A0A087WSP9_MOUSE Loading...

Origin recognition complex, subunit 2

AlphaFold DB , UniProt , Accession A0A087WSP9, Species MOUSE (Mus musculus, Mouse), Gene Orc2, Length 44 aa.

						>A0A087WSP9_MOUSE|A0A087WSP9|Orc2
MSTLQLKETKVPSVQFVGDDDVLSHILDREGGTKLKKEKAQLLV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.5	Very low	61.1	Low	235 Å²	235	162.1 Å²	162.1	100%	1.158	84%	0.839	S	S	*	*				0	78.5	0	-62.5	-70.5	-135.8	0	0	107.9	T3	M1-T3 PolarHBondContact O-N 3.41Å
2	S	53	Low	61.1	Low	114 Å²	114	156.9 Å²	156.9	80%	0.797	82%	0.823	S	S	*	*			trans	-79.2	111.7	179.4	-167.8	0	0	0	0	107.9	L4	S2-L4 PolarHBondContact O-N 3.35Å; S2-L4 VanDerWaalsContact O-N 3.09Å
3	T	59.2	Low	61.5	Low	119 Å²	119	154.5 Å²	154.5	73%	0.73	83%	0.828	S	S	*	*			trans	-71.8	99.2	175.7	50.2	0	0	0	0	108	M1 Q5	M1-T3 PolarHBondContact O-N 3.41Å; T3-Q5 PolarHBondContact O-N 3.16Å
4	L	60.6	Low	61.7	Low	156 Å²	156	150.7 Å²	150.7	82%	0.817	81%	0.812	S	S	*	*			trans	-63.3	100.8	171.7	-70.9	170.8	0	0	0	107.9	S2 L6	S2-L4 PolarHBondContact O-N 3.35Å; S2-L4 VanDerWaalsContact O-N 3.09Å; L4-L6 PolarHBondContact O-N 2.82Å
5	Q	63.2	Low	62	Low	183 Å²	183	152.4 Å²	152.4	86%	0.855	81%	0.813	S	S	*	*			trans	-69.5	87.8	169.4	-67.5	-150.1	59.7	0	0	107.9	T3 K7	T3-Q5 PolarHBondContact O-N 3.16Å; Q5-K7 PolarHBondContact O-N 3.01Å
6	L	59	Low	62.3	Low	156 Å²	156	153.6 Å²	153.6	82%	0.817	81%	0.809	S	S	*	*			trans	-63.3	99.7	174.3	-155.6	82.5	0	0	0	106.7	L4 E8	L4-L6 PolarHBondContact O-N 2.82Å; L6-E8 PolarHBondContact O-N 2.83Å
7	K	65.8	Low	62.3	Low	190 Å²	190	152.8 Å²	152.8	83%	0.826	81%	0.812	S	S	*	*			trans	-58.2	113	169.4	-80.3	-164.2	170.9	-168.8	0	106.5	Q5 T9	Q5-K7 PolarHBondContact O-N 3.01Å; K7-T9 VanDerWaalsContact C-N 3.33Å; K7-T9 PolarHBondContact O-N 2.99Å
8	E	61.8	Low	62.3	Low	191 Å²	191	147 Å²	147	89%	0.893	79%	0.794	S	S	*	*			trans	-58.8	99.8	175.7	-120.2	178.1	104.8	0	0	107.9	L6 K10	L6-E8 PolarHBondContact O-N 2.83Å; E8-K10 PolarHBondContact O-N 2.97Å
9	T	66.3	Low	62.5	Low	120 Å²	120	146.2 Å²	146.2	74%	0.736	79%	0.789	S	S	*	*			trans	-64	108.5	173.5	-59.5	0	0	0	0	105.9	K7 V11	K7-T9 VanDerWaalsContact C-N 3.33Å; K7-T9 PolarHBondContact O-N 2.99Å; T9-V11 WeakPolarHBondContact O-CG2 3.4Å; T9-V11 PolarHBondContact O-N 2.85Å
10	K	69.2	Low	62.7	Low	194 Å²	194	146.2 Å²	146.2	84%	0.843	79%	0.789	S	S	*	*			trans	-54.2	100.8	177.5	-177.2	169.2	-179	176.9	0	108.8	E8 P12	E8-K10 PolarHBondContact O-N 2.97Å; K10-P12 WeakPolarHBondContact O-CD 3.42Å
11	V	71.3	Confident	62.7	Low	125 Å²	125	145.2 Å²	145.2	76%	0.758	78%	0.783	S	S	*	*			trans	-73.5	120.8	177.8	-176.7	0	0	0	0	107	T9 S13	T9-V11 WeakPolarHBondContact O-CG2 3.4Å; T9-V11 PolarHBondContact O-N 2.85Å; V11-S13 PolarHBondContact O-N 2.91Å
12	P	61.9	Low	63.8	Low	100 Å²	100	137.1 Å²	137.1	65%	0.649	75%	0.747	S	S	*	*			trans	-66.4	130.5	177	25.7	-31.1	0	0	0	109.6	K10 V14	K10-P12 WeakPolarHBondContact O-CD 3.42Å; P12-V14 PolarHBondContact O-N 2.95Å; P12-V14 VanDerWaalsContact O-N 3.16Å
13	S	65.8	Low	64.5	Low	126 Å²	126	136.7 Å²	136.7	88%	0.881	74%	0.735	S	S	*	*			trans	-72.1	107.5	172.1	57.7	0	0	0	0	108.5	V11	V11-S13 PolarHBondContact O-N 2.91Å
14	V	64.8	Low	64.7	Low	101 Å²	101	133.9 Å²	133.9	61%	0.612	72%	0.72	S	S	*	*			trans	-96.4	134	171.2	-66.5	0	0	0	0	109	P12 F16	P12-V14 PolarHBondContact O-N 2.95Å; P12-V14 VanDerWaalsContact O-N 3.16Å; V14-F16 HydrophobicContact CG2-CE2 3.85Å; V14-F16 HydrophobicContact CG2-CZ 4.03Å
15	Q	66.3	Low	65	Low	176 Å²	176	132 Å²	132	82%	0.822	71%	0.707	S	S	*	*			trans	-97	115.8	170.7	-167.3	174.5	33	0	0	107.1	V17	Q15-V17 PolarHBondContact O-N 3.4Å
16	F	66.4	Low	65	Low	172 Å²	172	126.9 Å²	126.9	75%	0.754	69%	0.685	S	S	*	*			trans	-73.5	118.2	171.9	-67.3	-85.9	0	0	0	107.6	V14	V14-F16 HydrophobicContact CG2-CE2 3.85Å; V14-F16 HydrophobicContact CG2-CZ 4.03Å
17	V	62	Low	65	Low	140 Å²	140	123.1 Å²	123.1	85%	0.848	67%	0.665	S	S	*	*			trans	-101.8	107	176.4	-176	0	0	0	0	107.5	Q15	Q15-V17 PolarHBondContact O-N 3.4Å
18	G	62.6	Low	64.8	Low	48 Å²	48	120.5 Å²	120.5	50%	0.495	66%	0.66	S	S	.	*	S	Bend	trans	177.4	150.2	178.3	0	0	0	0	0	108.5
19	D	66.5	Low	64.8	Low	131 Å²	131	121.3 Å²	121.3	70%	0.701	66%	0.655	S	S	*	*			trans	-62.6	156.7	172	-62.9	-35.8	0	0	0	109.8	D21 V22	D19-D21 PolarHBondContact O-N 3.48Å; D19-V22 HydrophobicContact CB-CG2 4.46Å; D19-V22 WeakPolarHBondContact O-CB 3.39Å; D19-V22 WeakPolarHBondContact O-CG2 3.35Å; D19-V22 PolarHBondContact O-N 2.87Å
20	D	65.4	Low	64.5	Low	147 Å²	147	122.6 Å²	122.6	79%	0.786	65%	0.653	S	S	*	*	H	α-helix	trans	-52.1	-24.3	-179.1	-76.5	-29.9	0	0	0	112.8
21	D	63.3	Low	63.7	Low	126 Å²	126	115.4 Å²	115.4	67%	0.674	63%	0.633	S	S	*	*	H	α-helix	trans	-78.5	-16.9	178.6	-62.3	-40.2	0	0	0	114.5	D19 S24 H25	D19-D21 PolarHBondContact O-N 3.48Å; D21-S24 WeakPolarHBondContact O-CB 3.48Å; D21-S24 PolarHBondContact O-N 3.45Å; D21-H25 PolarHBondContact O-N 3.22Å
22	V	66.6	Low	62.9	Low	64 Å²	64	112.1 Å²	112.1	39%	0.388	63%	0.625	S	S	.	*	H	α-helix	trans	-71.4	-36.4	179.9	-179.6	0	0	0	0	110.9	D19 S24 H25 I26	D19-V22 HydrophobicContact CB-CG2 4.46Å; D19-V22 WeakPolarHBondContact O-CB 3.39Å; D19-V22 WeakPolarHBondContact O-CG2 3.35Å; D19-V22 PolarHBondContact O-N 2.87Å; V22-S24 VanDerWaalsContact C-N 3.28Å; V22-S24 PolarHBondContact O-N 2.95Å; V22-H25 PolarHBondContact O-N 3.09Å; V22-I26 HydrophobicContact CG1-CD1 4.05Å; V22-I26 PolarHBondContact O-N 3.28Å; V22-I26 HydrophobicContact CG1-CG1 4.48Å; V22-I26 WeakPolarHBondContact O-CG1 3.18Å
23	L	66.4	Low	62.5	Low	106 Å²	106	113.5 Å²	113.5	56%	0.555	63%	0.632	S	S	*	*	H	α-helix	trans	-60.9	-41.7	173.1	-70.7	177.8	0	0	0	110.7	I26 L27	L23-I26 PolarHBondContact O-N 3.07Å; L23-L27 WeakPolarHBondContact O-CB 2.94Å; L23-L27 WeakPolarHBondContact O-CG 3.44Å; L23-L27 PolarHBondContact O-N 2.96Å
24	S	64.6	Low	61.9	Low	60 Å²	60	116.7 Å²	116.7	42%	0.42	63%	0.63	S	S	.	*	H	α-helix	trans	-63	-43.9	175	-57.9	0	0	0	0	111.2	D21 V22 I26 L27 D28	D21-S24 WeakPolarHBondContact O-CB 3.48Å; D21-S24 PolarHBondContact O-N 3.45Å; V22-S24 VanDerWaalsContact C-N 3.28Å; V22-S24 PolarHBondContact O-N 2.95Å; S24-I26 PolarHBondContact O-N 3.35Å; S24-L27 PolarHBondContact O-N 3.32Å; S24-D28 WeakPolarHBondContact O-CB 3.37Å; S24-D28 PolarHBondContact O-N 2.94Å
25	H	65.3	Low	61.3	Low	116 Å²	116	116.6 Å²	116.6	54%	0.537	63%	0.626	S	S	.	*	H	α-helix	trans	-65.2	-35.1	179.6	-166.8	65.7	0	0	0	114	D21 V22 R29	D21-H25 PolarHBondContact O-N 3.22Å; V22-H25 PolarHBondContact O-N 3.09Å; H25-R29 WeakPolarHBondContact O-CB 3.2Å; H25-R29 PolarHBondContact O-N 2.98Å
26	I	64.3	Low	60.6	Low	75 Å²	75	117.1 Å²	117.1	39%	0.385	63%	0.625	S	S	.	*	H	α-helix	trans	-68.5	-51	174.1	-67.8	168	0	0	0	109.1	V22 L23 S24 D28 R29 E30	V22-I26 HydrophobicContact CG1-CD1 4.05Å; V22-I26 PolarHBondContact O-N 3.28Å; V22-I26 HydrophobicContact CG1-CG1 4.48Å; V22-I26 WeakPolarHBondContact O-CG1 3.18Å; L23-I26 PolarHBondContact O-N 3.07Å; S24-I26 PolarHBondContact O-N 3.35Å; I26-D28 PolarHBondContact O-N 2.95Å; I26-R29 PolarHBondContact O-N 3.21Å; I26-E30 VanDerWaalsContact CG2-CD 3.46Å; I26-E30 PolarHBondContact O-N 3.34Å; I26-E30 WeakPolarHBondContact O-CG 3.48Å; I26-E30 WeakPolarHBondContact CG2-OE1 3.44Å; I26-E30 HydrophobicContact CG2-CG 3.76Å
27	L	58.8	Low	60	Low	78 Å²	78	117.1 Å²	117.1	41%	0.408	63%	0.625	S	S	.	*	H	α-helix	trans	-57.6	-35.8	179.6	-70.2	171.6	0	0	0	113.5	L23 S24 R29 G32 L35	L23-L27 WeakPolarHBondContact O-CB 2.94Å; L23-L27 WeakPolarHBondContact O-CG 3.44Å; L23-L27 PolarHBondContact O-N 2.96Å; S24-L27 PolarHBondContact O-N 3.32Å; L27-R29 VanDerWaalsContact C-N 3.33Å; L27-G32 PolarHBondContact O-N 3.31Å; L27-L35 HydrophobicContact CD2-CB 4.39Å; L27-L35 HydrophobicContact CD2-CD1 4.28Å
28	D	61.8	Low	59.5	Low	135 Å²	135	117.8 Å²	117.8	72%	0.722	62%	0.619	S	S	*	*	H	α-helix	trans	-71.3	-28.8	177.2	-71	-29.9	0	0	0	112.5	S24 I26	S24-D28 WeakPolarHBondContact O-CB 3.37Å; S24-D28 PolarHBondContact O-N 2.94Å; I26-D28 PolarHBondContact O-N 2.95Å
29	R	61.9	Low	58.9	Low	207 Å²	207	123.3 Å²	123.3	78%	0.781	63%	0.629	S	S	*	*	H	α-helix	trans	-92.5	-27.1	-175.7	-159.2	174	178	-177.3	-2.1	113.8	H25 I26 L27 G31	H25-R29 WeakPolarHBondContact O-CB 3.2Å; H25-R29 PolarHBondContact O-N 2.98Å; I26-R29 PolarHBondContact O-N 3.21Å; L27-R29 VanDerWaalsContact C-N 3.33Å; R29-G31 VanDerWaalsContact C-N 3.32Å
30	E	58.4	Low	58	Low	148 Å²	148	120.7 Å²	120.7	69%	0.692	63%	0.625	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.5	0	175.8	-11.3	-158.9	123.5	0	0	113.6	I26	I26-E30 VanDerWaalsContact CG2-CD 3.46Å; I26-E30 PolarHBondContact O-N 3.34Å; I26-E30 WeakPolarHBondContact O-CG 3.48Å; I26-E30 WeakPolarHBondContact CG2-OE1 3.44Å; I26-E30 HydrophobicContact CG2-CG 3.76Å
31	G	53.1	Low	57.5	Low	42 Å²	42	121.3 Å²	121.3	43%	0.433	62%	0.624	S	S	.	*	T	Hydrogen-bonded Turn	trans	72.6	61.2	176.3	0	0	0	0	0	113.2	R29 T33	R29-G31 VanDerWaalsContact C-N 3.32Å; G31-T33 PolarHBondContact O-N 3.4Å; G31-T33 PolarHBondContact O-OG1 3.38Å
32	G	54.5	Low	56.9	Low	57 Å²	57	122.5 Å²	122.5	59%	0.588	63%	0.629	S	S	*	*	S	Bend	trans	43.3	1	139.2	0	0	0	0	0	123.1	L27	L27-G32 PolarHBondContact O-N 3.31Å
33	T	53.4	Low	56.1	Low	129 Å²	129	127.1 Å²	127.1	79%	0.791	65%	0.651	S	S	*	*	S	Bend	trans	-121.8	-4.8	-160.7	55.1	0	0	0	0	115.2	G31	G31-T33 PolarHBondContact O-N 3.4Å; G31-T33 PolarHBondContact O-OG1 3.38Å
34	K	54	Low	54.7	Low	192 Å²	192	132 Å²	132	84%	0.835	69%	0.685	S	S	*	*	S	Bend	trans	-113	-15.6	175.6	-79.7	-147	175.1	-169.5	0	116.8
35	L	52.3	Low	54.2	Low	100 Å²	100	135.6 Å²	135.6	52%	0.524	70%	0.698	S	S	.	*	S	Bend	trans	-96.9	-5.5	-173.1	-133.6	132.9	0	0	0	115.1	L27	L27-L35 HydrophobicContact CD2-CB 4.39Å; L27-L35 HydrophobicContact CD2-CD1 4.28Å
36	K	51.8	Low	53.6	Low	186 Å²	186	136.6 Å²	136.6	81%	0.809	71%	0.706	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.8	-12.8	173.1	-68.5	-157.1	176.3	-169.7	0	114.1
37	K	52.6	Low	53	Low	172 Å²	172	140.1 Å²	140.1	75%	0.748	72%	0.724	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.1	-20.7	-173.8	-130	177.6	-177	178.5	0	114.7
38	E	50.9	Low	52.7	Low	154 Å²	154	143.7 Å²	143.7	72%	0.72	74%	0.743	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.4	-32.5	-179.4	-155.9	172.7	103.3	0	0	112.7	A40 Q41	E38-A40 VanDerWaalsContact C-N 3.28Å; E38-A40 PolarHBondContact O-N 2.9Å; E38-Q41 PolarHBondContact O-N 2.63Å
39	K	50.8	Low	52.1	Low	165 Å²	165	144.3 Å²	144.3	72%	0.717	74%	0.744	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.4	-14.3	175.2	-72.7	-169.3	175	-175.3	0	114.5
40	A	48.1	Very low	51.4	Low	75 Å²	75	140.1 Å²	140.1	62%	0.62	74%	0.742	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.1	-9.5	175.6	0	0	0	0	0	113.5	E38	E38-A40 VanDerWaalsContact C-N 3.28Å; E38-A40 PolarHBondContact O-N 2.9Å
41	Q	53.5	Low	50.9	Low	161 Å²	161	139.5 Å²	139.5	75%	0.752	75%	0.745	S	S	*	*	S	Bend	trans	-102.9	-1.2	178.1	-74.9	-177.3	7.8	0	0	113.9	E38	E38-Q41 PolarHBondContact O-N 2.63Å
42	L	51.8	Low	50.8	Low	151 Å²	151	147 Å²	147	79%	0.791	77%	0.769	S	S	*	*	S	Bend	trans	-99.8	19	176.8	-93.4	163.1	0	0	0	113.2
43	L	48.7	Very low	50.5	Low	160 Å²	160	154.5 Å²	154.5	84%	0.838	78%	0.784	S	S	*	*			trans	-134.6	60.9	174.5	-149.6	89	0	0	0	110.6
44	V	37.5	Very low	50.2	Low	209 Å²	209	156.8 Å²	156.8	100%	1.267	78%	0.784	S	S	*	*			trans	-141.7	0	156.6	178.3	0	0	0	0	108.3

Retrieved 44 of 44 residues in 58.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).