A0A087WSS5_MOUSE Loading...

General transcription factor II E, polypeptide 2 (beta subunit)

AlphaFold DB , UniProt , Accession A0A087WSS5, Species MOUSE (Mus musculus, Mouse), Gene Gtf2e2, Length 62 aa.

						>A0A087WSS5_MOUSE|A0A087WSS5|Gtf2e2
MDPSLLRDRELFKKRALSTPVVEKRAVPSESPSSSSSKKKKAKVEHGGSSGSKQNSDHNNGS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	74.3	Confident	92.9	Very high	193 Å²	193	109 Å²	109	95%	0.951	54%	0.537	S	S	*	.				0	139.6	0	-76.1	-62.7	154.5	0	0	108.4	L5 L6	M1-L5 HydrophobicContact SD-CD2 4.2Å; M1-L6 HydrophobicContact CB-CD2 4.4Å
2	D	95.6	Very high	92.9	Very high	93 Å²	93	110.3 Å²	110.3	50%	0.497	54%	0.537	S	S	.	.			trans	-67.4	130.2	179.4	-175.9	-15	0	0	0	110.5	S4 L5 L6	D2-S4 WeakPolarHBondContact OD1-CB 3.34Å; D2-S4 PolarHBondContact OD1-N 2.83Å; D2-S4 PolarHBondContact OD1-OG 3.22Å; D2-S4 VanDerWaalsContact OD1-OG 3.06Å; D2-S4 PolarHBondContact OD2-OG 2.95Å; D2-S4 PolarHBondContact O-N 2.8Å; D2-L5 HydrophobicContact CB-CB 4.2Å; D2-L5 WeakPolarHBondContact O-CB 3.13Å; D2-L5 PolarHBondContact O-N 3.26Å; D2-L5 VanDerWaalsContact O-N 3.13Å; D2-L6 PolarHBondContact O-N 2.87Å
3	P	93.4	Very high	92.9	Very high	94 Å²	94	112 Å²	112	61%	0.61	54%	0.54	S	S	*	.	H	α-helix	trans	-51.8	-32	171.7	-27.4	34.7	0	0	0	114.3	R7	P3-R7 PolarHBondContact O-N 3.25Å; P3-R7 WeakPolarHBondContact O-CG 3.4Å
4	S	95.7	Very high	92.8	Very high	38 Å²	38	114.2 Å²	114.2	27%	0.266	55%	0.546	S	S	.	.	H	α-helix	trans	-62.9	-49.5	175.8	74.9	0	0	0	0	111.3	D2 L6 R7 D8	D2-S4 WeakPolarHBondContact OD1-CB 3.34Å; D2-S4 PolarHBondContact OD1-N 2.83Å; D2-S4 PolarHBondContact OD1-OG 3.22Å; D2-S4 VanDerWaalsContact OD1-OG 3.06Å; D2-S4 PolarHBondContact OD2-OG 2.95Å; D2-S4 PolarHBondContact O-N 2.8Å; S4-L6 VanDerWaalsContact C-N 3.28Å; S4-L6 PolarHBondContact O-N 3.34Å; S4-R7 WeakPolarHBondContact O-CB 3.35Å; S4-R7 PolarHBondContact O-N 2.76Å; S4-R7 VanDerWaalsContact O-N 3.08Å; S4-D8 PolarHBondContact O-N 3.06Å
5	L	94.7	Very high	92.6	Very high	96 Å²	96	117.3 Å²	117.3	50%	0.503	55%	0.55	S	S	.	*	H	α-helix	trans	-62.2	-35.3	179.7	-177.1	63.4	0	0	0	112.4	M1 D2 D8 R9	M1-L5 HydrophobicContact SD-CD2 4.2Å; D2-L5 HydrophobicContact CB-CB 4.2Å; D2-L5 WeakPolarHBondContact O-CB 3.13Å; D2-L5 PolarHBondContact O-N 3.26Å; D2-L5 VanDerWaalsContact O-N 3.13Å; L5-D8 PolarHBondContact O-N 3.21Å; L5-R9 WeakPolarHBondContact O-CB 3.22Å; L5-R9 PolarHBondContact O-N 2.8Å
6	L	95.6	Very high	92.4	Very high	72 Å²	72	112 Å²	112	38%	0.377	53%	0.533	S	S	.	.	H	α-helix	trans	-63.1	-43.6	174.9	-66.6	177.2	0	0	0	111.6	M1 D2 S4 R9 E10	M1-L6 HydrophobicContact CB-CD2 4.4Å; D2-L6 PolarHBondContact O-N 2.87Å; S4-L6 VanDerWaalsContact C-N 3.28Å; S4-L6 PolarHBondContact O-N 3.34Å; L6-R9 PolarHBondContact O-N 3.15Å; L6-E10 PolarHBondContact O-N 2.93Å; L6-E10 WeakPolarHBondContact O-CG 3.4Å
7	R	95.8	Very high	92	Very high	163 Å²	163	114.2 Å²	114.2	62%	0.615	55%	0.547	S	S	*	.	H	α-helix	trans	-65.1	-42.6	175.7	-65.3	-176.3	-59.7	162.7	3.6	111.5	P3 S4 R9 E10 L11	P3-R7 PolarHBondContact O-N 3.25Å; P3-R7 WeakPolarHBondContact O-CG 3.4Å; S4-R7 WeakPolarHBondContact O-CB 3.35Å; S4-R7 PolarHBondContact O-N 2.76Å; S4-R7 VanDerWaalsContact O-N 3.08Å; R7-R9 VanDerWaalsContact C-N 3.33Å; R7-R9 PolarHBondContact O-N 3.09Å; R7-E10 WeakPolarHBondContact O-CB 3.25Å; R7-E10 PolarHBondContact O-N 2.98Å; R7-L11 WeakPolarHBondContact O-CG 3.33Å; R7-L11 PolarHBondContact O-N 3.14Å
8	D	93.9	Very high	91.6	Very high	92 Å²	92	113.3 Å²	113.3	49%	0.492	56%	0.555	S	S	.	*	H	α-helix	trans	-63.1	-39.9	178.5	-69.3	-12.9	0	0	0	111.7	S4 L5 E10 L11 F12	S4-D8 PolarHBondContact O-N 3.06Å; L5-D8 PolarHBondContact O-N 3.21Å; D8-E10 VanDerWaalsContact C-N 3.33Å; D8-E10 PolarHBondContact O-N 3.26Å; D8-L11 PolarHBondContact O-N 2.97Å; D8-F12 WeakPolarHBondContact O-CB 3.44Å; D8-F12 PolarHBondContact O-N 2.84Å
9	R	95.4	Very high	90.8	Very high	154 Å²	154	111.4 Å²	111.4	58%	0.581	55%	0.551	S	S	*	*	H	α-helix	trans	-59.2	-43.4	173.3	-174	179.8	112	-101.8	6.3	111.9	L5 L6 R7 K13	L5-R9 WeakPolarHBondContact O-CB 3.22Å; L5-R9 PolarHBondContact O-N 2.8Å; L6-R9 PolarHBondContact O-N 3.15Å; R7-R9 VanDerWaalsContact C-N 3.33Å; R7-R9 PolarHBondContact O-N 3.09Å; R9-K13 PolarHBondContact O-N 3.01Å; R9-K13 WeakPolarHBondContact O-CB 3.42Å
10	E	94.6	Very high	89.9	Confident	99 Å²	99	110.6 Å²	110.6	46%	0.463	55%	0.554	S	S	.	*	H	α-helix	trans	-66.2	-41.7	178.7	-71.1	173.5	-162.2	0	0	112	L6 R7 D8 K14	L6-E10 PolarHBondContact O-N 2.93Å; L6-E10 WeakPolarHBondContact O-CG 3.4Å; R7-E10 WeakPolarHBondContact O-CB 3.25Å; R7-E10 PolarHBondContact O-N 2.98Å; D8-E10 VanDerWaalsContact C-N 3.33Å; D8-E10 PolarHBondContact O-N 3.26Å; E10-K14 WeakPolarHBondContact O-CG 3.45Å; E10-K14 PolarHBondContact O-N 3.3Å; E10-K14 VanDerWaalsContact O-N 3.14Å
11	L	93.4	Very high	89.1	Confident	105 Å²	105	109.6 Å²	109.6	55%	0.55	55%	0.554	S	S	.	*	H	α-helix	trans	-66	-44.3	176.4	-69.7	174.5	0	0	0	111.8	R7 D8 K13 K14 R15	R7-L11 WeakPolarHBondContact O-CG 3.33Å; R7-L11 PolarHBondContact O-N 3.14Å; D8-L11 PolarHBondContact O-N 2.97Å; L11-K13 PolarHBondContact O-N 3.48Å; L11-K14 PolarHBondContact O-N 3.14Å; L11-R15 PolarHBondContact O-N 3.38Å
12	F	92.9	Very high	88.4	Confident	124 Å²	124	105.5 Å²	105.5	54%	0.544	54%	0.539	S	S	.	.	H	α-helix	trans	-60.4	-45.4	176.7	-179.5	-95.4	0	0	0	111.4	D8 K14 R15 A16 V21	D8-F12 WeakPolarHBondContact O-CB 3.44Å; D8-F12 PolarHBondContact O-N 2.84Å; F12-K14 VanDerWaalsContact C-N 3.32Å; F12-K14 PolarHBondContact O-N 3.24Å; F12-R15 PolarHBondContact O-N 2.86Å; F12-R15 VanDerWaalsContact O-N 3.15Å; F12-A16 HydrophobicContact CE1-CB 4.26Å; F12-A16 PolarHBondContact O-N 2.95Å; F12-A16 WeakPolarHBondContact O-CB 3.36Å; F12-V21 HydrophobicContact CE2-CG2 4.01Å; F12-V21 HydrophobicContact CZ-CG2 4.21Å
13	K	92.2	Very high	86.8	Confident	133 Å²	133	109.8 Å²	109.8	58%	0.578	56%	0.556	S	S	*	*	H	α-helix	trans	-58.2	-43.5	176.1	-173.6	178.3	66.6	174	0	111.8	R9 L11 L17	R9-K13 PolarHBondContact O-N 3.01Å; R9-K13 WeakPolarHBondContact O-CB 3.42Å; L11-K13 PolarHBondContact O-N 3.48Å; K13-L17 WeakPolarHBondContact O-CG 3.44Å; K13-L17 PolarHBondContact O-N 3.43Å
14	K	91.6	Very high	85.5	Confident	143 Å²	143	113.9 Å²	113.9	62%	0.622	57%	0.565	S	S	*	*	H	α-helix	trans	-62.1	-43.8	175.7	-72.4	175.8	-178.3	176.2	0	111.8	E10 L11 F12	E10-K14 WeakPolarHBondContact O-CG 3.45Å; E10-K14 PolarHBondContact O-N 3.3Å; E10-K14 VanDerWaalsContact O-N 3.14Å; L11-K14 PolarHBondContact O-N 3.14Å; F12-K14 VanDerWaalsContact C-N 3.32Å; F12-K14 PolarHBondContact O-N 3.24Å
15	R	89.3	Confident	83.8	Confident	160 Å²	160	124.2 Å²	124.2	60%	0.604	60%	0.598	S	S	*	*	H	α-helix	trans	-65.8	-47	178.3	-179.6	178.8	-98.3	174.5	-6.7	111.5	L11 F12 L17 S18 T19	L11-R15 PolarHBondContact O-N 3.38Å; F12-R15 PolarHBondContact O-N 2.86Å; F12-R15 VanDerWaalsContact O-N 3.15Å; R15-L17 VanDerWaalsContact C-N 3.26Å; R15-L17 PolarHBondContact O-N 3.44Å; R15-S18 PolarHBondContact O-N 3.42Å; R15-T19 VanDerWaalsContact O-OG1 3.09Å; R15-T19 PolarHBondContact O-OG1 3.31Å; R15-T19 PolarHBondContact O-N 2.83Å; R15-T19 CarbonylContact O-C 3.55Å; R15-T19 WeakPolarHBondContact CG-OG1 3.49Å; R15-T19 VanDerWaalsContact CG-OG1 3.22Å
16	A	89.9	Confident	81.7	Confident	33 Å²	33	123.5 Å²	123.5	27%	0.273	61%	0.606	S	S	.	*	H	α-helix	trans	-61.8	-31.6	-175.9	0	0	0	0	0	113.5	F12 P20	F12-A16 HydrophobicContact CE1-CB 4.26Å; F12-A16 PolarHBondContact O-N 2.95Å; F12-A16 WeakPolarHBondContact O-CB 3.36Å; A16-P20 WeakPolarHBondContact O-CA 3.49Å
17	L	86.1	Confident	79.1	Confident	149 Å²	149	126.6 Å²	126.6	78%	0.78	63%	0.627	S	S	*	*	H	α-helix	trans	-71.4	-31.1	175.7	-68.8	171.1	0	0	0	113.1	K13 R15	K13-L17 WeakPolarHBondContact O-CG 3.44Å; K13-L17 PolarHBondContact O-N 3.43Å; R15-L17 VanDerWaalsContact C-N 3.26Å; R15-L17 PolarHBondContact O-N 3.44Å
18	S	84.1	Confident	76.9	Confident	98 Å²	98	125.3 Å²	125.3	69%	0.685	64%	0.64	S	S	*	*	H	α-helix	trans	-92.9	-44.4	-177.5	177.8	0	0	0	0	112.2	R15	R15-S18 PolarHBondContact O-N 3.42Å
19	T	76.5	Confident	74.9	Confident	77 Å²	77	125.5 Å²	125.5	47%	0.472	65%	0.649	S	S	.	*	S	Bend	trans	-124.6	91	178.2	58.8	0	0	0	0	107.5	R15 V21	R15-T19 VanDerWaalsContact O-OG1 3.09Å; R15-T19 PolarHBondContact O-OG1 3.31Å; R15-T19 PolarHBondContact O-N 2.83Å; R15-T19 CarbonylContact O-C 3.55Å; R15-T19 WeakPolarHBondContact CG-OG1 3.49Å; R15-T19 VanDerWaalsContact CG-OG1 3.22Å; T19-V21 PolarHBondContact O-N 2.96Å
20	P	74	Confident	72.5	Confident	95 Å²	95	126.7 Å²	126.7	62%	0.617	66%	0.661	S	S	*	*			trans	-58.9	126.2	178.1	23.7	-32.5	0	0	0	109.2	A16 V22	A16-P20 WeakPolarHBondContact O-CA 3.49Å; P20-V22 PolarHBondContact O-N 3.17Å
21	V	71.3	Confident	70.5	Confident	90 Å²	90	127.1 Å²	127.1	55%	0.545	68%	0.675	S	S	.	*			trans	-73.1	19.8	-174	-171.1	0	0	0	0	112.1	F12 T19 E23	F12-V21 HydrophobicContact CE2-CG2 4.01Å; F12-V21 HydrophobicContact CZ-CG2 4.21Å; T19-V21 PolarHBondContact O-N 2.96Å; V21-E23 VanDerWaalsContact C-N 3.3Å; V21-E23 PolarHBondContact O-N 3.43Å
22	V	60.8	Low	68.5	Low	108 Å²	108	128 Å²	128	66%	0.655	69%	0.687	S	S	*	*			trans	-81.4	84.6	178.4	-167.3	0	0	0	0	108.2	P20 K24	P20-V22 PolarHBondContact O-N 3.17Å; V22-K24 HydrophobicContact CG1-CG 3.85Å; V22-K24 PolarHBondContact O-N 3.18Å
23	E	62.4	Low	66.4	Low	183 Å²	183	126.7 Å²	126.7	86%	0.855	69%	0.693	S	S	*	*			trans	-62.2	83.4	155.9	-69.6	-176.4	-178.5	0	0	108.4	V21 R25	V21-E23 VanDerWaalsContact C-N 3.3Å; V21-E23 PolarHBondContact O-N 3.43Å; E23-R25 PolarHBondContact O-N 2.92Å
24	K	65.8	Low	64.1	Low	180 Å²	180	125.5 Å²	125.5	78%	0.783	70%	0.702	S	S	*	*			trans	-69.4	111.4	151.3	-68.7	-161.5	170.8	-174.3	0	104.9	V22 A26	V22-K24 HydrophobicContact CG1-CG 3.85Å; V22-K24 PolarHBondContact O-N 3.18Å; K24-A26 PolarHBondContact O-N 3.01Å
25	R	60.3	Low	61.9	Low	254 Å²	254	124.1 Å²	124.1	96%	0.958	71%	0.71	S	S	*	*	S	Bend	trans	-38.4	100.2	177.9	-73.5	-177.3	177.5	114.3	-1	111.5	E23	E23-R25 PolarHBondContact O-N 2.92Å
26	A	49.8	Very low	59.8	Low	82 Å²	82	121.7 Å²	121.7	68%	0.678	72%	0.718	S	S	*	*			trans	-159.6	112.8	155.7	0	0	0	0	0	108.9	K24	K24-A26 PolarHBondContact O-N 3.01Å
27	V	41.2	Very low	57.8	Low	136 Å²	136	125.5 Å²	125.5	82%	0.824	74%	0.742	S	S	*	*			trans	63.3	131.7	160.6	-73.6	0	0	0	0	121	S29	V27-S29 PolarHBondContact O-N 2.94Å
28	P	50.2	Low	56.5	Low	136 Å²	136	128.4 Å²	128.4	88%	0.883	75%	0.749	S	S	*	*			trans	-77.3	104.8	174.1	33.3	-29.1	0	0	0	108.4
29	S	50.3	Low	55.2	Low	97 Å²	97	133.6 Å²	133.6	68%	0.678	76%	0.759	S	S	*	*			trans	-138.7	111	163.2	-167.2	0	0	0	0	109.4	V27	V27-S29 PolarHBondContact O-N 2.94Å
30	E	46.4	Very low	54.4	Low	178 Å²	178	138.9 Å²	138.9	83%	0.832	78%	0.775	S	S	*	*			trans	72	89.7	158.3	-60.2	-167.4	116.6	0	0	117.2
31	S	51.7	Low	53.3	Low	109 Å²	109	143.6 Å²	143.6	76%	0.762	79%	0.786	S	S	*	*			trans	-29.2	121.4	134.2	-50.3	0	0	0	0	111.8	S33	S31-S33 PolarHBondContact O-N 2.88Å
32	P	51.3	Low	52.2	Low	122 Å²	122	143.3 Å²	143.3	79%	0.792	79%	0.793	S	S	*	*			trans	-76.5	88.3	156.9	30.8	-27.2	0	0	0	106.4
33	S	48.4	Very low	51.8	Low	97 Å²	97	147.2 Å²	147.2	68%	0.678	80%	0.802	S	S	*	*			trans	-53.2	155	165.6	-172.6	0	0	0	0	110.5	S31	S31-S33 PolarHBondContact O-N 2.88Å
34	S	45.7	Very low	51.1	Low	108 Å²	108	143.5 Å²	143.5	76%	0.755	79%	0.791	S	S	*	*			trans	81.5	85.9	144.8	62.6	0	0	0	0	119
35	S	44	Very low	50.3	Low	115 Å²	115	142.2 Å²	142.2	80%	0.804	79%	0.788	S	S	*	*			trans	-87.6	124.5	141.1	60	0	0	0	0	110.5
36	S	46.3	Very low	49.7	Very low	109 Å²	109	138.2 Å²	138.2	76%	0.762	78%	0.78	S	S	*	*			trans	91.7	98.2	162.6	80	0	0	0	0	118.9
37	S	47.8	Very low	49.3	Very low	113 Å²	113	137 Å²	137	79%	0.79	78%	0.775	S	S	*	*				-178.4	99	128.3	-79.7	0	0	0	0	112.4
38	K	57.6	Low	49.9	Very low	209 Å²	209	134.2 Å²	134.2	91%	0.909	77%	0.774	S	S	*	*			trans	28.9	100.3	156.3	-73.5	166.1	179	164.8	0	118.7
39	K	57.4	Low	50	Low	207 Å²	207	133.7 Å²	133.7	90%	0.9	77%	0.774	S	S	*	*			trans	-168.4	122	140.3	33.3	-152.9	171.7	177.1	0	113.5
40	K	59.5	Low	50.2	Low	189 Å²	189	133.8 Å²	133.8	82%	0.822	77%	0.774	S	S	*	*			trans	11.7	133.5	163.8	-79.6	-169	177.5	179.7	0	122
41	K	51.6	Low	50.6	Low	193 Å²	193	128.9 Å²	128.9	84%	0.839	77%	0.772	S	S	*	*			trans	70.6	105.8	148	-62.5	-177.5	-168.2	-78.6	0	118.2
42	A	47.6	Very low	50.9	Low	85 Å²	85	129.1 Å²	129.1	70%	0.702	77%	0.773	S	S	*	*				-166.3	131.9	109.1	0	0	0	0	0	108	V44	A42-V44 HydrophobicContact CB-CG2 4.38Å; A42-V44 PolarHBondContact O-N 3.13Å; A42-V44 VanDerWaalsContact C-N 3.27Å
43	K	53.3	Low	51.4	Low	190 Å²	190	133.4 Å²	133.4	83%	0.826	78%	0.779	S	S	*	*			trans	-63.4	97.2	159.6	-109.9	179.1	167.8	-174.3	0	105.4	E45	K43-E45 PolarHBondContact O-N 3.19Å
44	V	47.3	Very low	51.9	Low	105 Å²	105	137.4 Å²	137.4	64%	0.636	79%	0.787	S	S	*	*			trans	-86.8	82.8	160.9	174.9	0	0	0	0	105.1	A42 H46	A42-V44 HydrophobicContact CB-CG2 4.38Å; A42-V44 PolarHBondContact O-N 3.13Å; A42-V44 VanDerWaalsContact C-N 3.27Å; V44-H46 HydrophobicContact CG1-CB 3.83Å; V44-H46 WeakPolarHBondContact CG1-CD2 3.37Å; V44-H46 PolarHBondContact O-N 3.18Å
45	E	49.1	Very low	52.3	Low	153 Å²	153	137.7 Å²	137.7	72%	0.715	78%	0.78	S	S	*	*			trans	-67.7	68.2	154.7	-67.3	-83	146.1	0	0	106.5	K43 G47	K43-E45 PolarHBondContact O-N 3.19Å; E45-G47 PolarHBondContact O-N 3.29Å; E45-G47 VanDerWaalsContact O-N 3.09Å
46	H	46.3	Very low	52.8	Low	170 Å²	170	136.4 Å²	136.4	79%	0.787	77%	0.771	S	S	*	*			trans	-81.7	81.7	154.2	-93.2	-54.7	0	0	0	105.7	V44 G48	V44-H46 HydrophobicContact CG1-CB 3.83Å; V44-H46 WeakPolarHBondContact CG1-CD2 3.37Å; V44-H46 PolarHBondContact O-N 3.18Å; H46-G48 PolarHBondContact O-N 3.08Å
47	G	42.9	Very low	53.1	Low	56 Å²	56	138 Å²	138	58%	0.577	77%	0.771	S	S	*	*			trans	-38.9	124.8	165.2	0	0	0	0	0	108.4	E45 S49	E45-G47 PolarHBondContact O-N 3.29Å; E45-G47 VanDerWaalsContact O-N 3.09Å; G47-S49 PolarHBondContact O-N 3.31Å
48	G	52.7	Low	53.9	Low	78 Å²	78	140.4 Å²	140.4	80%	0.804	77%	0.77	S	S	*	*			trans	-48.3	110	170.7	0	0	0	0	0	107.2	H46 S50	H46-G48 PolarHBondContact O-N 3.08Å; G48-S50 PolarHBondContact O-N 2.97Å
49	S	52	Low	54.3	Low	125 Å²	125	137.8 Å²	137.8	87%	0.874	77%	0.766	S	S	*	*			trans	-62.2	111.7	178.7	-149.6	0	0	0	0	106.6	G47	G47-S49 PolarHBondContact O-N 3.31Å
50	S	55.1	Low	54.7	Low	98 Å²	98	135.1 Å²	135.1	69%	0.685	76%	0.761	S	S	*	*			trans	0.2	116.5	166.3	-171	0	0	0	0	114.7	G48 S52	G48-S50 PolarHBondContact O-N 2.97Å; S50-S52 PolarHBondContact O-N 2.74Å
51	G	56	Low	54.7	Low	76 Å²	76	128.8 Å²	128.8	78%	0.784	75%	0.75	S	S	*	*			trans	-57	110.7	164.2	0	0	0	0	0	109.6
52	S	56.7	Low	54.6	Low	113 Å²	113	128.9 Å²	128.9	79%	0.79	78%	0.775	S	S	*	*			trans	-95.2	102	155.9	-69.8	0	0	0	0	107	S50 Q54	S50-S52 PolarHBondContact O-N 2.74Å; S52-Q54 PolarHBondContact O-N 3.06Å; S52-Q54 VanDerWaalsContact O-N 3.14Å
53	K	63	Low	55	Low	212 Å²	212	131.1 Å²	131.1	92%	0.922	78%	0.778	S	S	*	*			trans	-56.8	112.7	163.9	-63.1	-174.2	179.1	-176.3	0	107.2
54	Q	57.1	Low	55.1	Low	182 Å²	182	127.9 Å²	127.9	85%	0.85	78%	0.776	S	S	*	*			trans	-121.1	96.3	150.5	176.8	154.4	-6	0	0	108	S52	S52-Q54 PolarHBondContact O-N 3.06Å; S52-Q54 VanDerWaalsContact O-N 3.14Å
55	N	55.9	Low	55.5	Low	113 Å²	113	129.2 Å²	129.2	60%	0.604	78%	0.783	S	S	*	*			trans	9.7	122.9	142.7	-157.5	3.2	0	0	0	116.6	D57	N55-D57 PolarHBondContact OD1-N 3.21Å; N55-D57 PolarHBondContact OD1-OD2 2.85Å
56	S	53.7	Low	55.9	Low	88 Å²	88	127.8 Å²	127.8	62%	0.615	79%	0.787	S	S	*	*			trans	-156.5	89.5	132.6	-67.1	0	0	0	0	106.6	H58	S56-H58 WeakPolarHBondContact CB-CE1 3.43Å; S56-H58 WeakPolarHBondContact CB-ND1 3.44Å; S56-H58 PolarHBondContact O-N 2.91Å; S56-H58 PolarHBondContact O-ND1 3.26Å
57	D	52.9	Low	56.5	Low	143 Å²	143	125.2 Å²	125.2	77%	0.765	79%	0.788	S	S	*	*			trans	-52.8	94.4	156.1	-68.1	-61.9	0	0	0	107.9	N55 N59	N55-D57 PolarHBondContact OD1-N 3.21Å; N55-D57 PolarHBondContact OD1-OD2 2.85Å; D57-N59 PolarHBondContact O-N 3.09Å
58	H	65.1	Low	57.4	Low	164 Å²	164	129.8 Å²	129.8	76%	0.759	80%	0.802	S	S	*	*			trans	-81	71	167.7	-68.3	58.1	0	0	0	106.4	S56 N60	S56-H58 WeakPolarHBondContact CB-CE1 3.43Å; S56-H58 WeakPolarHBondContact CB-ND1 3.44Å; S56-H58 PolarHBondContact O-N 2.91Å; S56-H58 PolarHBondContact O-ND1 3.26Å; H58-N60 PolarHBondContact O-N 2.96Å
59	N	66	Low	57.7	Low	153 Å²	153	133.5 Å²	133.5	82%	0.818	80%	0.801	S	S	*	*			trans	-73.1	81.8	164.6	-165.7	33	0	0	0	107.1	D57	D57-N59 PolarHBondContact O-N 3.09Å
60	N	64.9	Low	58.2	Low	151 Å²	151	134.2 Å²	134.2	81%	0.807	80%	0.796	S	S	*	*			trans	-96.8	87.8	164.4	-160.6	25.9	0	0	0	107.3	H58	H58-N60 PolarHBondContact O-N 2.96Å
61	G	59.3	Low	58.4	Low	57 Å²	57	137.2 Å²	137.2	59%	0.588	81%	0.805	S	S	*	*			trans	-68.7	130.1	171	0	0	0	0	0	110.6
62	S	50.7	Low	58.7	Low	194 Å²	194	142.7 Å²	142.7	100%	1.357	81%	0.807	S	S	*	*			trans	-152.9	0	152.4	-71.1	0	0	0	0	107.7

Retrieved 62 of 62 residues in 24.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).