A0A087WSN4_MOUSE Loading...

Coiled-coil domain containing 179

AlphaFold DB , UniProt , Accession A0A087WSN4, Species MOUSE (Mus musculus, Mouse), Gene Ccdc179, Length 32 aa.

						>A0A087WSN4_MOUSE|A0A087WSN4|Ccdc179
MCLRVKDEEPAQVYPEGPRRHHPSDVSTRQWT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	61.1	Low	67.4	Low	227 Å²	227	155.7 Å²	155.7	100%	1.118	81%	0.808	S	S	*	*				0	83.9	0	-69.5	-70.6	-87.4	0	0	108.1	L3	M1-L3 PolarHBondContact O-N 3.49Å
2	C	57.7	Low	68.4	Low	125 Å²	125	154.4 Å²	154.4	85%	0.845	80%	0.796	S	S	*	*			trans	-88.1	107.1	173.6	-61.2	0	0	0	0	107.1	R4	C2-R4 PolarHBondContact O-N 2.83Å
3	L	63.7	Low	69.5	Low	152 Å²	152	152 Å²	152	80%	0.796	79%	0.792	S	S	*	*			trans	-67.3	101.9	173.2	-64.8	175	0	0	0	106.9	M1 V5	M1-L3 PolarHBondContact O-N 3.49Å; L3-V5 PolarHBondContact O-N 2.99Å; L3-V5 HydrophobicContact CB-CG2 4.37Å
4	R	63.9	Low	70.2	Confident	241 Å²	241	152.4 Å²	152.4	91%	0.909	78%	0.779	S	S	*	*			trans	-69.5	79.5	164.9	-65.3	177.8	-179	169.1	-0.7	106.1	C2 K6	C2-R4 PolarHBondContact O-N 2.83Å; R4-K6 VanDerWaalsContact C-N 3.32Å; R4-K6 PolarHBondContact O-N 3.14Å
5	V	65.4	Low	71	Confident	124 Å²	124	146.7 Å²	146.7	75%	0.752	76%	0.756	S	S	*	*			trans	-59.8	107.3	162.6	-176	0	0	0	0	103.2	L3 D7	L3-V5 PolarHBondContact O-N 2.99Å; L3-V5 HydrophobicContact CB-CG2 4.37Å; V5-D7 PolarHBondContact O-N 2.99Å; V5-D7 VanDerWaalsContact O-N 3.14Å
6	K	64.1	Low	71.9	Confident	183 Å²	183	149.7 Å²	149.7	80%	0.796	77%	0.766	S	S	*	*			trans	-50.9	126.5	165.7	-84.7	177.3	166.6	-177.5	0	104.8	R4 E8	R4-K6 VanDerWaalsContact C-N 3.32Å; R4-K6 PolarHBondContact O-N 3.14Å; K6-E8 PolarHBondContact O-N 2.67Å
7	D	64.2	Low	72.4	Confident	164 Å²	164	143.2 Å²	143.2	88%	0.877	75%	0.745	S	S	*	*			trans	-65.8	64.6	175.5	-144.5	-49.7	0	0	0	107.7	V5 E9	V5-D7 PolarHBondContact O-N 2.99Å; V5-D7 VanDerWaalsContact O-N 3.14Å; D7-E9 PolarHBondContact O-N 3.07Å; D7-E9 VanDerWaalsContact O-N 3.09Å
8	E	70.2	Confident	72.8	Confident	169 Å²	169	142.7 Å²	142.7	79%	0.79	75%	0.752	S	S	*	*			trans	-71.5	104.3	175.3	-166.4	177.9	132	0	0	104.2	K6	K6-E8 PolarHBondContact O-N 2.67Å
9	E	75.2	Confident	73.1	Confident	144 Å²	144	145.4 Å²	145.4	67%	0.673	75%	0.751	S	S	*	*	P	Polyproline II helix	trans	-47.7	125.3	176.4	-167.8	-96	142.6	0	0	108	D7 A11	D7-E9 PolarHBondContact O-N 3.07Å; D7-E9 VanDerWaalsContact O-N 3.09Å; E9-A11 PolarHBondContact O-N 3.09Å
10	P	76	Confident	73.5	Confident	103 Å²	103	149.9 Å²	149.9	67%	0.669	76%	0.758	S	S	*	*	P	Polyproline II helix	trans	-60	120.2	-173.5	23.3	-32.8	0	0	0	108.7	Q12	P10-Q12 PolarHBondContact O-N 3.05Å; P10-Q12 VanDerWaalsContact O-N 3.14Å
11	A	79.5	Confident	73.9	Confident	81 Å²	81	149.3 Å²	149.3	67%	0.669	75%	0.752	S	S	*	*	P	Polyproline II helix	trans	-52.1	124.7	-178.2	0	0	0	0	0	110.8	E9 V13	E9-A11 PolarHBondContact O-N 3.09Å; A11-V13 WeakPolarHBondContact O-CG2 3.46Å; A11-V13 PolarHBondContact O-N 3.14Å
12	Q	80.1	Confident	74.8	Confident	140 Å²	140	142.3 Å²	142.3	65%	0.654	72%	0.716	S	S	*	*			trans	-63.7	110	176.7	-178	173.2	3	0	0	109.7	P10 Y14	P10-Q12 PolarHBondContact O-N 3.05Å; P10-Q12 VanDerWaalsContact O-N 3.14Å; Q12-Y14 HydrophobicContact CG-CE2 4.25Å; Q12-Y14 PolarHBondContact NE2-OH 2.77Å
13	V	81.8	Confident	75.8	Confident	123 Å²	123	143 Å²	143	75%	0.745	72%	0.719	S	S	*	*	P	Polyproline II helix	trans	-95.9	123.3	175.9	-171.3	0	0	0	0	109.5	A11	A11-V13 WeakPolarHBondContact O-CG2 3.46Å; A11-V13 PolarHBondContact O-N 3.14Å
14	Y	80.4	Confident	76.6	Confident	158 Å²	158	139.5 Å²	139.5	62%	0.62	71%	0.708	S	S	*	*	P	Polyproline II helix	trans	-85.7	144.6	170.1	-65	-83	0	0	0	109.8	Q12 E16	Q12-Y14 HydrophobicContact CG-CE2 4.25Å; Q12-Y14 PolarHBondContact NE2-OH 2.77Å; Y14-E16 PolarHBondContact O-N 3.12Å
15	P	82.3	Confident	77.4	Confident	67 Å²	67	131 Å²	131	44%	0.435	68%	0.681	S	S	.	*	P	Polyproline II helix	trans	-65.9	134.1	174.9	26.4	-32.6	0	0	0	110.6	G17 R19	P15-G17 PolarHBondContact O-N 3.14Å; P15-R19 HydrophobicContact CB-CG 4.32Å; P15-R19 HydrophobicContact CG-CG 3.62Å
16	E	84.7	Confident	77.8	Confident	194 Å²	194	131.1 Å²	131.1	91%	0.907	68%	0.681	S	S	*	*	S	Bend	trans	-68.3	11	-179.6	-62.1	-62	152.6	0	0	114.5	Y14	Y14-E16 PolarHBondContact O-N 3.12Å
17	G	81.1	Confident	78.1	Confident	40 Å²	40	126.8 Å²	126.8	41%	0.412	67%	0.674	S	S	.	*	S	Bend	trans	-171.9	-177.4	-174.7	0	0	0	0	0	114.9	P15 R19	P15-G17 PolarHBondContact O-N 3.14Å; G17-R19 PolarHBondContact O-N 3.11Å; G17-R19 VanDerWaalsContact O-N 3.11Å
18	P	79.4	Confident	78.2	Confident	134 Å²	134	125.3 Å²	125.3	87%	0.87	67%	0.671	S	S	*	*	P	Polyproline II helix	trans	-57.6	118.9	-178.1	-23.1	33.3	0	0	0	110.6	R20	P18-R20 PolarHBondContact O-N 2.93Å; P18-R20 VanDerWaalsContact O-N 3.14Å
19	R	78.6	Confident	77.9	Confident	194 Å²	194	125 Å²	125	73%	0.732	66%	0.662	S	S	*	*	P	Polyproline II helix	trans	-63.3	119.6	174.4	-67.8	178.6	72.2	96.1	-2.2	107.9	P15 G17 H21	P15-R19 HydrophobicContact CB-CG 4.32Å; P15-R19 HydrophobicContact CG-CG 3.62Å; G17-R19 PolarHBondContact O-N 3.11Å; G17-R19 VanDerWaalsContact O-N 3.11Å; R19-H21 PolarHBondContact O-N 3.45Å
20	R	81.1	Confident	77.5	Confident	234 Å²	234	126.5 Å²	126.5	88%	0.883	67%	0.67	S	S	*	*	P	Polyproline II helix	trans	-63.7	133.5	166.8	-74.3	-178.2	164.3	178	-4.7	107.7	P18 H22	P18-R20 PolarHBondContact O-N 2.93Å; P18-R20 VanDerWaalsContact O-N 3.14Å; R20-H22 PolarHBondContact O-N 3Å; R20-H22 VanDerWaalsContact O-N 3.12Å
21	H	82	Confident	76.7	Confident	138 Å²	138	130.8 Å²	130.8	64%	0.639	67%	0.672	S	S	*	*			trans	-60.5	114.8	174.4	-171.2	-83.7	0	0	0	108.6	R19 D25	R19-H21 PolarHBondContact O-N 3.45Å; H21-D25 PolarHBondContact CE1-O 3.14Å; H21-D25 PolarHBondContact NE2-O 3.47Å; H21-D25 WeakPolarHBondContact NE2-CB 3.27Å; H21-D25 VanDerWaalsContact NE2-CB 3.31Å; H21-D25 IonicContact CG-OD2 3.91Å; H21-D25 WeakPolarHBondContact CE1-CB 3.31Å; H21-D25 WeakPolarHBondContact CA-OD2 3.22Å
22	H	80.6	Confident	75.7	Confident	80 Å²	80	136.8 Å²	136.8	37%	0.37	70%	0.701	S	S	.	*			trans	-76.9	148.7	174.7	71.9	17.3	0	0	0	109.1	R20 S24 D25	R20-H22 PolarHBondContact O-N 3Å; R20-H22 VanDerWaalsContact O-N 3.12Å; H22-S24 PolarHBondContact O-N 3.11Å; H22-S24 VanDerWaalsContact NE2-OG 3.14Å; H22-S24 PolarHBondContact CE1-O 2.95Å; H22-S24 PolarHBondContact NE2-OG 3.46Å; H22-S24 PolarHBondContact ND1-OG 3.27Å; H22-S24 VanDerWaalsContact CG-OG 3.22Å; H22-S24 PolarHBondContact CE1-OG 3.4Å; H22-S24 VanDerWaalsContact CD2-OG 3.29Å; H22-S24 PolarHBondContact CD2-OG 2.74Å; H22-S24 PolarHBondContact ND1-N 3.27Å; H22-D25 PolarHBondContact ND1-OD1 3.02Å; H22-D25 PolarHBondContact O-N 2.94Å; H22-D25 WeakPolarHBondContact O-CB 3.31Å; H22-D25 VanDerWaalsContact O-CB 3.27Å; H22-D25 IonicContact NE2-OD1 3.65Å; H22-D25 VanDerWaalsContact ND1-OD2 3.11Å; H22-D25 PolarHBondContact ND1-OD2 3.39Å; H22-D25 IonicContact ND1-OD2 3.11Å; H22-D25 IonicContact ND1-OD1 3.27Å; H22-D25 PolarHBondContact ND1-N 3.29Å; H22-D25 VanDerWaalsContact ND1-CB 3.31Å; H22-D25 WeakPolarHBondContact ND1-CA 3.23Å; H22-D25 PolarHBondContact N-OD2 3.01Å; H22-D25 IonicContact CG-OD2 3.49Å; H22-D25 IonicContact CE1-OD2 3.68Å; H22-D25 PolarHBondContact CE1-OD1 3.2Å; H22-D25 IonicContact CE1-OD1 2.95Å; H22-D25 PolarHBondContact CE1-N 3Å; H22-D25 WeakPolarHBondContact CE1-CA 3.42Å; H22-D25 WeakPolarHBondContact ND1-CB 3.39Å
23	P	77.3	Confident	75.4	Confident	140 Å²	140	136.6 Å²	136.6	91%	0.909	70%	0.703	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.6	-23.4	-179.4	-25.5	34.5	0	0	0	113.9	D25	P23-D25 VanDerWaalsContact C-N 3.28Å; P23-D25 PolarHBondContact O-N 3.42Å
24	S	81.6	Confident	75.1	Confident	79 Å²	79	137.3 Å²	137.3	55%	0.552	70%	0.701	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.6	6.6	174.6	43.6	0	0	0	0	114.3	H22 V26	H22-S24 PolarHBondContact O-N 3.11Å; H22-S24 VanDerWaalsContact NE2-OG 3.14Å; H22-S24 PolarHBondContact CE1-O 2.95Å; H22-S24 PolarHBondContact NE2-OG 3.46Å; H22-S24 PolarHBondContact ND1-OG 3.27Å; H22-S24 VanDerWaalsContact CG-OG 3.22Å; H22-S24 PolarHBondContact CE1-OG 3.4Å; H22-S24 VanDerWaalsContact CD2-OG 3.29Å; H22-S24 PolarHBondContact CD2-OG 2.74Å; H22-S24 PolarHBondContact ND1-N 3.27Å; S24-V26 PolarHBondContact O-N 2.84Å
25	D	80.7	Confident	74.8	Confident	63 Å²	63	136.2 Å²	136.2	34%	0.337	71%	0.706	S	S	.	*			trans	-81.3	85.7	-173.6	-92.9	-42.3	0	0	0	104.4	H21 H22 P23 S27	H21-D25 PolarHBondContact CE1-O 3.14Å; H21-D25 PolarHBondContact NE2-O 3.47Å; H21-D25 WeakPolarHBondContact NE2-CB 3.27Å; H21-D25 VanDerWaalsContact NE2-CB 3.31Å; H21-D25 IonicContact CG-OD2 3.91Å; H21-D25 WeakPolarHBondContact CE1-CB 3.31Å; H21-D25 WeakPolarHBondContact CA-OD2 3.22Å; H22-D25 PolarHBondContact ND1-OD1 3.02Å; H22-D25 PolarHBondContact O-N 2.94Å; H22-D25 WeakPolarHBondContact O-CB 3.31Å; H22-D25 VanDerWaalsContact O-CB 3.27Å; H22-D25 IonicContact NE2-OD1 3.65Å; H22-D25 VanDerWaalsContact ND1-OD2 3.11Å; H22-D25 PolarHBondContact ND1-OD2 3.39Å; H22-D25 IonicContact ND1-OD2 3.11Å; H22-D25 IonicContact ND1-OD1 3.27Å; H22-D25 PolarHBondContact ND1-N 3.29Å; H22-D25 VanDerWaalsContact ND1-CB 3.31Å; H22-D25 WeakPolarHBondContact ND1-CA 3.23Å; H22-D25 PolarHBondContact N-OD2 3.01Å; H22-D25 IonicContact CG-OD2 3.49Å; H22-D25 IonicContact CE1-OD2 3.68Å; H22-D25 PolarHBondContact CE1-OD1 3.2Å; H22-D25 IonicContact CE1-OD1 2.95Å; H22-D25 PolarHBondContact CE1-N 3Å; H22-D25 WeakPolarHBondContact CE1-CA 3.42Å; H22-D25 WeakPolarHBondContact ND1-CB 3.39Å; P23-D25 VanDerWaalsContact C-N 3.28Å; P23-D25 PolarHBondContact O-N 3.42Å; D25-S27 VanDerWaalsContact C-N 3.28Å; D25-S27 PolarHBondContact O-N 2.86Å
26	V	72.4	Confident	74.4	Confident	126 Å²	126	140.2 Å²	140.2	76%	0.764	72%	0.722	S	S	*	*			trans	-70.7	95.3	173.1	-175.9	0	0	0	0	105.7	S24 T28	S24-V26 PolarHBondContact O-N 2.84Å; V26-T28 PolarHBondContact O-N 3.01Å
27	S	70.4	Confident	73.7	Confident	92 Å²	92	136.9 Å²	136.9	64%	0.643	71%	0.71	S	S	*	*			trans	-57.7	112.3	168.3	-175.3	0	0	0	0	107.3	D25 R29	D25-S27 VanDerWaalsContact C-N 3.28Å; D25-S27 PolarHBondContact O-N 2.86Å; S27-R29 PolarHBondContact O-N 2.92Å
28	T	66.1	Low	73.2	Confident	133 Å²	133	143.3 Å²	143.3	82%	0.816	73%	0.73	S	S	*	*			trans	-70.5	13.4	179.5	49.3	0	0	0	0	112.9	V26 Q30	V26-T28 PolarHBondContact O-N 3.01Å; T28-Q30 PolarHBondContact O-N 3.2Å
29	R	65.7	Low	72.8	Confident	161 Å²	161	144 Å²	144	61%	0.608	72%	0.72	S	S	*	*			trans	-78	69.6	177.1	-157.1	175.7	-174	-152.9	1	110.7	S27 W31	S27-R29 PolarHBondContact O-N 2.92Å; R29-W31 PolarHBondContact O-N 2.81Å
30	Q	66.6	Low	72.3	Confident	177 Å²	177	140.2 Å²	140.2	83%	0.827	72%	0.719	S	S	*	*			trans	-64.8	106	155	-66.8	-75.8	-10.9	0	0	106.2	T28 T32	T28-Q30 PolarHBondContact O-N 3.2Å; Q30-T32 PolarHBondContact O-N 3.41Å
31	W	59.3	Low	71.6	Confident	192 Å²	192	132.3 Å²	132.3	73%	0.727	71%	0.705	S	S	*	*			trans	-76.2	113.3	167.5	-76.3	87.6	0	0	0	107.6	R29	R29-W31 PolarHBondContact O-N 2.81Å
32	T	56.7	Low	70.7	Confident	207 Å²	207	131.8 Å²	131.8	100%	1.27	71%	0.711	S	S	*	*			trans	-100.1	0	153.9	43.9	0	0	0	0	108.9	Q30	Q30-T32 PolarHBondContact O-N 3.41Å

Retrieved 32 of 32 residues in 90.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).