A0A087WSL5_MOUSE Loading...

Tubulin, alpha 4A

AlphaFold DB , UniProt , Accession A0A087WSL5, Species MOUSE (Mus musculus, Mouse), Gene Tuba4a, Length 89 aa.

						>A0A087WSL5_MOUSE|A0A087WSL5|Tuba4a
MGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	79.3	Confident	89.6	Confident	199 Å²	199	74.1 Å²	74.1	98%	0.98	41%	0.405	S	S	*	.				0	-59.3	0	-65.4	-57.1	-85.3	0	0	111.9	N3 A4 C5	M1-N3 PolarHBondContact O-N 3.12Å; M1-A4 PolarHBondContact O-N 2.81Å; M1-C5 PolarHBondContact O-N 2.9Å; M1-C5 PolarHBondContact O-SG 3.49Å; M1-C5 VanDerWaalsContact O-SG 3.4Å
2	G	84.2	Confident	89.8	Confident	32 Å²	32	77.9 Å²	77.9	33%	0.33	42%	0.418	S	S	.	.	H	α-helix	trans	-54.2	-44.5	-178.2	0	0	0	0	0	114.9	A4 C5 W6	G2-A4 PolarHBondContact O-N 3.23Å; G2-C5 PolarHBondContact O-N 3.34Å; G2-W6 VanDerWaalsContact O-CD1 3.23Å; G2-W6 PolarHBondContact O-N 3.25Å; G2-W6 VanDerWaalsContact O-N 3.12Å
3	N	86.3	Confident	89.7	Confident	59 Å²	59	76.1 Å²	76.1	32%	0.316	41%	0.405	S	S	.	.	H	α-helix	trans	-58.3	-46.6	178.8	-170.9	46.9	0	0	0	112.9	M1 C5 W6 E7	M1-N3 PolarHBondContact O-N 3.12Å; N3-C5 VanDerWaalsContact C-N 3.34Å; N3-C5 PolarHBondContact O-N 3.11Å; N3-W6 PolarHBondContact O-N 3.2Å; N3-E7 PolarHBondContact O-N 3.12Å
4	A	89.2	Confident	89.7	Confident	59 Å²	59	73.4 Å²	73.4	49%	0.488	41%	0.405	S	S	.	.	H	α-helix	trans	-65.5	-35	179	0	0	0	0	0	112.6	M1 G2 L8	M1-A4 PolarHBondContact O-N 2.81Å; G2-A4 PolarHBondContact O-N 3.23Å; A4-L8 PolarHBondContact O-N 3.06Å
5	C	92	Very high	89.9	Confident	65 Å²	65	69.1 Å²	69.1	44%	0.439	38%	0.381	S	S	.	.	H	α-helix	trans	-64.2	-44.4	175.2	-64.5	0	0	0	0	111.6	M1 G2 N3 L8 Y9	M1-C5 PolarHBondContact O-N 2.9Å; M1-C5 PolarHBondContact O-SG 3.49Å; M1-C5 VanDerWaalsContact O-SG 3.4Å; G2-C5 PolarHBondContact O-N 3.34Å; N3-C5 VanDerWaalsContact C-N 3.34Å; N3-C5 PolarHBondContact O-N 3.11Å; C5-L8 PolarHBondContact O-N 3.3Å; C5-Y9 PolarHBondContact O-N 2.97Å
6	W	93.5	Very high	90.1	Very high	31 Å²	31	70.1 Å²	70.1	12%	0.117	38%	0.382	C	S	.	.	H	α-helix	trans	-70.5	-34.7	179	-76	108.4	0	0	0	112.9	G2 N3 L8 Y9 C10 F37 F38 P48 A50 F52 F72	G2-W6 VanDerWaalsContact O-CD1 3.23Å; G2-W6 PolarHBondContact O-N 3.25Å; G2-W6 VanDerWaalsContact O-N 3.12Å; N3-W6 PolarHBondContact O-N 3.2Å; W6-L8 VanDerWaalsContact C-N 3.34Å; W6-Y9 HydrophobicContact CE3-CD2 4.11Å; W6-Y9 AromaticContact CZ3-CD2 4Å; W6-Y9 HydrophobicContact CZ3-CD2 4Å; W6-Y9 PolarHBondContact O-N 2.81Å; W6-C10 WeakPolarHBondContact O-CB 3.38Å; W6-C10 PolarHBondContact O-N 3.13Å; W6-C10 PolarHBondContact O-SG 3.22Å; W6-F37 HydrophobicContact CH2-CB 4.13Å; W6-F37 HydrophobicContact CZ3-CB 4.25Å; W6-F38 HydrophobicContact CE3-CE1 4.15Å; W6-F38 AromaticContact CE3-CZ 3.86Å; W6-F38 HydrophobicContact CE3-CZ 3.86Å; W6-F38 AromaticContact CZ3-CE1 3.95Å; W6-F38 HydrophobicContact CZ3-CE1 3.95Å; W6-F38 AromaticContact CZ3-CE2 3.99Å; W6-F38 HydrophobicContact CZ3-CE2 3.99Å; W6-F38 AromaticContact CZ3-CZ 3.64Å; W6-F38 HydrophobicContact CZ3-CZ 3.64Å; W6-P48 HydrophobicContact CD2-CB 3.92Å; W6-P48 HydrophobicContact CD2-CG 4.16Å; W6-P48 HydrophobicContact CE3-CB 3.71Å; W6-P48 HydrophobicContact CE3-CG 3.77Å; W6-P48 HydrophobicContact CH2-CB 3.75Å; W6-P48 HydrophobicContact CZ2-CB 3.97Å; W6-P48 HydrophobicContact CZ3-CB 3.61Å; W6-P48 HydrophobicContact CZ3-CG 4.03Å; W6-A50 HydrophobicContact CZ2-CB 3.59Å; W6-F52 AromaticContact CD1-CZ 3.72Å; W6-F72 HydrophobicContact CB-CE1 4.5Å; W6-F72 HydrophobicContact CB-CZ 3.99Å; W6-F72 HydrophobicContact CD2-CE1 4.48Å; W6-F72 HydrophobicContact CG-CE1 4.11Å; W6-F72 HydrophobicContact CG-CZ 4.05Å
7	E	93	Very high	90.4	Very high	84 Å²	84	69.2 Å²	69.2	39%	0.393	38%	0.38	S	S	.	.	H	α-helix	trans	-58.6	-46.8	170.1	170.7	166.3	-150.8	0	0	111.3	N3 C10 L11 Y68	N3-E7 PolarHBondContact O-N 3.12Å; E7-C10 PolarHBondContact O-N 2.91Å; E7-L11 HydrophobicContact CG-CD1 4.38Å; E7-L11 WeakPolarHBondContact O-CG 3.35Å; E7-L11 PolarHBondContact O-N 2.93Å; E7-Y68 HydrophobicContact CB-CE2 3.76Å; E7-Y68 HydrophobicContact CG-CE2 3.74Å
8	L	93.1	Very high	90.6	Very high	89 Å²	89	68.4 Å²	68.4	47%	0.466	38%	0.375	S	S	.	.	H	α-helix	trans	-63.8	-44.5	177.4	-176.5	62.3	0	0	0	112	A4 C5 W6 C10 L11 E12	A4-L8 PolarHBondContact O-N 3.06Å; C5-L8 PolarHBondContact O-N 3.3Å; W6-L8 VanDerWaalsContact C-N 3.34Å; L8-C10 VanDerWaalsContact C-N 3.29Å; L8-C10 PolarHBondContact O-N 3.11Å; L8-L11 WeakPolarHBondContact O-CB 3.07Å; L8-L11 PolarHBondContact O-N 2.82Å; L8-L11 VanDerWaalsContact O-N 3.11Å; L8-E12 HydrophobicContact CD1-CG 4.37Å; L8-E12 HydrophobicContact CG-CG 4.37Å; L8-E12 WeakPolarHBondContact O-CG 3.38Å; L8-E12 PolarHBondContact O-N 2.91Å
9	Y	91.1	Very high	90.7	Very high	78 Å²	78	64.8 Å²	64.8	31%	0.306	36%	0.356	S	S	.	.	H	α-helix	trans	-60.6	-38.6	175.9	-80.4	4.3	0	0	0	112.4	C5 W6 L11 E12 H13 F37	C5-Y9 PolarHBondContact O-N 2.97Å; W6-Y9 HydrophobicContact CE3-CD2 4.11Å; W6-Y9 AromaticContact CZ3-CD2 4Å; W6-Y9 HydrophobicContact CZ3-CD2 4Å; W6-Y9 PolarHBondContact O-N 2.81Å; Y9-L11 VanDerWaalsContact C-N 3.33Å; Y9-L11 PolarHBondContact O-N 2.86Å; Y9-E12 PolarHBondContact O-N 3.42Å; Y9-H13 WeakPolarHBondContact O-CB 3.36Å; Y9-H13 PolarHBondContact O-CD2 3.43Å; Y9-H13 PolarHBondContact O-N 3.3Å; Y9-F37 AromaticContact CE2-CD1 3.99Å; Y9-F37 HydrophobicContact CE2-CD1 3.99Å; Y9-F37 HydrophobicContact CE2-CE1 4.13Å; Y9-F37 HydrophobicContact CE2-CG 4.25Å
10	C	92.4	Very high	90.7	Very high	0 Å²	0	65.2 Å²	65.2	0%	0	36%	0.355	C	S	.	.	H	α-helix	trans	-62	-43.1	174.3	-69.5	0	0	0	0	111.3	W6 E7 L8 H13 G14 I15 Y68 L71	W6-C10 WeakPolarHBondContact O-CB 3.38Å; W6-C10 PolarHBondContact O-N 3.13Å; W6-C10 PolarHBondContact O-SG 3.22Å; E7-C10 PolarHBondContact O-N 2.91Å; L8-C10 VanDerWaalsContact C-N 3.29Å; L8-C10 PolarHBondContact O-N 3.11Å; C10-H13 PolarHBondContact O-N 2.81Å; C10-G14 CarbonylContact O-C 3.47Å; C10-G14 WeakPolarHBondContact O-CA 3.46Å; C10-G14 PolarHBondContact O-N 3.25Å; C10-I15 HydrophobicContact CB-CB 4.26Å; C10-I15 WeakPolarHBondContact CB-O 3.2Å; C10-I15 PolarHBondContact O-N 3.22Å; C10-Y68 HydrophobicContact CB-CE1 3.92Å; C10-L71 VanDerWaalsContact SG-CD2 3.56Å
11	L	91.9	Very high	90.7	Very high	119 Å²	119	63.4 Å²	63.4	62%	0.623	34%	0.344	S	S	*	.	H	α-helix	trans	-65.4	-43.6	177.3	-69	169.9	0	0	0	112.6	E7 L8 Y9 H13 G14	E7-L11 HydrophobicContact CG-CD1 4.38Å; E7-L11 WeakPolarHBondContact O-CG 3.35Å; E7-L11 PolarHBondContact O-N 2.93Å; L8-L11 WeakPolarHBondContact O-CB 3.07Å; L8-L11 PolarHBondContact O-N 2.82Å; L8-L11 VanDerWaalsContact O-N 3.11Å; Y9-L11 VanDerWaalsContact C-N 3.33Å; Y9-L11 PolarHBondContact O-N 2.86Å; L11-H13 VanDerWaalsContact C-N 3.3Å; L11-H13 PolarHBondContact O-N 3.27Å; L11-G14 PolarHBondContact O-N 3.21Å
12	E	91.2	Very high	90.8	Very high	120 Å²	120	58.2 Å²	58.2	56%	0.561	33%	0.326	S	S	*	.	H	α-helix	trans	-63.3	-36.5	179.4	-73.7	176.6	174.6	0	0	112.3	L8 Y9	L8-E12 HydrophobicContact CD1-CG 4.37Å; L8-E12 HydrophobicContact CG-CG 4.37Å; L8-E12 WeakPolarHBondContact O-CG 3.38Å; L8-E12 PolarHBondContact O-N 2.91Å; Y9-E12 PolarHBondContact O-N 3.42Å
13	H	88.4	Confident	90.3	Very high	54 Å²	54	60.6 Å²	60.6	25%	0.25	34%	0.337	C	S	.	.	H	α-helix	trans	-97	0.2	-179	-64.7	-63.4	0	0	0	113.9	Y9 C10 L11 I15 M21	Y9-H13 WeakPolarHBondContact O-CB 3.36Å; Y9-H13 PolarHBondContact O-CD2 3.43Å; Y9-H13 PolarHBondContact O-N 3.3Å; C10-H13 PolarHBondContact O-N 2.81Å; L11-H13 VanDerWaalsContact C-N 3.3Å; L11-H13 PolarHBondContact O-N 3.27Å; H13-I15 HydrophobicContact CB-CD1 3.95Å; H13-I15 HydrophobicContact CB-CG1 4.05Å; H13-I15 PolarHBondContact O-N 3.32Å; H13-M21 WeakPolarHBondContact O-CE 3.5Å
14	G	90.3	Very high	89.5	Confident	39 Å²	39	58.9 Å²	58.9	40%	0.402	33%	0.328	S	S	.	.	T	Hydrogen-bonded Turn	trans	66.7	25	-179	0	0	0	0	0	114.1	C10 L11	C10-G14 CarbonylContact O-C 3.47Å; C10-G14 WeakPolarHBondContact O-CA 3.46Å; C10-G14 PolarHBondContact O-N 3.25Å; L11-G14 PolarHBondContact O-N 3.21Å
15	I	92	Very high	88.4	Confident	8 Å²	8	65.4 Å²	65.4	4%	0.041	35%	0.345	C	S	.	.			trans	-84.3	128	176.1	-59.3	169.2	0	0	0	108.3	C10 H13 M21 F38 H46 L71	C10-I15 HydrophobicContact CB-CB 4.26Å; C10-I15 WeakPolarHBondContact CB-O 3.2Å; C10-I15 PolarHBondContact O-N 3.22Å; H13-I15 HydrophobicContact CB-CD1 3.95Å; H13-I15 HydrophobicContact CB-CG1 4.05Å; H13-I15 PolarHBondContact O-N 3.32Å; I15-M21 HydrophobicContact CG1-CB 4.36Å; I15-M21 HydrophobicContact CG1-CG 4.41Å; I15-M21 HydrophobicContact CG1-SD 4Å; I15-F38 HydrophobicContact CD1-CD1 3.87Å; I15-F38 HydrophobicContact CD1-CD2 3.9Å; I15-F38 HydrophobicContact CD1-CE1 3.63Å; I15-F38 HydrophobicContact CD1-CE2 3.69Å; I15-F38 HydrophobicContact CD1-CG 4Å; I15-F38 HydrophobicContact CD1-CZ 3.55Å; I15-H46 HydrophobicContact CD1-CB 4.05Å; I15-H46 HydrophobicContact CG1-CB 4.47Å; I15-H46 HydrophobicContact CG2-CB 4.21Å; I15-L71 HydrophobicContact CG2-CD1 4.35Å
16	Q	94.1	Very high	87.1	Confident	86 Å²	86	65.6 Å²	65.6	40%	0.402	35%	0.345	S	S	.	.			trans	-75.9	162.3	178.1	-66.3	-172.7	12	0	0	111.5	D18 G19 Q20	Q16-D18 VanDerWaalsContact CB-OD1 3.26Å; Q16-D18 WeakPolarHBondContact CB-OD1 3.3Å; Q16-D18 PolarHBondContact O-N 3.48Å; Q16-G19 WeakPolarHBondContact O-CA 3.43Å; Q16-G19 PolarHBondContact O-N 3.37Å; Q16-Q20 WeakPolarHBondContact CB-O 3.47Å; Q16-Q20 WeakPolarHBondContact CG-O 3.31Å; Q16-Q20 PolarHBondContact N-O 2.63Å
17	P	94.8	Very high	85.6	Confident	54 Å²	54	69.7 Å²	69.7	35%	0.351	37%	0.368	S	S	.	.	T	Hydrogen-bonded Turn	trans	-60.6	-17.1	-179.8	-25.2	34.9	0	0	0	115.7	P67 Y68	P17-P67 WeakPolarHBondContact CB-O 3.48Å; P17-Y68 HydrophobicContact CB-CD1 3.82Å; P17-Y68 HydrophobicContact CB-CE1 3.89Å; P17-Y68 HydrophobicContact CB-CG 4.39Å; P17-Y68 HydrophobicContact CG-CD1 4.43Å; P17-Y68 HydrophobicContact CG-CE1 4Å
18	D	93.7	Very high	84	Confident	55 Å²	55	69 Å²	69	29%	0.294	38%	0.384	S	S	.	.	T	Hydrogen-bonded Turn	trans	-89.4	-1.7	173.2	67.6	-7.6	0	0	0	113.7	Q16 Q20 K45 Q70	Q16-D18 VanDerWaalsContact CB-OD1 3.26Å; Q16-D18 WeakPolarHBondContact CB-OD1 3.3Å; Q16-D18 PolarHBondContact O-N 3.48Å; D18-Q20 VanDerWaalsContact OD1-CB 3.31Å; D18-Q20 WeakPolarHBondContact OD1-CB 3.23Å; D18-Q20 WeakPolarHBondContact OD1-CG 3.38Å; D18-Q20 PolarHBondContact OD1-N 3.28Å; D18-Q20 WeakPolarHBondContact OD2-CG 3.44Å; D18-K45 VanDerWaalsContact O-CE 3.25Å; D18-K45 WeakPolarHBondContact O-CE 3.49Å; D18-K45 WeakPolarHBondContact O-CG 3.26Å; D18-Q70 HydrophobicContact CB-CB 4.44Å
19	G	92.4	Very high	82.5	Confident	0 Å²	0	67 Å²	67	0%	0	38%	0.384	C	S	.	.	S	Bend	trans	87.2	4.4	-177.4	0	0	0	0	0	114.3	Q16 H46	Q16-G19 WeakPolarHBondContact O-CA 3.43Å; Q16-G19 PolarHBondContact O-N 3.37Å; G19-H46 WeakPolarHBondContact O-CB 3.31Å; G19-H46 PolarHBondContact O-N 2.83Å
20	Q	91.9	Very high	80.9	Confident	73 Å²	73	65.5 Å²	65.5	34%	0.341	39%	0.392	S	S	.	.			trans	-79.7	142.8	177.5	-66.7	-66	-25.9	0	0	111.5	Q16 D18	Q16-Q20 WeakPolarHBondContact CB-O 3.47Å; Q16-Q20 WeakPolarHBondContact CG-O 3.31Å; Q16-Q20 PolarHBondContact N-O 2.63Å; D18-Q20 VanDerWaalsContact OD1-CB 3.31Å; D18-Q20 WeakPolarHBondContact OD1-CB 3.23Å; D18-Q20 WeakPolarHBondContact OD1-CG 3.38Å; D18-Q20 PolarHBondContact OD1-N 3.28Å; D18-Q20 WeakPolarHBondContact OD2-CG 3.44Å
21	M	88.9	Confident	79.2	Confident	27 Å²	27	73.4 Å²	73.4	13%	0.133	43%	0.434	C	S	.	.			trans	-127.2	86.8	177	-173.1	172.2	168.5	0	0	109.4	H13 I15 S23 D24 F34	H13-M21 WeakPolarHBondContact O-CE 3.5Å; I15-M21 HydrophobicContact CG1-CB 4.36Å; I15-M21 HydrophobicContact CG1-CG 4.41Å; I15-M21 HydrophobicContact CG1-SD 4Å; M21-S23 PolarHBondContact O-N 3.01Å; M21-S23 VanDerWaalsContact O-N 3.08Å; M21-D24 HydrophobicContact CB-CB 4.07Å; M21-D24 HydrophobicContact CE-CB 4.32Å; M21-D24 HydrophobicContact CG-CB 3.82Å; M21-D24 WeakPolarHBondContact O-CB 3.4Å; M21-D24 PolarHBondContact O-N 3.37Å; M21-D24 HydrophobicContact SD-CB 3.99Å; M21-F34 HydrophobicContact CE-CE1 4.3Å; M21-F34 HydrophobicContact CE-CZ 4.34Å; M21-F34 HydrophobicContact SD-CE2 4.39Å; M21-F34 HydrophobicContact SD-CZ 4.16Å
22	P	81.5	Confident	78.2	Confident	91 Å²	91	71.2 Å²	71.2	59%	0.591	42%	0.424	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.5	-21.2	-173.1	-21.5	30.8	0	0	0	114.8	D24	P22-D24 VanDerWaalsContact C-N 3.33Å
23	S	75.4	Confident	77.4	Confident	82 Å²	82	70.3 Å²	70.3	57%	0.573	43%	0.431	S	S	*	.	T	Hydrogen-bonded Turn	trans	-76.2	-22.6	175.8	48.7	0	0	0	0	113	M21 K25	M21-S23 PolarHBondContact O-N 3.01Å; M21-S23 VanDerWaalsContact O-N 3.08Å; S23-K25 PolarHBondContact O-N 2.93Å
24	D	68.6	Low	76.9	Confident	23 Å²	23	68.5 Å²	68.5	12%	0.123	42%	0.422	C	S	.	.			trans	-78.2	117	177.5	-172.2	1.3	0	0	0	109.7	M21 P22 T26 H46	M21-D24 HydrophobicContact CB-CB 4.07Å; M21-D24 HydrophobicContact CE-CB 4.32Å; M21-D24 HydrophobicContact CG-CB 3.82Å; M21-D24 WeakPolarHBondContact O-CB 3.4Å; M21-D24 PolarHBondContact O-N 3.37Å; M21-D24 HydrophobicContact SD-CB 3.99Å; P22-D24 VanDerWaalsContact C-N 3.33Å; D24-T26 WeakPolarHBondContact OD1-CA 3.14Å; D24-T26 PolarHBondContact OD1-N 3.44Å; D24-T26 PolarHBondContact OD1-OG1 2.95Å; D24-H46 IonicContact OD2-CE1 3.5Å; D24-H46 IonicContact OD2-NE2 3.53Å
25	K	65.3	Low	76.4	Confident	195 Å²	195	69 Å²	69	85%	0.848	42%	0.417	S	S	*	.			trans	-103.7	1.7	178.3	-65	-177	-178.6	176.1	0	111.9	S23	S23-K25 PolarHBondContact O-N 2.93Å
26	T	64.6	Low	76.1	Confident	69 Å²	69	73.3 Å²	73.3	42%	0.423	44%	0.444	S	S	.	.			trans	-108.5	46.4	-171.9	31	0	0	0	0	111.4	D24 G28 G29	D24-T26 WeakPolarHBondContact OD1-CA 3.14Å; D24-T26 PolarHBondContact OD1-N 3.44Å; D24-T26 PolarHBondContact OD1-OG1 2.95Å; T26-G28 PolarHBondContact O-N 2.88Å; T26-G29 PolarHBondContact O-N 2.8Å
27	I	63.7	Low	76	Confident	118 Å²	118	73.3 Å²	73.3	61%	0.605	44%	0.443	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52	114.6	174.4	-60.8	174.2	0	0	0	109.2	E40	I27-E40 VanDerWaalsContact CA-OE1 3.3Å; I27-E40 WeakPolarHBondContact CA-OE1 3.25Å; I27-E40 WeakPolarHBondContact CG2-OE1 3Å
28	G	57.8	Low	75.8	Confident	70 Å²	70	70.9 Å²	70.9	72%	0.722	43%	0.427	S	S	*	.	T	Hydrogen-bonded Turn	trans	76.9	14.2	-179.2	0	0	0	0	0	116.1	T26 E40	T26-G28 PolarHBondContact O-N 2.88Å; G28-E40 PolarHBondContact N-OE1 3.3Å; G28-E40 PolarHBondContact N-OE2 3.28Å
29	G	62.4	Low	75.7	Confident	47 Å²	47	70.4 Å²	70.4	49%	0.485	43%	0.427	S	S	.	.			trans	-129.2	58.9	177.9	0	0	0	0	0	112	T26	T26-G29 PolarHBondContact O-N 2.8Å
30	G	56.5	Low	75.5	Confident	46 Å²	46	73.3 Å²	73.3	47%	0.474	44%	0.441	S	S	.	.			trans	-97.9	105.2	-171.6	0	0	0	0	0	113.9
31	D	58.8	Low	75.2	Confident	165 Å²	165	71.8 Å²	71.8	88%	0.882	44%	0.437	S	S	*	.			trans	-117	21.7	156.8	-147.4	18.2	0	0	0	110.9
32	D	69.4	Low	74.9	Confident	74 Å²	74	74.7 Å²	74.7	40%	0.396	47%	0.474	S	S	.	.	S	Bend	trans	-79	144.8	175.8	-75.2	-24.5	0	0	0	111.4	F34 T35	D32-F34 HydrophobicContact CB-CD1 3.63Å; D32-F34 HydrophobicContact CB-CE1 3.23Å; D32-F34 HydrophobicContact CB-CG 4.48Å; D32-F34 HydrophobicContact CB-CZ 3.8Å; D32-F34 PolarHBondContact O-N 3.44Å; D32-F34 WeakPolarHBondContact OD2-CE1 3.49Å; D32-T35 WeakPolarHBondContact O-CB 3.4Å; D32-T35 WeakPolarHBondContact O-CG2 3.43Å; D32-T35 PolarHBondContact O-N 2.76Å; D32-T35 VanDerWaalsContact O-N 3.14Å; D32-T35 PolarHBondContact O-OG1 3.46Å
33	S	75.1	Confident	75.1	Confident	101 Å²	101	74 Å²	74	71%	0.706	48%	0.475	S	S	*	.	G	3₁₀ helix	trans	-60.8	-22.2	-172.5	56.6	0	0	0	0	114.8	T36	S33-T36 WeakPolarHBondContact O-CB 3.4Å; S33-T36 PolarHBondContact O-OG1 3.04Å
34	F	76.7	Confident	75.6	Confident	16 Å²	16	70.4 Å²	70.4	7%	0.07	45%	0.451	C	S	.	.	G	3₁₀ helix	trans	-78.5	-15.4	-179.2	63.7	-99.3	0	0	0	114	M21 D32 T36 F37 F38 H46	M21-F34 HydrophobicContact CE-CE1 4.3Å; M21-F34 HydrophobicContact CE-CZ 4.34Å; M21-F34 HydrophobicContact SD-CE2 4.39Å; M21-F34 HydrophobicContact SD-CZ 4.16Å; D32-F34 HydrophobicContact CB-CD1 3.63Å; D32-F34 HydrophobicContact CB-CE1 3.23Å; D32-F34 HydrophobicContact CB-CG 4.48Å; D32-F34 HydrophobicContact CB-CZ 3.8Å; D32-F34 PolarHBondContact O-N 3.44Å; D32-F34 WeakPolarHBondContact OD2-CE1 3.49Å; F34-T36 PolarHBondContact O-N 3.49Å; F34-T36 VanDerWaalsContact O-N 3.09Å; F34-F37 PolarHBondContact O-N 3.38Å; F34-F38 PolarHBondContact O-N 3.29Å; F34-F38 VanDerWaalsContact O-N 3.15Å; F34-H46 AromaticContact CE2-CD2 3.81Å; F34-H46 AromaticContact CE2-NE2 3.64Å
35	T	81.1	Confident	76.7	Confident	49 Å²	49	71.6 Å²	71.6	30%	0.301	46%	0.455	S	S	.	.	G	3₁₀ helix	trans	-61.3	-17.6	173.4	60.5	0	0	0	0	112.9	D32 F37 F38 R49	D32-T35 WeakPolarHBondContact O-CB 3.4Å; D32-T35 WeakPolarHBondContact O-CG2 3.43Å; D32-T35 PolarHBondContact O-N 2.76Å; D32-T35 VanDerWaalsContact O-N 3.14Å; D32-T35 PolarHBondContact O-OG1 3.46Å; T35-F37 PolarHBondContact O-N 3.38Å; T35-F38 CarbonylContact C-O 3.57Å; T35-R49 PolarHBondContact O-NE 2.57Å
36	T	86.3	Confident	78	Confident	98 Å²	98	62.5 Å²	62.5	60%	0.601	42%	0.416	S	S	*	.	G	3₁₀ helix	trans	-57.5	-36.8	168.8	-48.8	0	0	0	0	112.3	S33 F34 R49	S33-T36 WeakPolarHBondContact O-CB 3.4Å; S33-T36 PolarHBondContact O-OG1 3.04Å; F34-T36 PolarHBondContact O-N 3.49Å; F34-T36 VanDerWaalsContact O-N 3.09Å; T36-R49 WeakPolarHBondContact O-CD 3.43Å
37	F	90.8	Very high	79.4	Confident	87 Å²	87	59.3 Å²	59.3	38%	0.382	40%	0.396	S	S	.	.	T	Hydrogen-bonded Turn	trans	-104.8	-22.1	-175.4	-65.4	-77.3	0	0	0	113.4	W6 Y9 F34 T35 R49	W6-F37 HydrophobicContact CH2-CB 4.13Å; W6-F37 HydrophobicContact CZ3-CB 4.25Å; Y9-F37 AromaticContact CE2-CD1 3.99Å; Y9-F37 HydrophobicContact CE2-CD1 3.99Å; Y9-F37 HydrophobicContact CE2-CE1 4.13Å; Y9-F37 HydrophobicContact CE2-CG 4.25Å; F34-F37 PolarHBondContact O-N 3.38Å; T35-F37 PolarHBondContact O-N 3.38Å; F37-R49 WeakPolarHBondContact O-CB 3.43Å; F37-R49 PolarHBondContact O-N 3.21Å
38	F	91.3	Very high	80.9	Confident	2 Å²	2	53.7 Å²	53.7	1%	0.009	37%	0.367	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.1	144.3	-178.1	-64.3	-93.5	0	0	0	112.3	W6 I15 F34 T35 H46 V47 P48 R49	W6-F38 HydrophobicContact CE3-CE1 4.15Å; W6-F38 AromaticContact CE3-CZ 3.86Å; W6-F38 HydrophobicContact CE3-CZ 3.86Å; W6-F38 AromaticContact CZ3-CE1 3.95Å; W6-F38 HydrophobicContact CZ3-CE1 3.95Å; W6-F38 AromaticContact CZ3-CE2 3.99Å; W6-F38 HydrophobicContact CZ3-CE2 3.99Å; W6-F38 AromaticContact CZ3-CZ 3.64Å; W6-F38 HydrophobicContact CZ3-CZ 3.64Å; I15-F38 HydrophobicContact CD1-CD1 3.87Å; I15-F38 HydrophobicContact CD1-CD2 3.9Å; I15-F38 HydrophobicContact CD1-CE1 3.63Å; I15-F38 HydrophobicContact CD1-CE2 3.69Å; I15-F38 HydrophobicContact CD1-CG 4Å; I15-F38 HydrophobicContact CD1-CZ 3.55Å; F34-F38 PolarHBondContact O-N 3.29Å; F34-F38 VanDerWaalsContact O-N 3.15Å; T35-F38 CarbonylContact C-O 3.57Å; F38-H46 HydrophobicContact CB-CB 4.28Å; F38-H46 HydrophobicContact CD1-CB 4.09Å; F38-H46 HydrophobicContact CG-CB 4.42Å; F38-V47 CarbonylContact C-O 3.57Å; F38-V47 WeakPolarHBondContact CA-O 3.04Å; F38-P48 HydrophobicContact CD1-CG 4.15Å; F38-P48 HydrophobicContact CE1-CG 3.8Å; F38-R49 PolarHBondContact O-NE 2.94Å; F38-R49 PolarHBondContact O-NH2 3.03Å
39	C	90.5	Very high	82.6	Confident	45 Å²	45	57.3 Å²	57.3	30%	0.304	36%	0.359	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.3	128.6	162.8	-67.1	0	0	0	0	108.9	H46 V47 R49	C39-H46 CarbonylContact O-C 2.95Å; C39-H46 WeakPolarHBondContact O-CA 3.34Å; C39-V47 PolarHBondContact N-O 3.25Å; C39-V47 PolarHBondContact O-N 2.88Å; C39-R49 VanDerWaalsContact SG-CG 3.58Å; C39-R49 PolarHBondContact SG-NH1 2.83Å; C39-R49 PolarHBondContact SG-NH2 2.88Å
40	E	88.5	Confident	84.1	Confident	61 Å²	61	55.7 Å²	55.7	29%	0.285	34%	0.341	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.3	131.2	167	-158.8	-163.1	162	0	0	109.8	I27 G28 K45	I27-E40 VanDerWaalsContact CA-OE1 3.3Å; I27-E40 WeakPolarHBondContact CA-OE1 3.25Å; I27-E40 WeakPolarHBondContact CG2-OE1 3Å; G28-E40 PolarHBondContact N-OE1 3.3Å; G28-E40 PolarHBondContact N-OE2 3.28Å; E40-K45 CarbonylContact C-O 3.54Å; E40-K45 WeakPolarHBondContact CA-O 3.4Å
41	T	86.9	Confident	86	Confident	42 Å²	42	58.1 Å²	58.1	26%	0.258	35%	0.347	S	S	.	.	P	Polyproline II helix	trans	-86.8	160.9	168.9	69.4	0	0	0	0	110	A43 G44 K45 V47	T41-A43 PolarHBondContact O-N 2.86Å; T41-A43 PolarHBondContact OG1-N 3.01Å; T41-G44 PolarHBondContact O-N 3.06Å; T41-K45 HydrophobicContact CG2-CB 4.34Å; T41-K45 PolarHBondContact N-O 2.78Å; T41-K45 VanDerWaalsContact OG1-CB 3.31Å; T41-K45 WeakPolarHBondContact OG1-CB 3.49Å; T41-K45 PolarHBondContact OG1-N 3.34Å; T41-K45 PolarHBondContact OG1-O 3.48Å; T41-V47 HydrophobicContact CG2-CG2 4.05Å
42	G	82.1	Confident	87.7	Confident	88 Å²	88	51.7 Å²	51.7	91%	0.907	31%	0.311	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61	-7.8	175	0	0	0	0	0	115.4
43	A	85.9	Confident	88.9	Confident	76 Å²	76	52.9 Å²	52.9	63%	0.628	32%	0.32	S	S	*	.	T	Hydrogen-bonded Turn	trans	-96.5	12	174	0	0	0	0	0	113.3	T41 K45	T41-A43 PolarHBondContact O-N 2.86Å; T41-A43 PolarHBondContact OG1-N 3.01Å; A43-K45 PolarHBondContact O-N 2.8Å
44	G	85.8	Confident	89.8	Confident	6 Å²	6	50 Å²	50	6%	0.062	30%	0.298	C	S	.	.	S	Bend	trans	74.9	6.8	-178.4	0	0	0	0	0	114.5	T41 H46	T41-G44 PolarHBondContact O-N 3.06Å; G44-H46 PolarHBondContact O-ND1 3Å
45	K	91.1	Very high	90.6	Very high	48 Å²	48	53.4 Å²	53.4	21%	0.209	32%	0.316	C	S	.	.			trans	-80.7	127.3	178.2	-175.4	-173.1	178.3	-168.6	0	110.4	D18 E40 T41 A43 V47 Q70	D18-K45 VanDerWaalsContact O-CE 3.25Å; D18-K45 WeakPolarHBondContact O-CE 3.49Å; D18-K45 WeakPolarHBondContact O-CG 3.26Å; E40-K45 CarbonylContact C-O 3.54Å; E40-K45 WeakPolarHBondContact CA-O 3.4Å; T41-K45 HydrophobicContact CG2-CB 4.34Å; T41-K45 PolarHBondContact N-O 2.78Å; T41-K45 VanDerWaalsContact OG1-CB 3.31Å; T41-K45 WeakPolarHBondContact OG1-CB 3.49Å; T41-K45 PolarHBondContact OG1-N 3.34Å; T41-K45 PolarHBondContact OG1-O 3.48Å; A43-K45 PolarHBondContact O-N 2.8Å; K45-V47 HydrophobicContact CD-CG2 4.01Å; K45-V47 HydrophobicContact CG-CG2 4.08Å; K45-Q70 WeakPolarHBondContact CE-O 3.12Å; K45-Q70 PolarHBondContact NZ-O 3.15Å
46	H	92.2	Very high	91.1	Very high	5 Å²	5	53.1 Å²	53.1	2%	0.023	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.3	115	173.5	-66	78.4	0	0	0	110	I15 G19 D24 F34 F38 C39 G44	I15-H46 HydrophobicContact CD1-CB 4.05Å; I15-H46 HydrophobicContact CG1-CB 4.47Å; I15-H46 HydrophobicContact CG2-CB 4.21Å; G19-H46 WeakPolarHBondContact O-CB 3.31Å; G19-H46 PolarHBondContact O-N 2.83Å; D24-H46 IonicContact OD2-CE1 3.5Å; D24-H46 IonicContact OD2-NE2 3.53Å; F34-H46 AromaticContact CE2-CD2 3.81Å; F34-H46 AromaticContact CE2-NE2 3.64Å; F38-H46 HydrophobicContact CB-CB 4.28Å; F38-H46 HydrophobicContact CD1-CB 4.09Å; F38-H46 HydrophobicContact CG-CB 4.42Å; C39-H46 CarbonylContact O-C 2.95Å; C39-H46 WeakPolarHBondContact O-CA 3.34Å; G44-H46 PolarHBondContact O-ND1 3Å
47	V	94.2	Very high	91.4	Very high	1 Å²	1	50.7 Å²	50.7	1%	0.006	30%	0.297	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.9	127	-178.4	-177.9	0	0	0	0	110	F38 C39 T41 K45 R49 L71 H73	F38-V47 CarbonylContact C-O 3.57Å; F38-V47 WeakPolarHBondContact CA-O 3.04Å; C39-V47 PolarHBondContact N-O 3.25Å; C39-V47 PolarHBondContact O-N 2.88Å; T41-V47 HydrophobicContact CG2-CG2 4.05Å; K45-V47 HydrophobicContact CD-CG2 4.01Å; K45-V47 HydrophobicContact CG-CG2 4.08Å; V47-R49 PolarHBondContact O-N 2.78Å; V47-L71 WeakPolarHBondContact CG1-O 3.26Å; V47-H73 WeakPolarHBondContact CG1-CD2 3.49Å
48	P	95.4	Very high	91.5	Very high	0 Å²	0	50.5 Å²	50.5	0%	0	30%	0.303	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-54	136.5	175.9	-31.6	38.7	0	0	0	113.5	W6 F38 A50 L71 F72 Q76	W6-P48 HydrophobicContact CD2-CB 3.92Å; W6-P48 HydrophobicContact CD2-CG 4.16Å; W6-P48 HydrophobicContact CE3-CB 3.71Å; W6-P48 HydrophobicContact CE3-CG 3.77Å; W6-P48 HydrophobicContact CH2-CB 3.75Å; W6-P48 HydrophobicContact CZ2-CB 3.97Å; W6-P48 HydrophobicContact CZ3-CB 3.61Å; W6-P48 HydrophobicContact CZ3-CG 4.03Å; F38-P48 HydrophobicContact CD1-CG 4.15Å; F38-P48 HydrophobicContact CE1-CG 3.8Å; P48-A50 HydrophobicContact CB-CB 4.11Å; P48-A50 PolarHBondContact O-N 3.08Å; P48-L71 WeakPolarHBondContact CD-O 3.41Å; P48-L71 HydrophobicContact CG-CD1 4.22Å; P48-L71 HydrophobicContact CG-CD2 3.67Å; P48-L71 HydrophobicContact CG-CG 3.65Å; P48-F72 HydrophobicContact CB-CD1 3.96Å; P48-F72 HydrophobicContact CB-CE1 3.73Å; P48-F72 HydrophobicContact CG-CD1 3.89Å; P48-F72 HydrophobicContact CG-CE1 3.58Å; P48-F72 HydrophobicContact CG-CZ 4.35Å; P48-Q76 PolarHBondContact O-NE2 3.49Å
49	R	94.4	Very high	91.5	Very high	146 Å²	146	53.8 Å²	53.8	55%	0.551	32%	0.323	S	S	*	.	S	Bend	trans	-80.2	65.3	166	-63.3	175.9	-172.8	-83.6	-2.1	109.3	T35 T36 F37 F38 C39 V47	T35-R49 PolarHBondContact O-NE 2.57Å; T36-R49 WeakPolarHBondContact O-CD 3.43Å; F37-R49 WeakPolarHBondContact O-CB 3.43Å; F37-R49 PolarHBondContact O-N 3.21Å; F38-R49 PolarHBondContact O-NE 2.94Å; F38-R49 PolarHBondContact O-NH2 3.03Å; C39-R49 VanDerWaalsContact SG-CG 3.58Å; C39-R49 PolarHBondContact SG-NH1 2.83Å; C39-R49 PolarHBondContact SG-NH2 2.88Å; V47-R49 PolarHBondContact O-N 2.78Å
50	A	94	Very high	91.7	Very high	13 Å²	13	51.8 Å²	51.8	11%	0.107	31%	0.309	C	S	.	.			trans	-130.9	154.5	-176.3	0	0	0	0	0	111.6	W6 P48 F52 Q76	W6-A50 HydrophobicContact CZ2-CB 3.59Å; P48-A50 HydrophobicContact CB-CB 4.11Å; P48-A50 PolarHBondContact O-N 3.08Å; A50-F52 HydrophobicContact CB-CE2 4.13Å; A50-Q76 WeakPolarHBondContact O-CB 3.37Å; A50-Q76 WeakPolarHBondContact O-CG 3.08Å; A50-Q76 PolarHBondContact O-NE2 3.05Å
51	V	95.1	Very high	92	Very high	98 Å²	98	51.7 Å²	51.7	59%	0.594	31%	0.311	S	S	*	.			trans	-130.2	130.5	167.7	-177.1	0	0	0	0	107.8	V53 I78	V51-V53 HydrophobicContact CG1-CG2 3.76Å; V51-I78 HydrophobicContact CG1-CD1 4.02Å
52	F	94.3	Very high	92.3	Very high	29 Å²	29	56 Å²	56	13%	0.127	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.5	129	171.4	-66.1	-102.4	0	0	0	108.5	W6 A50 I60 I63 F72 Q76 L77 I78	W6-F52 AromaticContact CD1-CZ 3.72Å; A50-F52 HydrophobicContact CB-CE2 4.13Å; F52-I60 HydrophobicContact CB-CD1 3.45Å; F52-I60 VanDerWaalsContact CB-CD1 3.45Å; F52-I60 HydrophobicContact CG-CD1 4.43Å; F52-I63 HydrophobicContact CD1-CD1 3.52Å; F52-I63 HydrophobicContact CE1-CD1 3.63Å; F52-I63 HydrophobicContact CG-CD1 4.02Å; F52-I63 HydrophobicContact CZ-CD1 4.22Å; F52-F72 HydrophobicContact CD2-CE1 4.5Å; F52-F72 AromaticContact CE2-CD1 3.89Å; F52-F72 HydrophobicContact CE2-CD1 3.89Å; F52-F72 AromaticContact CE2-CE1 3.48Å; F52-F72 HydrophobicContact CE2-CE1 3.48Å; F52-F72 VanDerWaalsContact CE2-CE1 3.48Å; F52-F72 HydrophobicContact CE2-CE2 4.49Å; F52-F72 AromaticContact CE2-CZ 3.82Å; F52-F72 HydrophobicContact CE2-CZ 3.82Å; F52-F72 HydrophobicContact CZ-CE1 4.09Å; F52-F72 HydrophobicContact CZ-CZ 4.02Å; F52-Q76 PolarHBondContact N-O 3.37Å; F52-L77 HydrophobicContact CB-CD2 3.84Å; F52-L77 HydrophobicContact CD2-CD2 3.64Å; F52-L77 HydrophobicContact CE2-CD2 4.48Å; F52-L77 HydrophobicContact CG-CD2 3.97Å; F52-I78 PolarHBondContact O-N 3.44Å
53	V	94.4	Very high	92.9	Very high	99 Å²	99	52.3 Å²	52.3	60%	0.6	29%	0.287	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-130.4	126.2	-179.5	-172.3	0	0	0	0	107.7	V51 I78	V51-V53 HydrophobicContact CG1-CG2 3.76Å; V53-I78 WeakPolarHBondContact CA-O 3.44Å; V53-I78 HydrophobicContact CG1-CB 4.47Å; V53-I78 HydrophobicContact CG1-CG2 4.47Å; V53-I78 HydrophobicContact CG2-CB 4.36Å; V53-I78 HydrophobicContact CG2-CD1 4.35Å
54	D	94.4	Very high	93.3	Very high	42 Å²	42	52.5 Å²	52.5	23%	0.225	27%	0.272	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.2	150	171.2	-153.3	-39.9	0	0	0	109.5	E56 V59 I60 I78 T79 G80	D54-E56 VanDerWaalsContact C-N 3.3Å; D54-E56 WeakPolarHBondContact CB-O 3.38Å; D54-E56 PolarHBondContact OD1-N 3.27Å; D54-V59 WeakPolarHBondContact OD2-CB 3.46Å; D54-I60 HydrophobicContact CB-CD1 4.18Å; D54-I60 HydrophobicContact CB-CG1 3.64Å; D54-I78 PolarHBondContact N-O 2.87Å; D54-T79 CarbonylContact O-C 3.43Å; D54-T79 VanDerWaalsContact O-CA 3.23Å; D54-T79 WeakPolarHBondContact O-CA 3.44Å; D54-G80 PolarHBondContact O-N 3.23Å
55	L	93.3	Very high	93.7	Very high	86 Å²	86	58.3 Å²	58.3	45%	0.45	30%	0.302	S	S	.	.	S	Bend	trans	-83.1	-15.1	177.6	-64.5	-179	0	0	0	111.9	G80 K81 E82 A84	L55-G80 CarbonylContact O-C 3.55Å; L55-G80 WeakPolarHBondContact O-CA 3.48Å; L55-G80 PolarHBondContact O-N 2.84Å; L55-K81 PolarHBondContact O-N 3.49Å; L55-E82 WeakPolarHBondContact CB-O 3.47Å; L55-E82 CarbonylContact O-C 3.59Å; L55-E82 PolarHBondContact O-N 3.38Å; L55-E82 VanDerWaalsContact O-O 3.09Å; L55-A84 HydrophobicContact CD1-CB 3.73Å
56	E	92.9	Very high	93.8	Very high	43 Å²	43	56.9 Å²	56.9	20%	0.201	30%	0.3	C	S	.	.	S	Bend	trans	-127.7	154.2	175	75.1	79.2	-155.3	0	0	111	D54 T58 V59 D83	D54-E56 VanDerWaalsContact C-N 3.3Å; D54-E56 WeakPolarHBondContact CB-O 3.38Å; D54-E56 PolarHBondContact OD1-N 3.27Å; E56-T58 VanDerWaalsContact CD-N 3.27Å; E56-T58 WeakPolarHBondContact OE1-CB 3.3Å; E56-T58 PolarHBondContact OE1-N 3.28Å; E56-T58 PolarHBondContact OE1-OG1 2.88Å; E56-T58 WeakPolarHBondContact OE2-CA 3.47Å; E56-T58 WeakPolarHBondContact OE2-CB 3.49Å; E56-T58 PolarHBondContact OE2-N 2.75Å; E56-T58 PolarHBondContact OE2-OG1 3.14Å; E56-V59 PolarHBondContact OE1-N 3.15Å; E56-D83 HydrophobicContact CB-CB 4.16Å; E56-D83 HydrophobicContact CG-CB 4.33Å
57	P	91.8	Very high	93.9	Very high	48 Å²	48	61.7 Å²	61.7	31%	0.312	33%	0.332	S	S	.	.	S	Bend	trans	-79.3	-20.1	-168.3	30.4	-35.6	0	0	0	115.4	V59 I60 D61 T79	P57-V59 PolarHBondContact O-N 3.09Å; P57-I60 PolarHBondContact O-N 3.06Å; P57-D61 VanDerWaalsContact O-CB 3.26Å; P57-D61 WeakPolarHBondContact O-CB 3.44Å; P57-D61 VanDerWaalsContact O-CG 3.27Å; P57-D61 PolarHBondContact O-N 2.87Å; P57-T79 HydrophobicContact CB-CG2 4.36Å
58	T	92.9	Very high	93.9	Very high	83 Å²	83	62.4 Å²	62.4	51%	0.509	34%	0.335	S	S	.	.	H	α-helix	trans	-57.5	-52.8	-165.3	-49.1	0	0	0	0	112	E56 I60 D61 E62	E56-T58 VanDerWaalsContact CD-N 3.27Å; E56-T58 WeakPolarHBondContact OE1-CB 3.3Å; E56-T58 PolarHBondContact OE1-N 3.28Å; E56-T58 PolarHBondContact OE1-OG1 2.88Å; E56-T58 WeakPolarHBondContact OE2-CA 3.47Å; E56-T58 WeakPolarHBondContact OE2-CB 3.49Å; E56-T58 PolarHBondContact OE2-N 2.75Å; E56-T58 PolarHBondContact OE2-OG1 3.14Å; T58-I60 PolarHBondContact O-N 2.86Å; T58-D61 PolarHBondContact O-N 3.44Å; T58-E62 PolarHBondContact O-N 2.92Å; T58-E62 VanDerWaalsContact O-N 3.15Å
59	V	92.2	Very high	93.9	Very high	70 Å²	70	69.2 Å²	69.2	42%	0.424	36%	0.36	S	S	.	.	H	α-helix	trans	-65.9	-38.7	-177.2	179.7	0	0	0	0	112.1	D54 E56 P57	D54-V59 WeakPolarHBondContact OD2-CB 3.46Å; E56-V59 PolarHBondContact OE1-N 3.15Å; P57-V59 PolarHBondContact O-N 3.09Å
60	I	93.9	Very high	93.9	Very high	4 Å²	4	66.8 Å²	66.8	2%	0.021	36%	0.355	C	S	.	.	H	α-helix	trans	-73.3	-34.5	179.1	-59.9	-63.2	0	0	0	111.1	F52 D54 P57 T58 E62 I63 R64 L77 T79	F52-I60 HydrophobicContact CB-CD1 3.45Å; F52-I60 VanDerWaalsContact CB-CD1 3.45Å; F52-I60 HydrophobicContact CG-CD1 4.43Å; D54-I60 HydrophobicContact CB-CD1 4.18Å; D54-I60 HydrophobicContact CB-CG1 3.64Å; P57-I60 PolarHBondContact O-N 3.06Å; T58-I60 PolarHBondContact O-N 2.86Å; I60-E62 VanDerWaalsContact C-N 3.28Å; I60-E62 PolarHBondContact O-N 2.92Å; I60-I63 HydrophobicContact CD1-CD1 4.45Å; I60-I63 WeakPolarHBondContact O-CA 3.47Å; I60-I63 WeakPolarHBondContact O-CB 3.31Å; I60-I63 PolarHBondContact O-N 2.64Å; I60-R64 HydrophobicContact CG2-CG 4.3Å; I60-R64 WeakPolarHBondContact O-CG 3.41Å; I60-R64 PolarHBondContact O-N 3.43Å; I60-L77 HydrophobicContact CG2-CB 3.71Å; I60-T79 HydrophobicContact CB-CG2 3.32Å; I60-T79 HydrophobicContact CG1-CG2 3.48Å; I60-T79 VanDerWaalsContact CG1-CG2 3.48Å; I60-T79 HydrophobicContact CG2-CG2 3.57Å
61	D	93.9	Very high	94	Very high	58 Å²	58	66.1 Å²	66.1	31%	0.31	35%	0.35	S	S	.	.	H	α-helix	trans	-67.7	-28.9	177.4	-78.3	-8.1	0	0	0	112	P57 T58 I63 R64 N65	P57-D61 VanDerWaalsContact O-CB 3.26Å; P57-D61 WeakPolarHBondContact O-CB 3.44Å; P57-D61 VanDerWaalsContact O-CG 3.27Å; P57-D61 PolarHBondContact O-N 2.87Å; T58-D61 PolarHBondContact O-N 3.44Å; D61-I63 VanDerWaalsContact C-N 3.27Å; D61-I63 PolarHBondContact O-N 2.95Å; D61-R64 PolarHBondContact O-N 3.22Å; D61-R64 WeakPolarHBondContact OD1-CD 3.42Å; D61-R64 IonicContact OD1-CZ 3.76Å; D61-R64 IonicContact OD1-NE 3.99Å; D61-R64 IonicContact OD1-NH1 2.81Å; D61-R64 PolarHBondContact OD1-NH1 3.43Å; D61-N65 WeakPolarHBondContact O-CB 3.23Å; D61-N65 PolarHBondContact O-N 3.13Å; D61-N65 PolarHBondContact O-ND2 2.98Å
62	E	94.4	Very high	94	Very high	134 Å²	134	61.9 Å²	61.9	63%	0.626	32%	0.323	S	S	*	.	H	α-helix	trans	-60.5	-37.8	168	-69.7	-177.9	174.8	0	0	111.9	T58 I60 G66	T58-E62 PolarHBondContact O-N 2.92Å; T58-E62 VanDerWaalsContact O-N 3.15Å; I60-E62 VanDerWaalsContact C-N 3.28Å; I60-E62 PolarHBondContact O-N 2.92Å; E62-G66 VanDerWaalsContact O-CA 3.24Å; E62-G66 WeakPolarHBondContact O-CA 3.24Å; E62-G66 PolarHBondContact O-N 3.41Å
63	I	93.4	Very high	94	Very high	9 Å²	9	63.5 Å²	63.5	5%	0.046	33%	0.331	C	S	.	.	H	α-helix	trans	-72.3	-44.9	176.5	-56	172.7	0	0	0	110.2	F52 I60 D61 N65 G66 R69 F72 L77	F52-I63 HydrophobicContact CD1-CD1 3.52Å; F52-I63 HydrophobicContact CE1-CD1 3.63Å; F52-I63 HydrophobicContact CG-CD1 4.02Å; F52-I63 HydrophobicContact CZ-CD1 4.22Å; I60-I63 HydrophobicContact CD1-CD1 4.45Å; I60-I63 WeakPolarHBondContact O-CA 3.47Å; I60-I63 WeakPolarHBondContact O-CB 3.31Å; I60-I63 PolarHBondContact O-N 2.64Å; D61-I63 VanDerWaalsContact C-N 3.27Å; D61-I63 PolarHBondContact O-N 2.95Å; I63-N65 PolarHBondContact O-N 3.29Å; I63-G66 PolarHBondContact O-N 3.12Å; I63-R69 WeakPolarHBondContact O-CA 3.45Å; I63-F72 HydrophobicContact CG2-CD2 3.71Å; I63-F72 HydrophobicContact CG2-CE2 3.77Å; I63-L77 HydrophobicContact CG2-CD1 4.28Å; I63-L77 HydrophobicContact CG2-CD2 4.29Å
64	R	94.6	Very high	93.9	Very high	81 Å²	81	63.8 Å²	63.8	31%	0.306	34%	0.335	S	S	.	.	H	α-helix	trans	-63.7	-26.9	179.7	-68.8	173.4	179.4	155.5	-0.1	113.3	I60 D61 R69 L77 T79	I60-R64 HydrophobicContact CG2-CG 4.3Å; I60-R64 WeakPolarHBondContact O-CG 3.41Å; I60-R64 PolarHBondContact O-N 3.43Å; D61-R64 PolarHBondContact O-N 3.22Å; D61-R64 WeakPolarHBondContact OD1-CD 3.42Å; D61-R64 IonicContact OD1-CZ 3.76Å; D61-R64 IonicContact OD1-NE 3.99Å; D61-R64 IonicContact OD1-NH1 2.81Å; D61-R64 PolarHBondContact OD1-NH1 3.43Å; R64-R69 WeakPolarHBondContact O-CB 3.35Å; R64-L77 HydrophobicContact CG-CD1 3.62Å; R64-L77 PolarHBondContact NH2-O 3.43Å; R64-T79 PolarHBondContact NH2-OG1 3.24Å
65	N	94.8	Very high	93.8	Very high	128 Å²	128	69.1 Å²	69.1	68%	0.684	36%	0.359	S	S	*	.	H	α-helix	trans	-107.8	-3.4	179.4	-62.2	-56.4	0	0	0	113.2	D61 I63	D61-N65 WeakPolarHBondContact O-CB 3.23Å; D61-N65 PolarHBondContact O-N 3.13Å; D61-N65 PolarHBondContact O-ND2 2.98Å; I63-N65 PolarHBondContact O-N 3.29Å
66	G	94	Very high	93.9	Very high	18 Å²	18	66.6 Å²	66.6	19%	0.186	35%	0.345	C	S	.	.	S	Bend	trans	-80.8	-179.2	-176.1	0	0	0	0	0	114.3	E62 I63 Y68 R69	E62-G66 VanDerWaalsContact O-CA 3.24Å; E62-G66 WeakPolarHBondContact O-CA 3.24Å; E62-G66 PolarHBondContact O-N 3.41Å; I63-G66 PolarHBondContact O-N 3.12Å; G66-Y68 PolarHBondContact O-N 3.29Å; G66-R69 VanDerWaalsContact O-CB 3.26Å; G66-R69 WeakPolarHBondContact O-CB 3.5Å; G66-R69 VanDerWaalsContact O-CG 3.31Å; G66-R69 WeakPolarHBondContact O-CG 3.41Å; G66-R69 PolarHBondContact O-N 3.19Å; G66-R69 VanDerWaalsContact O-N 3.08Å
67	P	93.9	Very high	94	Very high	105 Å²	105	65 Å²	65	68%	0.682	34%	0.337	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.2	-36.2	179.9	-24.6	34.3	0	0	0	113.2	P17 R69	P17-P67 WeakPolarHBondContact CB-O 3.48Å; P67-R69 VanDerWaalsContact C-N 3.34Å
68	Y	94.2	Very high	94.2	Very high	17 Å²	17	66.9 Å²	66.9	7%	0.067	34%	0.344	C	S	.	.	T	Hydrogen-bonded Turn	trans	-92.6	18	-179.5	-67.3	-83.2	0	0	0	113.6	E7 C10 P17 G66 Q70 L71	E7-Y68 HydrophobicContact CB-CE2 3.76Å; E7-Y68 HydrophobicContact CG-CE2 3.74Å; C10-Y68 HydrophobicContact CB-CE1 3.92Å; P17-Y68 HydrophobicContact CB-CD1 3.82Å; P17-Y68 HydrophobicContact CB-CE1 3.89Å; P17-Y68 HydrophobicContact CB-CG 4.39Å; P17-Y68 HydrophobicContact CG-CD1 4.43Å; P17-Y68 HydrophobicContact CG-CE1 4Å; G66-Y68 PolarHBondContact O-N 3.29Å; Y68-Q70 PolarHBondContact O-N 3.08Å; Y68-L71 HydrophobicContact CD1-CB 4.26Å; Y68-L71 HydrophobicContact CD1-CD2 3.72Å; Y68-L71 HydrophobicContact CD1-CG 4.49Å; Y68-L71 HydrophobicContact CE1-CD2 4.48Å; Y68-L71 HydrophobicContact CG-CD2 4.37Å; Y68-L71 VanDerWaalsContact O-CB 3.23Å; Y68-L71 WeakPolarHBondContact O-CB 3.46Å; Y68-L71 PolarHBondContact O-N 2.79Å
69	R	94.8	Very high	94.3	Very high	143 Å²	143	65.1 Å²	65.1	54%	0.54	33%	0.333	S	S	.	.	T	Hydrogen-bonded Turn	trans	-55.5	-24.7	179.5	65.6	-179.1	-174	78.5	4.5	114.7	I63 R64 G66 P67	I63-R69 WeakPolarHBondContact O-CA 3.45Å; R64-R69 WeakPolarHBondContact O-CB 3.35Å; G66-R69 VanDerWaalsContact O-CB 3.26Å; G66-R69 WeakPolarHBondContact O-CB 3.5Å; G66-R69 VanDerWaalsContact O-CG 3.31Å; G66-R69 WeakPolarHBondContact O-CG 3.41Å; G66-R69 PolarHBondContact O-N 3.19Å; G66-R69 VanDerWaalsContact O-N 3.08Å; P67-R69 VanDerWaalsContact C-N 3.34Å
70	Q	95.1	Very high	94.2	Very high	94 Å²	94	63.3 Å²	63.3	44%	0.439	33%	0.329	S	S	.	.	T	Hydrogen-bonded Turn	trans	-91	-12.8	179.2	-67.9	-175.7	81.1	0	0	112.2	D18 K45 Y68	D18-Q70 HydrophobicContact CB-CB 4.44Å; K45-Q70 WeakPolarHBondContact CE-O 3.12Å; K45-Q70 PolarHBondContact NZ-O 3.15Å; Y68-Q70 PolarHBondContact O-N 3.08Å
71	L	95.4	Very high	93.9	Very high	0 Å²	0	72.8 Å²	72.8	0%	0	37%	0.37	C	S	.	.	T	Hydrogen-bonded Turn	trans	-71	-45	-174.4	-174.5	66	0	0	0	111.8	C10 I15 V47 P48 Y68	C10-L71 VanDerWaalsContact SG-CD2 3.56Å; I15-L71 HydrophobicContact CG2-CD1 4.35Å; V47-L71 WeakPolarHBondContact CG1-O 3.26Å; P48-L71 WeakPolarHBondContact CD-O 3.41Å; P48-L71 HydrophobicContact CG-CD1 4.22Å; P48-L71 HydrophobicContact CG-CD2 3.67Å; P48-L71 HydrophobicContact CG-CG 3.65Å; Y68-L71 HydrophobicContact CD1-CB 4.26Å; Y68-L71 HydrophobicContact CD1-CD2 3.72Å; Y68-L71 HydrophobicContact CD1-CG 4.49Å; Y68-L71 HydrophobicContact CE1-CD2 4.48Å; Y68-L71 HydrophobicContact CG-CD2 4.37Å; Y68-L71 VanDerWaalsContact O-CB 3.23Å; Y68-L71 WeakPolarHBondContact O-CB 3.46Å; Y68-L71 PolarHBondContact O-N 2.79Å
72	F	94.6	Very high	93.5	Very high	8 Å²	8	78 Å²	78	4%	0.035	39%	0.392	C	S	.	.	S	Bend	trans	-90	152.9	-174.1	-54.4	-79	0	0	0	112.7	W6 P48 F52 I63 L77	W6-F72 HydrophobicContact CB-CE1 4.5Å; W6-F72 HydrophobicContact CB-CZ 3.99Å; W6-F72 HydrophobicContact CD2-CE1 4.48Å; W6-F72 HydrophobicContact CG-CE1 4.11Å; W6-F72 HydrophobicContact CG-CZ 4.05Å; P48-F72 HydrophobicContact CB-CD1 3.96Å; P48-F72 HydrophobicContact CB-CE1 3.73Å; P48-F72 HydrophobicContact CG-CD1 3.89Å; P48-F72 HydrophobicContact CG-CE1 3.58Å; P48-F72 HydrophobicContact CG-CZ 4.35Å; F52-F72 HydrophobicContact CD2-CE1 4.5Å; F52-F72 AromaticContact CE2-CD1 3.89Å; F52-F72 HydrophobicContact CE2-CD1 3.89Å; F52-F72 AromaticContact CE2-CE1 3.48Å; F52-F72 HydrophobicContact CE2-CE1 3.48Å; F52-F72 VanDerWaalsContact CE2-CE1 3.48Å; F52-F72 HydrophobicContact CE2-CE2 4.49Å; F52-F72 AromaticContact CE2-CZ 3.82Å; F52-F72 HydrophobicContact CE2-CZ 3.82Å; F52-F72 HydrophobicContact CZ-CE1 4.09Å; F52-F72 HydrophobicContact CZ-CZ 4.02Å; I63-F72 HydrophobicContact CG2-CD2 3.71Å; I63-F72 HydrophobicContact CG2-CE2 3.77Å; F72-L77 HydrophobicContact CB-CD1 4.39Å; F72-L77 HydrophobicContact CB-CD2 4.31Å; F72-L77 HydrophobicContact CB-CG 4.38Å; F72-L77 HydrophobicContact CG-CD2 4.47Å
73	H	94.4	Very high	93.2	Very high	64 Å²	64	76 Å²	76	30%	0.296	39%	0.386	S	S	.	.			trans	-73.5	135.5	164.9	-72.9	-66.7	0	0	0	109.7	V47 E75 Q76	V47-H73 WeakPolarHBondContact CG1-CD2 3.49Å; H73-E75 HydrophobicContact CB-CG 3.91Å; H73-E75 PolarHBondContact O-N 3.4Å; H73-E75 VanDerWaalsContact O-N 3.12Å; H73-Q76 HydrophobicContact CB-CG 4.04Å; H73-Q76 VanDerWaalsContact O-CB 3.3Å; H73-Q76 WeakPolarHBondContact O-CB 3.26Å; H73-Q76 PolarHBondContact O-N 3.38Å
74	P	93.1	Very high	92.8	Very high	105 Å²	105	77.5 Å²	77.5	68%	0.682	40%	0.4	S	S	*	.	G	3₁₀ helix	trans	-56.4	-31.4	179.3	-27.2	35	0	0	0	113.8	Q76 L77	P74-Q76 PolarHBondContact O-N 2.92Å; P74-L77 PolarHBondContact O-N 3.15Å; P74-L77 VanDerWaalsContact O-N 3.11Å
75	E	93.1	Very high	92.5	Very high	153 Å²	153	77.3 Å²	77.3	72%	0.715	42%	0.415	S	S	*	.	G	3₁₀ helix	trans	-68.6	-16.5	176.1	67.1	-147.2	-172.7	0	0	114.2	H73 L77	H73-E75 HydrophobicContact CB-CG 3.91Å; H73-E75 PolarHBondContact O-N 3.4Å; H73-E75 VanDerWaalsContact O-N 3.12Å; E75-L77 VanDerWaalsContact C-N 3.3Å
76	Q	93.8	Very high	92.2	Very high	33 Å²	33	79.3 Å²	79.3	15%	0.154	43%	0.426	C	S	.	.	G	3₁₀ helix	trans	-84.6	-5.5	172.7	-65.1	171.7	-39.2	0	0	112.5	P48 A50 F52 H73 P74	P48-Q76 PolarHBondContact O-NE2 3.49Å; A50-Q76 WeakPolarHBondContact O-CB 3.37Å; A50-Q76 WeakPolarHBondContact O-CG 3.08Å; A50-Q76 PolarHBondContact O-NE2 3.05Å; F52-Q76 PolarHBondContact N-O 3.37Å; H73-Q76 HydrophobicContact CB-CG 4.04Å; H73-Q76 VanDerWaalsContact O-CB 3.3Å; H73-Q76 WeakPolarHBondContact O-CB 3.26Å; H73-Q76 PolarHBondContact O-N 3.38Å; P74-Q76 PolarHBondContact O-N 2.92Å
77	L	95.4	Very high	91.7	Very high	10 Å²	10	83.4 Å²	83.4	5%	0.052	44%	0.444	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.7	89.2	-177	-59.4	-175.9	0	0	0	109.7	F52 I60 I63 R64 F72 P74 E75	F52-L77 HydrophobicContact CB-CD2 3.84Å; F52-L77 HydrophobicContact CD2-CD2 3.64Å; F52-L77 HydrophobicContact CE2-CD2 4.48Å; F52-L77 HydrophobicContact CG-CD2 3.97Å; I60-L77 HydrophobicContact CG2-CB 3.71Å; I63-L77 HydrophobicContact CG2-CD1 4.28Å; I63-L77 HydrophobicContact CG2-CD2 4.29Å; R64-L77 HydrophobicContact CG-CD1 3.62Å; R64-L77 PolarHBondContact NH2-O 3.43Å; F72-L77 HydrophobicContact CB-CD1 4.39Å; F72-L77 HydrophobicContact CB-CD2 4.31Å; F72-L77 HydrophobicContact CB-CG 4.38Å; F72-L77 HydrophobicContact CG-CD2 4.47Å; P74-L77 PolarHBondContact O-N 3.15Å; P74-L77 VanDerWaalsContact O-N 3.11Å; E75-L77 VanDerWaalsContact C-N 3.3Å
78	I	95.4	Very high	91.4	Very high	87 Å²	87	89.7 Å²	89.7	45%	0.446	46%	0.456	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.8	127.5	-170	-55.6	173.5	0	0	0	109.9	V51 F52 V53 D54	V51-I78 HydrophobicContact CG1-CD1 4.02Å; F52-I78 PolarHBondContact O-N 3.44Å; V53-I78 WeakPolarHBondContact CA-O 3.44Å; V53-I78 HydrophobicContact CG1-CB 4.47Å; V53-I78 HydrophobicContact CG1-CG2 4.47Å; V53-I78 HydrophobicContact CG2-CB 4.36Å; V53-I78 HydrophobicContact CG2-CD1 4.35Å; D54-I78 PolarHBondContact N-O 2.87Å
79	T	95	Very high	90.2	Very high	47 Å²	47	95.7 Å²	95.7	29%	0.288	51%	0.509	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.3	134.9	-178.5	49.8	0	0	0	0	111.7	D54 P57 I60 R64	D54-T79 CarbonylContact O-C 3.43Å; D54-T79 VanDerWaalsContact O-CA 3.23Å; D54-T79 WeakPolarHBondContact O-CA 3.44Å; P57-T79 HydrophobicContact CB-CG2 4.36Å; I60-T79 HydrophobicContact CB-CG2 3.32Å; I60-T79 HydrophobicContact CG1-CG2 3.48Å; I60-T79 VanDerWaalsContact CG1-CG2 3.48Å; I60-T79 HydrophobicContact CG2-CG2 3.57Å; R64-T79 PolarHBondContact NH2-OG1 3.24Å
80	G	91.2	Very high	90	Very high	32 Å²	32	93.4 Å²	93.4	33%	0.33	51%	0.507	S	S	.	.			trans	-81.4	-168.9	163.9	0	0	0	0	0	113.1	D54 L55	D54-G80 PolarHBondContact O-N 3.23Å; L55-G80 CarbonylContact O-C 3.55Å; L55-G80 WeakPolarHBondContact O-CA 3.48Å; L55-G80 PolarHBondContact O-N 2.84Å
81	K	87.2	Confident	89.7	Confident	202 Å²	202	93.3 Å²	93.3	88%	0.878	51%	0.511	S	S	*	.	S	Bend	trans	-113.4	-18.1	174.8	-67.8	-174.5	-179.8	-179.6	0	113.5	L55	L55-K81 PolarHBondContact O-N 3.49Å
82	E	86.8	Confident	89.4	Confident	168 Å²	168	98.5 Å²	98.5	79%	0.785	54%	0.539	S	S	*	.	S	Bend	trans	-135.1	127.4	-173.2	-68.9	-178.6	-179.7	0	0	107.8	L55	L55-E82 WeakPolarHBondContact CB-O 3.47Å; L55-E82 CarbonylContact O-C 3.59Å; L55-E82 PolarHBondContact O-N 3.38Å; L55-E82 VanDerWaalsContact O-O 3.09Å
83	D	86.1	Confident	89.1	Confident	91 Å²	91	103.8 Å²	103.8	49%	0.487	57%	0.569	S	S	.	*			trans	-71.3	156.3	175.4	177.3	29.7	0	0	0	111.1	E56 A85	E56-D83 HydrophobicContact CB-CB 4.16Å; E56-D83 HydrophobicContact CG-CB 4.33Å; D83-A85 PolarHBondContact O-N 2.96Å; D83-A85 VanDerWaalsContact O-N 3.11Å; D83-A85 PolarHBondContact OD2-N 3.11Å
84	A	85.3	Confident	88.8	Confident	41 Å²	41	106.3 Å²	106.3	34%	0.339	59%	0.586	S	S	.	*			trans	-60.8	-11.3	169.1	0	0	0	0	0	113.3	L55 N86 N87	L55-A84 HydrophobicContact CD1-CB 3.73Å; A84-N86 PolarHBondContact O-N 3.3Å; A84-N87 WeakPolarHBondContact O-CB 3.39Å; A84-N87 PolarHBondContact O-N 3.33Å
85	A	88.9	Confident	88.5	Confident	77 Å²	77	106.4 Å²	106.4	64%	0.636	58%	0.58	S	S	*	*	T	Hydrogen-bonded Turn	trans	55	38.6	178.7	0	0	0	0	0	112.7	D83 N87	D83-A85 PolarHBondContact O-N 2.96Å; D83-A85 VanDerWaalsContact O-N 3.11Å; D83-A85 PolarHBondContact OD2-N 3.11Å; A85-N87 PolarHBondContact O-N 3.06Å
86	N	88	Confident	88.2	Confident	170 Å²	170	103.1 Å²	103.1	91%	0.909	57%	0.57	S	S	*	*	T	Hydrogen-bonded Turn	trans	58.3	24.9	-173.4	-56.1	-71.3	0	0	0	114.7	A84	A84-N86 PolarHBondContact O-N 3.3Å
87	N	85.1	Confident	87.7	Confident	105 Å²	105	108.5 Å²	108.5	56%	0.561	60%	0.602	S	S	*	*			trans	-104.3	138.5	175	-170.1	4.5	0	0	0	111	A84 A85 A89	A84-N87 WeakPolarHBondContact O-CB 3.39Å; A84-N87 PolarHBondContact O-N 3.33Å; A85-N87 PolarHBondContact O-N 3.06Å; N87-A89 WeakPolarHBondContact OD1-CB 3.4Å; N87-A89 PolarHBondContact OD1-N 3.06Å; N87-A89 VanDerWaalsContact OD1-N 3.13Å
88	Y	87.4	Confident	87.1	Confident	237 Å²	237	116.7 Å²	116.7	93%	0.929	65%	0.648	S	S	*	*			trans	-91.3	-16.6	178.5	178.5	-99.7	0	0	0	113.7
89	A	68.9	Low	86.3	Confident	143 Å²	143	119.4 Å²	119.4	100%	1.182	67%	0.666	S	S	*	*			trans	-71.3	0	-161.5	0	0	0	0	0	116.5	N87	N87-A89 WeakPolarHBondContact OD1-CB 3.4Å; N87-A89 PolarHBondContact OD1-N 3.06Å; N87-A89 VanDerWaalsContact OD1-N 3.13Å

Retrieved 89 of 89 residues in 122.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).