A0A087WSJ5_MOUSE Loading...

Sterol O-acyltransferase 1

AlphaFold DB , UniProt , Accession A0A087WSJ5, Species MOUSE (Mus musculus, Mouse), Gene Soat1, Length 32 aa.

						>A0A087WSJ5_MOUSE|A0A087WSJ5|Soat1
MKQLIAKKRLLAAEAEELKPLFMKEVGCHFDD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	76.6	Confident	91	Very high	184 Å²	184	136.5 Å²	136.5	91%	0.906	65%	0.65	S	S	*	*				0	-54.8	0	-140.2	63.4	104.6	0	0	114	Q3 L4 I5	M1-Q3 PolarHBondContact O-N 3.09Å; M1-L4 WeakPolarHBondContact O-CB 3.43Å; M1-L4 PolarHBondContact O-N 3.34Å; M1-L4 VanDerWaalsContact O-N 3.09Å; M1-I5 PolarHBondContact O-N 3.18Å
2	K	82.7	Confident	91.3	Very high	192 Å²	192	129.6 Å²	129.6	84%	0.835	63%	0.633	S	S	*	*	H	α-helix	trans	-55.5	-44	-178.9	-70	-178.1	178.7	-179.1	0	114.3	L4 I5 A6	K2-L4 VanDerWaalsContact C-N 3.33Å; K2-L4 PolarHBondContact O-N 3.09Å; K2-I5 PolarHBondContact O-N 3.06Å; K2-A6 PolarHBondContact O-N 2.92Å; K2-A6 VanDerWaalsContact O-N 3.09Å
3	Q	89.3	Confident	91.6	Very high	163 Å²	163	123.3 Å²	123.3	76%	0.762	62%	0.615	S	S	*	*	H	α-helix	trans	-66.6	-31.8	177.2	-69.4	179.4	-45.4	0	0	113.5	M1 A6 K7	M1-Q3 PolarHBondContact O-N 3.09Å; Q3-A6 PolarHBondContact O-N 3.45Å; Q3-K7 WeakPolarHBondContact O-CG 3.45Å; Q3-K7 PolarHBondContact O-N 3.36Å
4	L	92.9	Very high	91.7	Very high	118 Å²	118	121.9 Å²	121.9	62%	0.618	61%	0.605	S	S	*	*	H	α-helix	trans	-69.6	-40	178	-174.4	64.3	0	0	0	111	M1 K2 K7 K8	M1-L4 WeakPolarHBondContact O-CB 3.43Å; M1-L4 PolarHBondContact O-N 3.34Å; M1-L4 VanDerWaalsContact O-N 3.09Å; K2-L4 VanDerWaalsContact C-N 3.33Å; K2-L4 PolarHBondContact O-N 3.09Å; L4-K7 PolarHBondContact O-N 3.45Å; L4-K8 WeakPolarHBondContact O-CB 3.44Å; L4-K8 PolarHBondContact O-N 3.44Å
5	I	94.7	Very high	91.7	Very high	86 Å²	86	116.9 Å²	116.9	44%	0.441	59%	0.591	S	S	.	*	H	α-helix	trans	-66.1	-41.6	175.2	-62.8	171.6	0	0	0	110.6	M1 K2 K8 R9	M1-I5 PolarHBondContact O-N 3.18Å; K2-I5 PolarHBondContact O-N 3.06Å; I5-K8 PolarHBondContact O-N 3.31Å; I5-R9 WeakPolarHBondContact O-CG 3.49Å; I5-R9 PolarHBondContact O-N 3.39Å
6	A	94.1	Very high	91.6	Very high	52 Å²	52	116.6 Å²	116.6	43%	0.43	59%	0.587	S	S	.	*	H	α-helix	trans	-60.6	-47	175.8	0	0	0	0	0	111.6	K2 Q3 K8 R9 L10	K2-A6 PolarHBondContact O-N 2.92Å; K2-A6 VanDerWaalsContact O-N 3.09Å; Q3-A6 PolarHBondContact O-N 3.45Å; A6-K8 PolarHBondContact O-N 2.99Å; A6-R9 PolarHBondContact O-N 3.29Å; A6-L10 PolarHBondContact O-N 2.98Å; A6-L10 VanDerWaalsContact O-N 3.14Å
7	K	93.7	Very high	91.5	Very high	141 Å²	141	118.4 Å²	118.4	61%	0.613	59%	0.593	S	S	*	*	H	α-helix	trans	-60.6	-42.7	174.7	-76.9	-175.5	174.7	-170.8	0	112.6	Q3 L4 R9 L10 L11	Q3-K7 WeakPolarHBondContact O-CG 3.45Å; Q3-K7 PolarHBondContact O-N 3.36Å; L4-K7 PolarHBondContact O-N 3.45Å; K7-R9 VanDerWaalsContact C-N 3.27Å; K7-R9 PolarHBondContact O-N 3.22Å; K7-L10 PolarHBondContact O-N 2.72Å; K7-L11 WeakPolarHBondContact O-CG 3.33Å; K7-L11 PolarHBondContact O-N 3.07Å
8	K	93.5	Very high	91.3	Very high	159 Å²	159	117.1 Å²	117.1	69%	0.691	59%	0.587	S	S	*	*	H	α-helix	trans	-58.9	-39.2	176.7	-174.7	-178.8	176.1	-179.6	0	111.9	L4 I5 A6 A12	L4-K8 WeakPolarHBondContact O-CB 3.44Å; L4-K8 PolarHBondContact O-N 3.44Å; I5-K8 PolarHBondContact O-N 3.31Å; A6-K8 PolarHBondContact O-N 2.99Å; K8-A12 WeakPolarHBondContact O-CB 3.4Å; K8-A12 PolarHBondContact O-N 3.14Å
9	R	93.3	Very high	90.9	Very high	186 Å²	186	115.9 Å²	115.9	70%	0.702	58%	0.578	S	S	*	*	H	α-helix	trans	-69	-41.6	178.5	-71.8	-179	-173.7	-163.2	0.8	112.6	I5 A6 K7 A12 A13	I5-R9 WeakPolarHBondContact O-CG 3.49Å; I5-R9 PolarHBondContact O-N 3.39Å; A6-R9 PolarHBondContact O-N 3.29Å; K7-R9 VanDerWaalsContact C-N 3.27Å; K7-R9 PolarHBondContact O-N 3.22Å; R9-A12 PolarHBondContact O-N 3.35Å; R9-A13 PolarHBondContact O-N 3.47Å
10	L	95.6	Very high	90.5	Very high	110 Å²	110	114.3 Å²	114.3	58%	0.576	58%	0.577	S	S	*	*	H	α-helix	trans	-62.4	-48.7	176.5	-71	169.6	0	0	0	111.3	A6 K7 A12 A13 E14	A6-L10 PolarHBondContact O-N 2.98Å; A6-L10 VanDerWaalsContact O-N 3.14Å; K7-L10 PolarHBondContact O-N 2.72Å; L10-A12 VanDerWaalsContact C-N 3.27Å; L10-A12 PolarHBondContact O-N 2.6Å; L10-A13 WeakPolarHBondContact O-CB 3.37Å; L10-A13 PolarHBondContact O-N 3.07Å; L10-A13 VanDerWaalsContact O-N 3.09Å; L10-E14 WeakPolarHBondContact O-CG 3.44Å; L10-E14 PolarHBondContact O-N 3.06Å
11	L	94.5	Very high	90.1	Very high	110 Å²	110	114.2 Å²	114.2	58%	0.576	58%	0.577	S	S	*	*	H	α-helix	trans	-61	-35.9	177.3	-69.7	169.4	0	0	0	112.7	K7 A15	K7-L11 WeakPolarHBondContact O-CG 3.33Å; K7-L11 PolarHBondContact O-N 3.07Å; L11-A15 WeakPolarHBondContact O-CB 3.28Å; L11-A15 PolarHBondContact O-N 3.49Å
12	A	94.8	Very high	89.9	Confident	54 Å²	54	112.2 Å²	112.2	45%	0.446	56%	0.564	S	S	.	*	H	α-helix	trans	-68	-40.4	175.2	0	0	0	0	0	111.9	K8 R9 L10 A15 E16	K8-A12 WeakPolarHBondContact O-CB 3.4Å; K8-A12 PolarHBondContact O-N 3.14Å; R9-A12 PolarHBondContact O-N 3.35Å; L10-A12 VanDerWaalsContact C-N 3.27Å; L10-A12 PolarHBondContact O-N 2.6Å; A12-A15 PolarHBondContact O-N 3.34Å; A12-E16 WeakPolarHBondContact O-CG 3.36Å; A12-E16 PolarHBondContact O-N 3.09Å
13	A	95.1	Very high	89.4	Confident	48 Å²	48	109 Å²	109	40%	0.397	55%	0.553	S	S	.	*	H	α-helix	trans	-65	-46.2	176.4	0	0	0	0	0	111.6	R9 L10 A15 E16 E17	R9-A13 PolarHBondContact O-N 3.47Å; L10-A13 WeakPolarHBondContact O-CB 3.37Å; L10-A13 PolarHBondContact O-N 3.07Å; L10-A13 VanDerWaalsContact O-N 3.09Å; A13-A15 VanDerWaalsContact C-N 3.28Å; A13-A15 PolarHBondContact O-N 3.18Å; A13-E16 PolarHBondContact O-N 3.36Å; A13-E17 PolarHBondContact O-N 3.39Å; A13-E17 VanDerWaalsContact O-N 3.07Å
14	E	93.9	Very high	88.5	Confident	103 Å²	103	109.7 Å²	109.7	48%	0.481	55%	0.554	S	S	.	*	H	α-helix	trans	-58.2	-40.5	174.4	-71.1	169.6	-164.1	0	0	111.5	L10 E17 L18	L10-E14 WeakPolarHBondContact O-CG 3.44Å; L10-E14 PolarHBondContact O-N 3.06Å; E14-E17 PolarHBondContact O-N 3.02Å; E14-L18 WeakPolarHBondContact O-CB 3.4Å; E14-L18 VanDerWaalsContact O-CG 3.25Å; E14-L18 WeakPolarHBondContact O-CG 3.44Å; E14-L18 PolarHBondContact O-N 2.91Å
15	A	90.9	Very high	87	Confident	48 Å²	48	111.8 Å²	111.8	40%	0.397	56%	0.56	S	S	.	*	H	α-helix	trans	-64.9	-41.2	176.7	0	0	0	0	0	112.8	L11 A12 A13 E17 L18 K19	L11-A15 WeakPolarHBondContact O-CB 3.28Å; L11-A15 PolarHBondContact O-N 3.49Å; A12-A15 PolarHBondContact O-N 3.34Å; A13-A15 VanDerWaalsContact C-N 3.28Å; A13-A15 PolarHBondContact O-N 3.18Å; A15-E17 VanDerWaalsContact C-N 3.32Å; A15-E17 PolarHBondContact O-N 3.49Å; A15-L18 PolarHBondContact O-N 3.35Å; A15-K19 WeakPolarHBondContact O-CG 3.49Å; A15-K19 PolarHBondContact O-N 3.03Å
16	E	89.9	Confident	85.4	Confident	112 Å²	112	110 Å²	110	52%	0.523	55%	0.554	S	S	.	*	H	α-helix	trans	-62.6	-38.6	175	-67.5	-62	153.1	0	0	112	A12 A13 L18 K19 P20	A12-E16 WeakPolarHBondContact O-CG 3.36Å; A12-E16 PolarHBondContact O-N 3.09Å; A13-E16 PolarHBondContact O-N 3.36Å; E16-L18 VanDerWaalsContact C-N 3.31Å; E16-L18 PolarHBondContact O-N 3.02Å; E16-K19 PolarHBondContact O-N 3.04Å; E16-K19 WeakPolarHBondContact OE1-CE 3.44Å; E16-K19 IonicContact OE1-NZ 2.6Å; E16-K19 PolarHBondContact OE1-NZ 3.3Å; E16-K19 WeakPolarHBondContact OE2-CD 3.39Å; E16-K19 VanDerWaalsContact OE2-CE 3.28Å; E16-K19 WeakPolarHBondContact OE2-CE 3.41Å; E16-K19 IonicContact OE2-NZ 2.72Å; E16-K19 PolarHBondContact OE2-NZ 3.03Å; E16-P20 VanDerWaalsContact O-CD 3.31Å; E16-P20 WeakPolarHBondContact O-CD 3.22Å
17	E	90.8	Very high	83.6	Confident	147 Å²	147	108.8 Å²	108.8	69%	0.687	55%	0.545	S	S	*	.	H	α-helix	trans	-68.5	-30	176.2	-70.1	178	-172.3	0	0	112.7	A13 E14 A15 P20	A13-E17 PolarHBondContact O-N 3.39Å; A13-E17 VanDerWaalsContact O-N 3.07Å; E14-E17 PolarHBondContact O-N 3.02Å; A15-E17 VanDerWaalsContact C-N 3.32Å; A15-E17 PolarHBondContact O-N 3.49Å; E17-P20 WeakPolarHBondContact O-CD 3.4Å
18	L	87.6	Confident	81.8	Confident	94 Å²	94	107 Å²	107	49%	0.492	55%	0.55	S	S	.	.	H	α-helix	trans	-82.3	-20.4	176.8	-69.8	172.1	0	0	0	113.4	E14 A15 E16 L21 F22	E14-L18 WeakPolarHBondContact O-CB 3.4Å; E14-L18 VanDerWaalsContact O-CG 3.25Å; E14-L18 WeakPolarHBondContact O-CG 3.44Å; E14-L18 PolarHBondContact O-N 2.91Å; A15-L18 PolarHBondContact O-N 3.35Å; E16-L18 VanDerWaalsContact C-N 3.31Å; E16-L18 PolarHBondContact O-N 3.02Å; L18-L21 HydrophobicContact CD2-CD1 3.92Å; L18-L21 WeakPolarHBondContact O-CB 3.31Å; L18-L21 PolarHBondContact O-N 3.25Å; L18-L21 VanDerWaalsContact O-N 3.12Å; L18-F22 PolarHBondContact O-N 2.8Å; L18-F22 VanDerWaalsContact O-N 3.08Å
19	K	84.1	Confident	80.1	Confident	95 Å²	95	106.8 Å²	106.8	41%	0.413	55%	0.551	S	S	.	*	H	α-helix	trans	-54.7	-46.8	180	-81.7	179.9	-167.6	175	0	113.5	A15 E16 L21 F22 M23	A15-K19 WeakPolarHBondContact O-CG 3.49Å; A15-K19 PolarHBondContact O-N 3.03Å; E16-K19 PolarHBondContact O-N 3.04Å; E16-K19 WeakPolarHBondContact OE1-CE 3.44Å; E16-K19 IonicContact OE1-NZ 2.6Å; E16-K19 PolarHBondContact OE1-NZ 3.3Å; E16-K19 WeakPolarHBondContact OE2-CD 3.39Å; E16-K19 VanDerWaalsContact OE2-CE 3.28Å; E16-K19 WeakPolarHBondContact OE2-CE 3.41Å; E16-K19 IonicContact OE2-NZ 2.72Å; E16-K19 PolarHBondContact OE2-NZ 3.03Å; K19-L21 VanDerWaalsContact C-N 3.25Å; K19-L21 PolarHBondContact O-N 3.13Å; K19-F22 PolarHBondContact O-N 3.49Å; K19-M23 WeakPolarHBondContact O-CB 3.35Å; K19-M23 VanDerWaalsContact O-CG 3.22Å; K19-M23 WeakPolarHBondContact O-CG 3.43Å; K19-M23 PolarHBondContact O-N 3.32Å
20	P	81.6	Confident	78.3	Confident	84 Å²	84	105.7 Å²	105.7	55%	0.545	55%	0.552	S	S	.	*	H	α-helix	trans	-62.8	-31.6	178.7	-22.6	33.7	0	0	0	113.4	E16 E17 K24	E16-P20 VanDerWaalsContact O-CD 3.31Å; E16-P20 WeakPolarHBondContact O-CD 3.22Å; E17-P20 WeakPolarHBondContact O-CD 3.4Å; P20-K24 WeakPolarHBondContact O-CB 3.25Å; P20-K24 PolarHBondContact O-N 3.26Å
21	L	82.4	Confident	76.6	Confident	113 Å²	113	107.4 Å²	107.4	59%	0.592	56%	0.561	S	S	*	*	H	α-helix	trans	-69.5	-43.9	177.2	-62.1	174.9	0	0	0	110.6	L18 K19 K24	L18-L21 HydrophobicContact CD2-CD1 3.92Å; L18-L21 WeakPolarHBondContact O-CB 3.31Å; L18-L21 PolarHBondContact O-N 3.25Å; L18-L21 VanDerWaalsContact O-N 3.12Å; K19-L21 VanDerWaalsContact C-N 3.25Å; K19-L21 PolarHBondContact O-N 3.13Å; L21-K24 PolarHBondContact O-N 3.08Å
22	F	73.3	Confident	74.8	Confident	141 Å²	141	112.4 Å²	112.4	62%	0.618	59%	0.589	S	S	*	*	H	α-helix	trans	-64	-50.8	173.1	-108.5	-92.6	0	0	0	111.4	L18 K19 K24 E25 V26	L18-F22 PolarHBondContact O-N 2.8Å; L18-F22 VanDerWaalsContact O-N 3.08Å; K19-F22 PolarHBondContact O-N 3.49Å; F22-K24 PolarHBondContact O-N 3.12Å; F22-K24 VanDerWaalsContact O-N 3.13Å; F22-E25 PolarHBondContact O-N 3.19Å; F22-V26 HydrophobicContact CD1-CG2 4.15Å; F22-V26 WeakPolarHBondContact O-CG2 3.3Å; F22-V26 PolarHBondContact O-N 3.4Å
23	M	71.4	Confident	73.8	Confident	125 Å²	125	115.4 Å²	115.4	62%	0.616	60%	0.596	S	S	*	*	H	α-helix	trans	-61.4	-25.1	-178.9	-68.2	-59.5	176.3	0	0	113.2	K19 G27	K19-M23 WeakPolarHBondContact O-CB 3.35Å; K19-M23 VanDerWaalsContact O-CG 3.22Å; K19-M23 WeakPolarHBondContact O-CG 3.43Å; K19-M23 PolarHBondContact O-N 3.32Å; M23-G27 WeakPolarHBondContact O-CA 3.22Å; M23-G27 PolarHBondContact O-N 2.89Å
24	K	70.8	Confident	72.6	Confident	177 Å²	177	118.9 Å²	118.9	77%	0.77	61%	0.606	S	S	*	*	H	α-helix	trans	-70.3	-32.2	173.1	-170.1	179	178.7	-176.3	0	112.8	P20 L21 F22	P20-K24 WeakPolarHBondContact O-CB 3.25Å; P20-K24 PolarHBondContact O-N 3.26Å; L21-K24 PolarHBondContact O-N 3.08Å; F22-K24 PolarHBondContact O-N 3.12Å; F22-K24 VanDerWaalsContact O-N 3.13Å
25	E	61.5	Low	71.5	Confident	162 Å²	162	119.8 Å²	119.8	76%	0.757	61%	0.613	S	S	*	*	H	α-helix	trans	-86.2	-36.5	176.8	-81.6	179.7	163.1	0	0	112.8	F22	F22-E25 PolarHBondContact O-N 3.19Å
26	V	60.7	Low	70.3	Confident	50 Å²	50	124 Å²	124	30%	0.303	63%	0.626	S	S	.	*	H	α-helix	trans	-98.2	-18.7	-178.4	-98.7	0	0	0	0	115.2	F22 C28 H29 F30	F22-V26 HydrophobicContact CD1-CG2 4.15Å; F22-V26 WeakPolarHBondContact O-CG2 3.3Å; F22-V26 PolarHBondContact O-N 3.4Å; V26-C28 PolarHBondContact O-N 2.93Å; V26-H29 PolarHBondContact O-N 2.79Å; V26-F30 HydrophobicContact CB-CD2 3.9Å; V26-F30 HydrophobicContact CB-CE2 3.78Å; V26-F30 HydrophobicContact CG1-CD2 4.19Å; V26-F30 HydrophobicContact CG1-CE2 3.62Å; V26-F30 VanDerWaalsContact O-CD2 3.3Å; V26-F30 WeakPolarHBondContact O-CD2 2.91Å; V26-F30 PolarHBondContact O-N 3.36Å
27	G	57.2	Low	69.1	Low	25 Å²	25	124.8 Å²	124.8	26%	0.258	63%	0.632	S	S	.	*	H	α-helix	trans	-63.1	-23	178.3	0	0	0	0	0	113.7	M23 H29	M23-G27 WeakPolarHBondContact O-CA 3.22Å; M23-G27 PolarHBondContact O-N 2.89Å; G27-H29 PolarHBondContact O-N 2.92Å
28	C	55.9	Low	67.6	Low	104 Å²	104	123.3 Å²	123.3	70%	0.703	63%	0.629	S	S	*	*	H	α-helix	trans	-76.2	-6.4	171.7	-162.3	0	0	0	0	113.4	V26	V26-C28 PolarHBondContact O-N 2.93Å
29	H	57.6	Low	66.2	Low	155 Å²	155	125.4 Å²	125.4	72%	0.718	64%	0.638	S	S	*	*	H	α-helix	trans	-119.7	-7.9	-174.5	-108.5	42.2	0	0	0	114.6	V26 G27	V26-H29 PolarHBondContact O-N 2.79Å; G27-H29 PolarHBondContact O-N 2.92Å
30	F	55.5	Low	64.8	Low	163 Å²	163	127.7 Å²	127.7	72%	0.715	66%	0.656	S	S	*	*	H	α-helix	trans	-115.4	-0.4	179.7	-71.3	-75.9	0	0	0	113.7	V26	V26-F30 HydrophobicContact CB-CD2 3.9Å; V26-F30 HydrophobicContact CB-CE2 3.78Å; V26-F30 HydrophobicContact CG1-CD2 4.19Å; V26-F30 HydrophobicContact CG1-CE2 3.62Å; V26-F30 VanDerWaalsContact O-CD2 3.3Å; V26-F30 WeakPolarHBondContact O-CD2 2.91Å; V26-F30 PolarHBondContact O-N 3.36Å
31	D	59.1	Low	63.4	Low	146 Å²	146	131.3 Å²	131.3	78%	0.781	67%	0.665	S	S	*	*			trans	-92.5	2.2	173.2	-76.7	-21.3	0	0	0	113.2
32	D	55.8	Low	61.7	Low	215 Å²	215	133 Å²	133	100%	1.15	67%	0.672	S	S	*	*			trans	-102	0	172.1	-77.1	-22.6	0	0	0	112.5

Retrieved 32 of 32 residues in 40.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).