContact O-N 2.85Å
25	H	64	Low	72.4	Confident	119 Å²	119	115.4 Å²	115.4	55%	0.551	57%	0.565	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.1	7.2	176.8	-61.5	-73	0	0	0	112.9	A22 Q23 L27 V28 W29	A22-H25 CarbonylContact O-C 3.5Å; A22-H25 WeakPolarHBondContact O-CA 3.46Å; A22-H25 PolarHBondContact O-N 3.35Å; Q23-H25 PolarHBondContact O-N 2.87Å; H25-L27 PolarHBondContact O-N 2.89Å; H25-V28 PolarHBondContact O-N 3.38Å; H25-V28 VanDerWaalsContact O-N 3.08Å; H25-W29 PolarHBondContact O-N 3.15Å
26	T	60.3	Low	71.7	Confident	65 Å²	65	114.5 Å²	114.5	40%	0.399	57%	0.568	S	S	.	*	H	α-helix	trans	-56.6	-34	-177.1	-75.5	0	0	0	0	112.5	A22 Q23 V28 W29 A30	A22-T26 PolarHBondContact O-N 3.09Å; A22-T26 PolarHBondContact O-OG1 3.48Å; Q23-T26 WeakPolarHBondContact CA-OG1 3.35Å; Q23-T26 VanDerWaalsContact O-CB 3.25Å; Q23-T26 WeakPolarHBondContact O-CB 3.41Å; Q23-T26 PolarHBondContact O-N 3.25Å; Q23-T26 VanDerWaalsContact O-N 3.14Å; Q23-T26 PolarHBondContact O-OG1 2.9Å; T26-V28 VanDerWaalsContact C-N 3.32Å; T26-V28 PolarHBondContact O-N 3.39Å; T26-W29 PolarHBondContact O-N 2.89Å; T26-A30 HydrophobicContact CG2-CB 4.2Å; T26-A30 WeakPolarHBondContact O-CA 3.41Å; T26-A30 WeakPolarHBondContact O-CB 3.32Å; T26-A30 PolarHBondContact O-N 2.95Å
27	L	60.8	Low	71.2	Confident	140 Å²	140	115.5 Å²	115.5	73%	0.733	58%	0.582	S	S	*	*	H	α-helix	trans	-61.1	-43.1	178.9	-65.9	176.7	0	0	0	111.6	H25 L31	H25-L27 PolarHBondContact O-N 2.89Å; L27-L31 VanDerWaalsContact O-CB 3.26Å; L27-L31 WeakPolarHBondContact O-CB 3.33Å; L27-L31 VanDerWaalsContact O-CD1 3.25Å; L27-L31 WeakPolarHBondContact O-CD1 3.44Å; L27-L31 WeakPolarHBondContact O-CG 3.49Å; L27-L31 PolarHBondContact O-N 3.34Å
28	V	64	Low	70.7	Confident	65 Å²	65	115.9 Å²	115.9	39%	0.394	58%	0.581	S	S	.	*	H	α-helix	trans	-69.7	-40.1	180	178.1	0	0	0	0	111.4	H25 T26 R32	H25-V28 PolarHBondContact O-N 3.38Å; H25-V28 VanDerWaalsContact O-N 3.08Å; T26-V28 VanDerWaalsContact C-N 3.32Å; T26-V28 PolarHBondContact O-N 3.39Å; V28-R32 WeakPolarHBondContact O-CD 3.37Å; V28-R32 WeakPolarHBondContact O-CG 3.35Å; V28-R32 PolarHBondContact O-N 3.35Å
29	W	58.3	Low	70.6	Confident	179 Å²	179	117 Å²	117	68%	0.678	59%	0.585	S	S	*	*	H	α-helix	trans	-77.9	-36.1	-179.7	-78.6	102.8	0	0	0	113.4	H25 T26 R32	H25-W29 PolarHBondContact O-N 3.15Å; T26-W29 PolarHBondContact O-N 2.89Å; W29-R32 CarbonylContact O-C 3.39Å; W29-R32 PolarHBondContact O-N 3.46Å; W29-R32 VanDerWaalsContact O-N 3.14Å
30	A	62.9	Low	70.6	Confident	45 Å²	45	120.7 Å²	120.7	37%	0.372	60%	0.603	S	S	.	*	H	α-helix	trans	-68.5	-35.9	174.5	0	0	0	0	0	111.9	T26 R32 Q33	T26-A30 HydrophobicContact CG2-CB 4.2Å; T26-A30 WeakPolarHBondContact O-CA 3.41Å; T26-A30 WeakPolarHBondContact O-CB 3.32Å; T26-A30 PolarHBondContact O-N 2.95Å; A30-R32 PolarHBondContact O-N 3.4Å; A30-Q33 WeakPolarHBondContact O-CG 3.46Å; A30-Q33 PolarHBondContact O-N 3.04Å
31	L	63.2	Low	70.7	Confident	147 Å²	147	121.2 Å²	121.2	77%	0.77	61%	0.608	S	S	*	*	H	α-helix	trans	-65.7	-23.9	171.2	-73.9	168	0	0	0	112.4	L27	L27-L31 VanDerWaalsContact O-CB 3.26Å; L27-L31 WeakPolarHBondContact O-CB 3.33Å; L27-L31 VanDerWaalsContact O-CD1 3.25Å; L27-L31 WeakPolarHBondContact O-CD1 3.44Å; L27-L31 WeakPolarHBondContact O-CG 3.49Å; L27-L31 PolarHBondContact O-N 3.34Å
32	R	65.4	Low	70.9	Confident	158 Å²	158	124.4 Å²	124.4	60%	0.596	63%	0.625	S	S	*	*	T	Hydrogen-bonded Turn	trans	-97.4	24	-179	-69.8	173.6	180	163.6	1	113.7	V28 W29 A30 R34	V28-R32 WeakPolarHBondContact O-CD 3.37Å; V28-R32 WeakPolarHBondContact O-CG 3.35Å; V28-R32 PolarHBondContact O-N 3.35Å; W29-R32 CarbonylContact O-C 3.39Å; W29-R32 PolarHBondContact O-N 3.46Å; W29-R32 VanDerWaalsContact O-N 3.14Å; A30-R32 PolarHBondContact O-N 3.4Å; R32-R34 PolarHBondContact O-N 2.99Å
33	Q	66.8	Low	71.3	Confident	162 Å²	162	129.4 Å²	129.4	76%	0.757	64%	0.644	S	S	*	*	S	Bend	trans	-61.2	-21.3	171.9	-77.4	-179.9	29.7	0	0	113.1	A30	A30-Q33 WeakPolarHBondContact O-CG 3.46Å; A30-Q33 PolarHBondContact O-N 3.04Å
34	R	68.1	Low	71.9	Confident	216 Å²	216	129.3 Å²	129.3	82%	0.815	65%	0.654	S	S	*	*	S	Bend	trans	-128.6	127.3	173.5	-66.4	-178.8	177.4	164.3	-0.6	109.4	R32	R32-R34 PolarHBondContact O-N 2.99Å
35	P	72	Confident	72.4	Confident	86 Å²	86	129.4 Å²	129.4	56%	0.558	66%	0.657	S	S	*	*			trans	-63.6	143	168.9	27.8	-32.2	0	0	0	109.1	T37 W39	P35-T37 PolarHBondContact O-N 3.02Å; P35-W39 HydrophobicContact CB-CB 4.44Å; P35-W39 HydrophobicContact CB-CD2 4.24Å; P35-W39 HydrophobicContact CB-CE3 3.68Å; P35-W39 HydrophobicContact CB-CZ3 4.28Å
36	P	79	Confident	72.8	Confident	71 Å²	71	132.2 Å²	132.2	46%	0.461	67%	0.67	S	S	.	*			trans	-44.1	138.6	164.1	-28.8	24.5	0	0	0	112.5	D38 W39	P36-D38 WeakPolarHBondContact CB-OD1 3.32Å; P36-D38 PolarHBondContact O-N 2.92Å; P36-D38 VanDerWaalsContact O-N 3.12Å; P36-W39 HydrophobicContact CG-CE3 4.23Å; P36-W39 WeakPolarHBondContact O-CB 3.46Å; P36-W39 PolarHBondContact O-N 3.01Å
37	T	78.4	Confident	73	Confident	139 Å²	139	138.4 Å²	138.4	85%	0.853	69%	0.691	S	S	*	*	G	3₁₀ helix	trans	-58	-28.6	-177.1	-50.9	0	0	0	0	112.3	P35	P35-T37 PolarHBondContact O-N 3.02Å
38	D	81.7	Confident	73.2	Confident	103 Å²	103	139.4 Å²	139.4	55%	0.551	70%	0.698	S	S	*	*	G	3₁₀ helix	trans	-83.7	-2.4	-178.8	59.1	-37.2	0	0	0	114.5	P36 N40 L41	P36-D38 WeakPolarHBondContact CB-OD1 3.32Å; P36-D38 PolarHBondContact O-N 2.92Å; P36-D38 VanDerWaalsContact O-N 3.12Å; D38-N40 PolarHBondContact O-N 3.05Å; D38-L41 HydrophobicContact CB-CD1 3.6Å; D38-L41 HydrophobicContact CB-CG 4.15Å; D38-L41 VanDerWaalsContact O-CB 3.32Å; D38-L41 WeakPolarHBondContact O-CB 3.37Å; D38-L41 WeakPolarHBondContact O-CG 3.39Å; D38-L41 PolarHBondContact O-N 3.17Å
39	W	82.3	Confident	72.9	Confident	182 Å²	182	149.3 Å²	149.3	69%	0.689	74%	0.735	S	S	*	*	G	3₁₀ helix	trans	-60.7	-33.7	178.4	-157.5	-53.5	0	0	0	112.6	P35 P36 L41	P35-W39 HydrophobicContact CB-CB 4.44Å; P35-W39 HydrophobicContact CB-CD2 4.24Å; P35-W39 HydrophobicContact CB-CE3 3.68Å; P35-W39 HydrophobicContact CB-CZ3 4.28Å; P36-W39 HydrophobicContact CG-CE3 4.23Å; P36-W39 WeakPolarHBondContact O-CB 3.46Å; P36-W39 PolarHBondContact O-N 3.01Å; W39-L41 PolarHBondContact O-N 2.93Å
40	N	81.3	Confident	73.6	Confident	145 Å²	145	147.8 Å²	147.8	78%	0.775	74%	0.738	S	S	*	*	G	3₁₀ helix	trans	-84.2	3.3	179.3	-61.4	-64.4	0	0	0	113	D38	D38-N40 PolarHBondContact O-N 3.05Å
41	L	85.9	Confident	74.1	Confident	119 Å²	119	153.2 Å²	153.2	62%	0.623	76%	0.757	S	S	*	*	S	Bend	trans	-73.4	137	177.4	-63.9	179	0	0	0	109.6	D38 W39 L43	D38-L41 HydrophobicContact CB-CD1 3.6Å; D38-L41 HydrophobicContact CB-CG 4.15Å; D38-L41 VanDerWaalsContact O-CB 3.32Å; D38-L41 WeakPolarHBondContact O-CB 3.37Å; D38-L41 WeakPolarHBondContact O-CG 3.39Å; D38-L41 PolarHBondContact O-N 3.17Å; W39-L41 PolarHBondContact O-N 2.93Å; L41-L43 PolarHBondContact O-N 3.32Å
42	P	85.3	Confident	74.8	Confident	116 Å²	116	153.6 Å²	153.6	75%	0.753	76%	0.757	S	S	*	*	P	Polyproline II helix	trans	-59.2	141.1	171.1	26.3	-32.6	0	0	0	108.9
43	L	81.6	Confident	75.3	Confident	159 Å²	159	153.3 Å²	153.3	83%	0.832	77%	0.766	S	S	*	*	P	Polyproline II helix	trans	-53.1	137.8	173.3	-66.8	173.1	0	0	0	108.8	L41 Q45	L41-L43 PolarHBondContact O-N 3.32Å; L43-Q45 PolarHBondContact O-N 3.16Å
44	P	81.9	Confident	75.8	Confident	122 Å²	122	152.8 Å²	152.8	79%	0.792	77%	0.767	S	S	*	*	P	Polyproline II helix	trans	-55.5	117.7	172.9	-18.8	29.7	0	0	0	107.5	E46	P44-E46 PolarHBondContact O-N 3.44Å
45	Q	76.4	Confident	76.3	Confident	179 Å²	179	148.5 Å²	148.5	84%	0.836	76%	0.764	S	S	*	*			trans	-60.6	113.8	167.3	-77.8	-172.9	-41.5	0	0	105.9	L43 K47	L43-Q45 PolarHBondContact O-N 3.16Å; Q45-K47 VanDerWaalsContact C-N 3.34Å; Q45-K47 PolarHBondContact O-N 2.93Å
46	E	73.4	Confident	76.7	Confident	179 Å²	179	153 Å²	153	84%	0.836	78%	0.778	S	S	*	*			trans	-52.1	110.9	159.1	-82.4	-170.6	151.8	0	0	105.2	P44 D48	P44-E46 PolarHBondContact O-N 3.44Å; E46-D48 PolarHBondContact O-N 3.33Å
47	K	64.7	Low	76.5	Confident	194 Å²	194	159.3 Å²	159.3	84%	0.843	80%	0.803	S	S	*	*			trans	-69.7	98.4	167.3	-65.1	-178.6	-177.3	-178.7	0	103.5	Q45 K49	Q45-K47 VanDerWaalsContact C-N 3.34Å; Q45-K47 PolarHBondContact O-N 2.93Å; K47-K49 PolarHBondContact O-N 3.18Å
48	D	65.3	Low	76.3	Confident	162 Å²	162	161 Å²	161	87%	0.866	80%	0.798	S	S	*	*			trans	-41.3	116.8	169.2	-79.5	-53.3	0	0	0	107.8	E46	E46-D48 PolarHBondContact O-N 3.33Å
49	K	56	Low	75.8	Confident	272 Å²	272	166.3 Å²	166.3	100%	1.183	82%	0.821	S	S	*	*			trans	-115.1	0	168.8	-176.8	-170.9	169.8	-164.3	0	108.1	K47	K47-K49 PolarHBondContact O-N 3.18Å

Retrieved 49 of 49 residues in 81.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).