A0A087WSU0_MOUSE Loading...

aspartyl aminopeptidase

AlphaFold DB , UniProt , Accession A0A087WSU0, Species MOUSE (Mus musculus, Mouse), Gene Dnpep, Length 56 aa.

						>A0A087WSU0_MOUSE|A0A087WSU0|Dnpep
MAMNGRARKEAIQATARELLKFVNRSPSPFHVVAECRSRLLQAGFRELKETEGWDI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.7	Very low	79.3	Confident	254 Å²	254	130.6 Å²	130.6	100%	1.251	69%	0.687	S	S	*	*				0	90.8	0	-75	169	122.9	0	0	109.5
2	A	54.6	Low	80.8	Confident	93 Å²	93	126.6 Å²	126.6	77%	0.769	67%	0.665	S	S	*	*			trans	-138	14.1	178.2	0	0	0	0	0	113.1
3	M	58.8	Low	82.1	Confident	164 Å²	164	123.2 Å²	123.2	81%	0.808	64%	0.643	S	S	*	*	H	α-helix	trans	-81.3	-13.3	-173.5	-60	-149.2	91.4	0	0	114.4	A7	M3-A7 WeakPolarHBondContact O-CB 3.3Å
4	N	71.2	Confident	83.1	Confident	148 Å²	148	118 Å²	118	79%	0.791	63%	0.627	S	S	*	*	H	α-helix	trans	-72.6	-35.4	-174.3	-91.1	27.7	0	0	0	114.5	R8	N4-R8 VanDerWaalsContact O-CB 3.29Å; N4-R8 WeakPolarHBondContact O-CB 3.49Å; N4-R8 PolarHBondContact O-N 3.31Å
5	G	80.8	Confident	84	Confident	55 Å²	55	116.9 Å²	116.9	57%	0.567	63%	0.627	S	S	*	*	H	α-helix	trans	-73	-42.3	-174	0	0	0	0	0	113.5	K9	G5-K9 PolarHBondContact O-N 3.48Å; G5-K9 VanDerWaalsContact O-N 3.16Å
6	R	88.9	Confident	84.9	Confident	189 Å²	189	112.4 Å²	112.4	71%	0.713	61%	0.611	S	S	*	*	H	α-helix	trans	-70.4	-48.1	-179.8	-177.1	179	-78.5	-177.1	-4.9	111.4	R8 K9 E10	R6-R8 VanDerWaalsContact C-N 3.28Å; R6-R8 PolarHBondContact O-N 3.31Å; R6-K9 PolarHBondContact O-N 2.82Å; R6-K9 VanDerWaalsContact O-N 3.13Å; R6-E10 VanDerWaalsContact CG-OE1 3.32Å; R6-E10 WeakPolarHBondContact CG-OE1 3.32Å; R6-E10 WeakPolarHBondContact O-CG 3.35Å; R6-E10 PolarHBondContact O-N 3.36Å
7	A	90.4	Very high	85.7	Confident	54 Å²	54	114.4 Å²	114.4	45%	0.446	61%	0.607	S	S	.	*	H	α-helix	trans	-58.7	-39.7	177.4	0	0	0	0	0	111.9	M3 E10 A11	M3-A7 WeakPolarHBondContact O-CB 3.3Å; A7-E10 PolarHBondContact O-N 3.4Å; A7-A11 WeakPolarHBondContact O-CB 3.35Å; A7-A11 PolarHBondContact O-N 3.31Å
8	R	93.6	Very high	86.3	Confident	167 Å²	167	112.6 Å²	112.6	63%	0.63	60%	0.595	S	S	*	*	H	α-helix	trans	-64.3	-43.7	175.8	-179.7	55.5	177.6	174.7	1.4	112.4	N4 R6 E10 A11 I12	N4-R8 VanDerWaalsContact O-CB 3.29Å; N4-R8 WeakPolarHBondContact O-CB 3.49Å; N4-R8 PolarHBondContact O-N 3.31Å; R6-R8 VanDerWaalsContact C-N 3.28Å; R6-R8 PolarHBondContact O-N 3.31Å; R8-E10 VanDerWaalsContact C-N 3.33Å; R8-A11 PolarHBondContact O-N 3.02Å; R8-I12 HydrophobicContact CG-CD1 3.99Å; R8-I12 VanDerWaalsContact O-CG1 3.3Å; R8-I12 WeakPolarHBondContact O-CG1 3.49Å; R8-I12 PolarHBondContact O-N 3.02Å
9	K	94.8	Very high	86.8	Confident	146 Å²	146	112.3 Å²	112.3	64%	0.635	59%	0.593	S	S	*	*	H	α-helix	trans	-61.6	-43.3	177	-177	178.4	178.5	179.6	0	111.1	G5 R6 I12 Q13	G5-K9 PolarHBondContact O-N 3.48Å; G5-K9 VanDerWaalsContact O-N 3.16Å; R6-K9 PolarHBondContact O-N 2.82Å; R6-K9 VanDerWaalsContact O-N 3.13Å; K9-I12 PolarHBondContact O-N 2.66Å; K9-Q13 HydrophobicContact CG-CG 4.47Å; K9-Q13 WeakPolarHBondContact O-CB 3.27Å; K9-Q13 WeakPolarHBondContact O-CG 3.5Å; K9-Q13 PolarHBondContact O-N 3.02Å
10	E	96.2	Very high	87.4	Confident	120 Å²	120	112 Å²	112	56%	0.561	59%	0.591	S	S	*	*	H	α-helix	trans	-62.3	-45.4	177.3	-73.5	166.9	-173.3	0	0	111.8	R6 A7 R8 I12 Q13 A14	R6-E10 VanDerWaalsContact CG-OE1 3.32Å; R6-E10 WeakPolarHBondContact CG-OE1 3.32Å; R6-E10 WeakPolarHBondContact O-CG 3.35Å; R6-E10 PolarHBondContact O-N 3.36Å; A7-E10 PolarHBondContact O-N 3.4Å; R8-E10 VanDerWaalsContact C-N 3.33Å; E10-I12 PolarHBondContact O-N 3.38Å; E10-Q13 PolarHBondContact O-N 3.08Å; E10-A14 WeakPolarHBondContact O-CB 3.37Å; E10-A14 PolarHBondContact O-N 3.49Å
11	A	95.6	Very high	87.8	Confident	47 Å²	47	111.3 Å²	111.3	39%	0.388	58%	0.583	S	S	.	*	H	α-helix	trans	-58.9	-46.4	175.4	0	0	0	0	0	112.1	A7 R8 Q13 A14 T15	A7-A11 WeakPolarHBondContact O-CB 3.35Å; A7-A11 PolarHBondContact O-N 3.31Å; R8-A11 PolarHBondContact O-N 3.02Å; A11-Q13 VanDerWaalsContact C-N 3.34Å; A11-Q13 PolarHBondContact O-N 3.12Å; A11-A14 PolarHBondContact O-N 2.99Å; A11-T15 PolarHBondContact O-N 2.97Å; A11-T15 PolarHBondContact O-OG1 3.13Å; A11-T15 VanDerWaalsContact O-OG1 3.11Å
12	I	96.5	Very high	90.1	Very high	82 Å²	82	101.4 Å²	101.4	42%	0.421	53%	0.534	S	S	.	.	H	α-helix	trans	-60.6	-44.8	177	-68.4	166	0	0	0	110.9	R8 K9 E10 A14 T15 A16	R8-I12 HydrophobicContact CG-CD1 3.99Å; R8-I12 VanDerWaalsContact O-CG1 3.3Å; R8-I12 WeakPolarHBondContact O-CG1 3.49Å; R8-I12 PolarHBondContact O-N 3.02Å; K9-I12 PolarHBondContact O-N 2.66Å; E10-I12 PolarHBondContact O-N 3.38Å; I12-A14 VanDerWaalsContact C-N 3.33Å; I12-A14 PolarHBondContact O-N 3.42Å; I12-T15 PolarHBondContact O-N 3.28Å; I12-A16 WeakPolarHBondContact O-CB 3.45Å; I12-A16 PolarHBondContact O-N 2.95Å
13	Q	97.8	Very high	92	Very high	82 Å²	82	100.9 Å²	100.9	38%	0.383	52%	0.52	S	S	.	.	H	α-helix	trans	-65.3	-36.9	179	-72.2	-69.5	-37.8	0	0	112	K9 E10 A11 R17	K9-Q13 HydrophobicContact CG-CG 4.47Å; K9-Q13 WeakPolarHBondContact O-CB 3.27Å; K9-Q13 WeakPolarHBondContact O-CG 3.5Å; K9-Q13 PolarHBondContact O-N 3.02Å; E10-Q13 PolarHBondContact O-N 3.08Å; A11-Q13 VanDerWaalsContact C-N 3.34Å; A11-Q13 PolarHBondContact O-N 3.12Å; Q13-R17 WeakPolarHBondContact O-CB 3.36Å; Q13-R17 VanDerWaalsContact O-CG 3.24Å; Q13-R17 WeakPolarHBondContact O-CG 3.39Å; Q13-R17 PolarHBondContact O-N 3.39Å; Q13-R17 PolarHBondContact O-NE 3.42Å
14	A	97	Very high	93.8	Very high	51 Å²	51	99.4 Å²	99.4	42%	0.421	52%	0.516	S	S	.	.	H	α-helix	trans	-63.3	-48.7	174.6	0	0	0	0	0	111.1	E10 A11 I12 A16 R17 E18	E10-A14 WeakPolarHBondContact O-CB 3.37Å; E10-A14 PolarHBondContact O-N 3.49Å; A11-A14 PolarHBondContact O-N 2.99Å; I12-A14 VanDerWaalsContact C-N 3.33Å; I12-A14 PolarHBondContact O-N 3.42Å; A14-A16 PolarHBondContact O-N 3.24Å; A14-R17 PolarHBondContact O-N 3.45Å; A14-E18 PolarHBondContact O-N 2.96Å
15	T	96.8	Very high	94.8	Very high	102 Å²	102	99.3 Å²	99.3	63%	0.626	50%	0.504	S	S	*	.	H	α-helix	trans	-60.2	-44.1	177.1	-53.4	0	0	0	0	112.1	A11 I12 R17 E18 L19	A11-T15 PolarHBondContact O-N 2.97Å; A11-T15 PolarHBondContact O-OG1 3.13Å; A11-T15 VanDerWaalsContact O-OG1 3.11Å; I12-T15 PolarHBondContact O-N 3.28Å; T15-R17 PolarHBondContact O-N 3Å; T15-E18 PolarHBondContact O-N 3.39Å; T15-L19 PolarHBondContact O-N 3.4Å
16	A	97.8	Very high	95.4	Very high	44 Å²	44	97.5 Å²	97.5	36%	0.364	48%	0.483	S	S	.	.	H	α-helix	trans	-62.5	-42.1	178.1	0	0	0	0	0	112.1	I12 A14 L19 L20	I12-A16 WeakPolarHBondContact O-CB 3.45Å; I12-A16 PolarHBondContact O-N 2.95Å; A14-A16 PolarHBondContact O-N 3.24Å; A16-L19 PolarHBondContact O-N 2.9Å; A16-L20 WeakPolarHBondContact O-CG 3.38Å; A16-L20 PolarHBondContact O-N 3.36Å
17	R	98.1	Very high	95.6	Very high	146 Å²	146	93.4 Å²	93.4	55%	0.551	48%	0.481	S	S	*	.	H	α-helix	trans	-63.9	-40.5	176.2	-72.7	176.1	-136.9	-88.7	2.8	112.1	Q13 A14 T15 L19 L20 K21	Q13-R17 WeakPolarHBondContact O-CB 3.36Å; Q13-R17 VanDerWaalsContact O-CG 3.24Å; Q13-R17 WeakPolarHBondContact O-CG 3.39Å; Q13-R17 PolarHBondContact O-N 3.39Å; Q13-R17 PolarHBondContact O-NE 3.42Å; A14-R17 PolarHBondContact O-N 3.45Å; T15-R17 PolarHBondContact O-N 3Å; R17-L19 VanDerWaalsContact C-N 3.34Å; R17-L20 PolarHBondContact O-N 3.44Å; R17-K21 WeakPolarHBondContact O-CG 3.47Å; R17-K21 PolarHBondContact O-N 3.04Å
18	E	96.7	Very high	95.9	Very high	82 Å²	82	92.6 Å²	92.6	38%	0.383	47%	0.472	S	S	.	.	H	α-helix	trans	-65.2	-37.9	176.6	-74.8	-53.3	126.4	0	0	112.4	A14 T15 K21 F22	A14-E18 PolarHBondContact O-N 2.96Å; T15-E18 PolarHBondContact O-N 3.39Å; E18-K21 PolarHBondContact O-N 3.37Å; E18-K21 WeakPolarHBondContact OE1-CD 3.43Å; E18-K21 WeakPolarHBondContact OE1-CE 3.45Å; E18-K21 IonicContact OE1-NZ 2.7Å; E18-K21 PolarHBondContact OE1-NZ 2.83Å; E18-F22 PolarHBondContact O-N 2.95Å
19	L	96.6	Very high	96.1	Very high	108 Å²	108	89.4 Å²	89.4	57%	0.565	47%	0.473	S	S	*	.	H	α-helix	trans	-61.9	-46	172.2	177.6	62.2	0	0	0	111.5	T15 A16 R17 K21 F22 V23	T15-L19 PolarHBondContact O-N 3.4Å; A16-L19 PolarHBondContact O-N 2.9Å; R17-L19 VanDerWaalsContact C-N 3.34Å; L19-K21 VanDerWaalsContact C-N 3.31Å; L19-K21 PolarHBondContact O-N 2.83Å; L19-F22 WeakPolarHBondContact O-CB 3.43Å; L19-F22 PolarHBondContact O-N 3.37Å; L19-F22 VanDerWaalsContact O-N 3.13Å; L19-V23 HydrophobicContact CD1-CG2 4.28Å; L19-V23 WeakPolarHBondContact O-CG2 3.39Å; L19-V23 PolarHBondContact O-N 2.93Å
20	L	97.5	Very high	96.2	Very high	105 Å²	105	90.9 Å²	90.9	55%	0.55	48%	0.48	S	S	.	.	H	α-helix	trans	-61	-40.6	177.4	-68.6	174.9	0	0	0	111.9	A16 R17 F22 V23 N24	A16-L20 WeakPolarHBondContact O-CG 3.38Å; A16-L20 PolarHBondContact O-N 3.36Å; R17-L20 PolarHBondContact O-N 3.44Å; L20-F22 VanDerWaalsContact C-N 3.33Å; L20-F22 PolarHBondContact O-N 2.89Å; L20-V23 PolarHBondContact O-N 3.01Å; L20-N24 WeakPolarHBondContact O-CB 3.46Å; L20-N24 PolarHBondContact O-N 3.3Å; L20-N24 PolarHBondContact O-ND2 2.86Å
21	K	96	Very high	96.2	Very high	98 Å²	98	89.7 Å²	89.7	43%	0.426	47%	0.474	S	S	.	.	H	α-helix	trans	-60.6	-42.9	173.7	-71.8	175.9	-172.1	171.6	0	111.8	R17 E18 L19 R25	R17-K21 WeakPolarHBondContact O-CG 3.47Å; R17-K21 PolarHBondContact O-N 3.04Å; E18-K21 PolarHBondContact O-N 3.37Å; E18-K21 WeakPolarHBondContact OE1-CD 3.43Å; E18-K21 WeakPolarHBondContact OE1-CE 3.45Å; E18-K21 IonicContact OE1-NZ 2.7Å; E18-K21 PolarHBondContact OE1-NZ 2.83Å; L19-K21 VanDerWaalsContact C-N 3.31Å; L19-K21 PolarHBondContact O-N 2.83Å; K21-R25 WeakPolarHBondContact O-CB 3.39Å; K21-R25 VanDerWaalsContact O-CG 3.3Å; K21-R25 WeakPolarHBondContact O-CG 3.5Å; K21-R25 PolarHBondContact O-N 2.7Å; K21-R25 VanDerWaalsContact O-N 3.15Å
22	F	95.7	Very high	96.3	Very high	47 Å²	47	89.9 Å²	89.9	21%	0.206	47%	0.47	C	S	.	.	H	α-helix	trans	-61.2	-48.6	177.3	178.8	-95.1	0	0	0	111.8	E18 L19 L20 R25 S26 V32 E35	E18-F22 PolarHBondContact O-N 2.95Å; L19-F22 WeakPolarHBondContact O-CB 3.43Å; L19-F22 PolarHBondContact O-N 3.37Å; L19-F22 VanDerWaalsContact O-N 3.13Å; L20-F22 VanDerWaalsContact C-N 3.33Å; L20-F22 PolarHBondContact O-N 2.89Å; F22-R25 PolarHBondContact O-N 2.99Å; F22-S26 WeakPolarHBondContact O-CB 3.37Å; F22-S26 PolarHBondContact O-N 3.37Å; F22-S26 PolarHBondContact O-OG 3.39Å; F22-V32 HydrophobicContact CE1-CG1 4.28Å; F22-V32 HydrophobicContact CZ-CG1 3.84Å; F22-E35 HydrophobicContact CD2-CB 4.43Å; F22-E35 HydrophobicContact CD2-CG 3.44Å; F22-E35 VanDerWaalsContact CD2-CG 3.44Å; F22-E35 HydrophobicContact CE2-CB 4.12Å; F22-E35 HydrophobicContact CE2-CG 3.57Å; F22-E35 HydrophobicContact CG-CG 4.49Å
23	V	95.9	Very high	96.3	Very high	81 Å²	81	90.8 Å²	90.8	49%	0.491	48%	0.479	S	S	.	.	H	α-helix	trans	-62.2	-46.7	179.3	172.9	0	0	0	0	111.1	L19 L20 R25 S26	L19-V23 HydrophobicContact CD1-CG2 4.28Å; L19-V23 WeakPolarHBondContact O-CG2 3.39Å; L19-V23 PolarHBondContact O-N 2.93Å; L20-V23 PolarHBondContact O-N 3.01Å; V23-R25 PolarHBondContact O-N 3.36Å; V23-S26 PolarHBondContact O-N 3.49Å
24	N	95.1	Very high	96.2	Very high	133 Å²	133	89.5 Å²	89.5	71%	0.711	48%	0.483	S	S	*	.	H	α-helix	trans	-63.9	-28	-179.5	-71.8	-16.7	0	0	0	113.4	L20 S26	L20-N24 WeakPolarHBondContact O-CB 3.46Å; L20-N24 PolarHBondContact O-N 3.3Å; L20-N24 PolarHBondContact O-ND2 2.86Å; N24-S26 VanDerWaalsContact C-N 3.28Å
25	R	92.8	Very high	96.2	Very high	146 Å²	146	88.2 Å²	88.2	55%	0.551	47%	0.468	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82	-6.7	174.9	-72.1	177.6	-179.4	172.6	-1.9	113.6	K21 F22 V23 P27 E35	K21-R25 WeakPolarHBondContact O-CB 3.39Å; K21-R25 VanDerWaalsContact O-CG 3.3Å; K21-R25 WeakPolarHBondContact O-CG 3.5Å; K21-R25 PolarHBondContact O-N 2.7Å; K21-R25 VanDerWaalsContact O-N 3.15Å; F22-R25 PolarHBondContact O-N 2.99Å; V23-R25 PolarHBondContact O-N 3.36Å; R25-P27 WeakPolarHBondContact O-CD 3.3Å; R25-E35 WeakPolarHBondContact CD-OE2 3.48Å; R25-E35 IonicContact NH1-OE1 3.37Å; R25-E35 PolarHBondContact NH1-OE1 3.13Å
26	S	93.8	Very high	96.2	Very high	18 Å²	18	85.9 Å²	85.9	13%	0.126	46%	0.455	C	S	.	.			trans	-120.4	62.9	-170.1	-54.7	0	0	0	0	112.9	F22 V23 N24 S28	F22-S26 WeakPolarHBondContact O-CB 3.37Å; F22-S26 PolarHBondContact O-N 3.37Å; F22-S26 PolarHBondContact O-OG 3.39Å; V23-S26 PolarHBondContact O-N 3.49Å; N24-S26 VanDerWaalsContact C-N 3.28Å; S26-S28 PolarHBondContact O-N 3.14Å
27	P	93.8	Very high	96.1	Very high	103 Å²	103	89.4 Å²	89.4	67%	0.669	46%	0.459	S	S	*	.	S	Bend	trans	-69.7	-11.7	-177	29.4	-37	0	0	0	114.2	R25 H31	R25-P27 WeakPolarHBondContact O-CD 3.3Å; P27-H31 HydrophobicContact CG-CB 4.31Å
28	S	97	Very high	96	Very high	37 Å²	37	84.7 Å²	84.7	26%	0.259	45%	0.448	S	S	.	.	S	Bend	trans	-146.4	165	173.8	83.9	0	0	0	0	111.4	S26 F30 H31 V32	S26-S28 PolarHBondContact O-N 3.14Å; S28-F30 PolarHBondContact O-N 3.46Å; S28-F30 PolarHBondContact OG-N 3.34Å; S28-H31 WeakPolarHBondContact O-CB 3.2Å; S28-H31 PolarHBondContact O-N 3.15Å; S28-H31 PolarHBondContact OG-ND1 3.3Å; S28-V32 PolarHBondContact O-N 3.48Å
29	P	96.4	Very high	96	Very high	100 Å²	100	84.9 Å²	84.9	65%	0.649	45%	0.446	S	S	*	.	H	α-helix	trans	-54.3	-36.7	177.8	-27.6	36	0	0	0	113.7	H31 V32 V33	P29-H31 VanDerWaalsContact C-N 3.34Å; P29-H31 PolarHBondContact O-N 3.25Å; P29-V32 WeakPolarHBondContact O-CB 3.45Å; P29-V32 PolarHBondContact O-N 2.77Å; P29-V33 PolarHBondContact O-N 3.27Å; P29-V33 VanDerWaalsContact O-N 3.14Å
30	F	97.1	Very high	96	Very high	177 Å²	177	84 Å²	84	78%	0.776	44%	0.441	S	S	*	.	H	α-helix	trans	-64.7	-37.2	175.9	-60.9	-71.1	0	0	0	112.5	S28 V33 A34	S28-F30 PolarHBondContact O-N 3.46Å; S28-F30 PolarHBondContact OG-N 3.34Å; F30-V33 PolarHBondContact O-N 3.07Å; F30-A34 PolarHBondContact O-N 2.95Å
31	H	96.4	Very high	96	Very high	95 Å²	95	82.5 Å²	82.5	44%	0.44	43%	0.433	S	S	.	.	H	α-helix	trans	-70.1	-34.8	175.9	-64.2	90.1	0	0	0	112.1	P27 S28 P29 V33 A34 E35	P27-H31 HydrophobicContact CG-CB 4.31Å; S28-H31 WeakPolarHBondContact O-CB 3.2Å; S28-H31 PolarHBondContact O-N 3.15Å; S28-H31 PolarHBondContact OG-ND1 3.3Å; P29-H31 VanDerWaalsContact C-N 3.34Å; P29-H31 PolarHBondContact O-N 3.25Å; H31-V33 VanDerWaalsContact C-N 3.33Å; H31-V33 PolarHBondContact O-N 3.46Å; H31-A34 PolarHBondContact O-N 3.19Å; H31-E35 WeakPolarHBondContact O-CB 3.47Å; H31-E35 PolarHBondContact O-N 2.82Å
32	V	97.1	Very high	96	Very high	51 Å²	51	85 Å²	85	31%	0.309	45%	0.446	S	S	.	.	H	α-helix	trans	-57.1	-49.5	172	179.3	0	0	0	0	110	F22 S28 P29 A34 E35 C36	F22-V32 HydrophobicContact CE1-CG1 4.28Å; F22-V32 HydrophobicContact CZ-CG1 3.84Å; S28-V32 PolarHBondContact O-N 3.48Å; P29-V32 WeakPolarHBondContact O-CB 3.45Å; P29-V32 PolarHBondContact O-N 2.77Å; V32-A34 VanDerWaalsContact C-N 3.35Å; V32-A34 PolarHBondContact O-N 3.32Å; V32-E35 PolarHBondContact O-N 2.97Å; V32-C36 WeakPolarHBondContact O-CB 3.3Å; V32-C36 PolarHBondContact O-N 3.32Å; V32-C36 PolarHBondContact O-SG 3.02Å; V32-C36 VanDerWaalsContact O-SG 3.37Å
33	V	96.9	Very high	96.1	Very high	100 Å²	100	86.1 Å²	86.1	61%	0.606	46%	0.464	S	S	*	.	H	α-helix	trans	-61.9	-43.1	178.9	175	0	0	0	0	111.1	P29 F30 H31 C36 R37	P29-V33 PolarHBondContact O-N 3.27Å; P29-V33 VanDerWaalsContact O-N 3.14Å; F30-V33 PolarHBondContact O-N 3.07Å; H31-V33 VanDerWaalsContact C-N 3.33Å; H31-V33 PolarHBondContact O-N 3.46Å; V33-C36 PolarHBondContact O-N 3.39Å; V33-R37 WeakPolarHBondContact O-CB 3.47Å; V33-R37 PolarHBondContact O-N 2.97Å
34	A	95.9	Very high	96.2	Very high	56 Å²	56	85.5 Å²	85.5	46%	0.463	47%	0.474	S	S	.	.	H	α-helix	trans	-63	-42.4	177.7	0	0	0	0	0	112.8	F30 H31 V32 R37 S38	F30-A34 PolarHBondContact O-N 2.95Å; H31-A34 PolarHBondContact O-N 3.19Å; V32-A34 VanDerWaalsContact C-N 3.35Å; V32-A34 PolarHBondContact O-N 3.32Å; A34-R37 PolarHBondContact O-N 3.5Å; A34-S38 WeakPolarHBondContact O-CB 3.32Å; A34-S38 PolarHBondContact O-N 2.85Å
35	E	96.3	Very high	96.2	Very high	24 Å²	24	85.3 Å²	85.3	11%	0.112	47%	0.468	C	S	.	.	H	α-helix	trans	-65.7	-42.4	176.1	179.4	70	-170.9	0	0	111	F22 R25 H31 V32 S38 R39	F22-E35 HydrophobicContact CD2-CB 4.43Å; F22-E35 HydrophobicContact CD2-CG 3.44Å; F22-E35 VanDerWaalsContact CD2-CG 3.44Å; F22-E35 HydrophobicContact CE2-CB 4.12Å; F22-E35 HydrophobicContact CE2-CG 3.57Å; F22-E35 HydrophobicContact CG-CG 4.49Å; R25-E35 WeakPolarHBondContact CD-OE2 3.48Å; R25-E35 IonicContact NH1-OE1 3.37Å; R25-E35 PolarHBondContact NH1-OE1 3.13Å; H31-E35 WeakPolarHBondContact O-CB 3.47Å; H31-E35 PolarHBondContact O-N 2.82Å; V32-E35 PolarHBondContact O-N 2.97Å; E35-S38 PolarHBondContact O-N 3.24Å; E35-R39 WeakPolarHBondContact O-CG 3.44Å; E35-R39 PolarHBondContact O-N 3.36Å; E35-R39 IonicContact OE1-CZ 3.31Å; E35-R39 VanDerWaalsContact OE1-CZ 3.31Å; E35-R39 IonicContact OE1-NE 2.95Å; E35-R39 PolarHBondContact OE1-NE 3.25Å; E35-R39 IonicContact OE1-NH2 2.83Å; E35-R39 PolarHBondContact OE1-NH2 2.97Å
36	C	96.6	Very high	96.3	Very high	52 Å²	52	86.4 Å²	86.4	35%	0.351	47%	0.472	S	S	.	.	H	α-helix	trans	-60.4	-48.2	173.7	-74.5	0	0	0	0	111.9	V32 V33 S38 R39 L40	V32-C36 WeakPolarHBondContact O-CB 3.3Å; V32-C36 PolarHBondContact O-N 3.32Å; V32-C36 PolarHBondContact O-SG 3.02Å; V32-C36 VanDerWaalsContact O-SG 3.37Å; V33-C36 PolarHBondContact O-N 3.39Å; C36-S38 VanDerWaalsContact C-N 3.33Å; C36-S38 PolarHBondContact O-N 3.45Å; C36-R39 PolarHBondContact O-N 3Å; C36-L40 WeakPolarHBondContact O-CG 3.24Å; C36-L40 PolarHBondContact O-N 3.44Å
37	R	96.4	Very high	96.4	Very high	119 Å²	119	90.7 Å²	90.7	45%	0.449	49%	0.489	S	S	.	.	H	α-helix	trans	-55.7	-48.5	175.7	177.5	-178.7	175.6	-93.4	-1.5	111	V33 A34 R39 L40 L41 E47	V33-R37 WeakPolarHBondContact O-CB 3.47Å; V33-R37 PolarHBondContact O-N 2.97Å; A34-R37 PolarHBondContact O-N 3.5Å; R37-R39 VanDerWaalsContact C-N 3.34Å; R37-R39 PolarHBondContact O-N 3.48Å; R37-L40 PolarHBondContact O-N 2.96Å; R37-L41 HydrophobicContact CG-CD1 4.05Å; R37-L41 HydrophobicContact CG-CG 4.47Å; R37-L41 VanDerWaalsContact O-CG 3.32Å; R37-L41 WeakPolarHBondContact O-CG 3.48Å; R37-L41 PolarHBondContact O-N 2.94Å; R37-E47 IonicContact CZ-OE1 2.66Å; R37-E47 IonicContact CZ-OE2 2.83Å; R37-E47 IonicContact NE-OE1 3.2Å; R37-E47 PolarHBondContact NE-OE1 3.4Å; R37-E47 IonicContact NE-OE2 2.9Å; R37-E47 PolarHBondContact NE-OE2 2.97Å; R37-E47 IonicContact NH2-OE1 3.48Å; R37-E47 IonicContact NH2-OE2 3.72Å; R37-E47 PolarHBondContact NH2-OE2 2.95Å
38	S	95.9	Very high	96.5	Very high	46 Å²	46	88.8 Å²	88.8	32%	0.322	47%	0.473	S	S	.	.	H	α-helix	trans	-58.4	-44.2	179	-176.2	0	0	0	0	112.3	A34 E35 C36 L41 Q42	A34-S38 WeakPolarHBondContact O-CB 3.32Å; A34-S38 PolarHBondContact O-N 2.85Å; E35-S38 PolarHBondContact O-N 3.24Å; C36-S38 VanDerWaalsContact C-N 3.33Å; C36-S38 PolarHBondContact O-N 3.45Å; S38-L41 PolarHBondContact O-N 3.39Å; S38-Q42 WeakPolarHBondContact O-CB 3.4Å; S38-Q42 VanDerWaalsContact O-CG 3.27Å; S38-Q42 WeakPolarHBondContact O-CG 3.37Å; S38-Q42 PolarHBondContact O-N 3.43Å; S38-Q42 PolarHBondContact O-NE2 3.47Å; S38-Q42 PolarHBondContact OG-NE2 3.48Å
39	R	95.9	Very high	96.3	Very high	87 Å²	87	93 Å²	93	33%	0.328	49%	0.487	S	S	.	.	H	α-helix	trans	-65.9	-40.7	177.9	-70.7	174.2	-176.9	-124.2	-0.9	112.7	E35 C36 R37 Q42 A43	E35-R39 WeakPolarHBondContact O-CG 3.44Å; E35-R39 PolarHBondContact O-N 3.36Å; E35-R39 IonicContact OE1-CZ 3.31Å; E35-R39 VanDerWaalsContact OE1-CZ 3.31Å; E35-R39 IonicContact OE1-NE 2.95Å; E35-R39 PolarHBondContact OE1-NE 3.25Å; E35-R39 IonicContact OE1-NH2 2.83Å; E35-R39 PolarHBondContact OE1-NH2 2.97Å; C36-R39 PolarHBondContact O-N 3Å; R37-R39 VanDerWaalsContact C-N 3.34Å; R37-R39 PolarHBondContact O-N 3.48Å; R39-Q42 PolarHBondContact O-N 3.01Å; R39-A43 WeakPolarHBondContact O-CB 3.43Å; R39-A43 PolarHBondContact O-N 3.01Å
40	L	97.6	Very high	96.2	Very high	90 Å²	90	97 Å²	97	47%	0.471	50%	0.497	S	S	.	.	H	α-helix	trans	-62.9	-46.2	175.8	-72.3	169.1	0	0	0	111.2	C36 R37 Q42 A43 G44 F45	C36-L40 WeakPolarHBondContact O-CG 3.24Å; C36-L40 PolarHBondContact O-N 3.44Å; R37-L40 PolarHBondContact O-N 2.96Å; L40-Q42 VanDerWaalsContact C-N 3.33Å; L40-Q42 PolarHBondContact O-N 3.3Å; L40-A43 CarbonylContact O-C 3.59Å; L40-A43 PolarHBondContact O-N 3.27Å; L40-A43 VanDerWaalsContact O-N 3.12Å; L40-G44 PolarHBondContact O-N 3.03Å; L40-F45 HydrophobicContact CB-CB 4.15Å; L40-F45 HydrophobicContact CB-CG 4.44Å; L40-F45 HydrophobicContact CD2-CD1 4.47Å; L40-F45 HydrophobicContact CD2-CD2 4.07Å; L40-F45 HydrophobicContact CD2-CE2 4.29Å; L40-F45 HydrophobicContact CD2-CG 4.16Å; L40-F45 WeakPolarHBondContact O-CB 3.36Å; L40-F45 WeakPolarHBondContact O-CD2 3.22Å; L40-F45 PolarHBondContact O-N 3.33Å
41	L	97.3	Very high	96.1	Very high	73 Å²	73	95 Å²	95	38%	0.382	50%	0.499	S	S	.	.	H	α-helix	trans	-60.7	-42.1	176.3	-68.3	173.9	0	0	0	111.8	R37 S38 A43 G44 F45 E47	R37-L41 HydrophobicContact CG-CD1 4.05Å; R37-L41 HydrophobicContact CG-CG 4.47Å; R37-L41 VanDerWaalsContact O-CG 3.32Å; R37-L41 WeakPolarHBondContact O-CG 3.48Å; R37-L41 PolarHBondContact O-N 2.94Å; S38-L41 PolarHBondContact O-N 3.39Å; L41-A43 VanDerWaalsContact C-N 3.27Å; L41-A43 PolarHBondContact O-N 3.11Å; L41-G44 PolarHBondContact O-N 3.31Å; L41-F45 WeakPolarHBondContact CD2-O 3.29Å; L41-E47 HydrophobicContact CD2-CB 4.34Å
42	Q	96.5	Very high	96	Very high	150 Å²	150	95.4 Å²	95.4	70%	0.701	50%	0.502	S	S	*	.	H	α-helix	trans	-64.2	-30.6	175.8	-73.8	170.9	49	0	0	113.1	S38 R39 L40 G44	S38-Q42 WeakPolarHBondContact O-CB 3.4Å; S38-Q42 VanDerWaalsContact O-CG 3.27Å; S38-Q42 WeakPolarHBondContact O-CG 3.37Å; S38-Q42 PolarHBondContact O-N 3.43Å; S38-Q42 PolarHBondContact O-NE2 3.47Å; S38-Q42 PolarHBondContact OG-NE2 3.48Å; R39-Q42 PolarHBondContact O-N 3.01Å; L40-Q42 VanDerWaalsContact C-N 3.33Å; L40-Q42 PolarHBondContact O-N 3.3Å; Q42-G44 PolarHBondContact O-N 3.01Å
43	A	97.6	Very high	95.7	Very high	71 Å²	71	97 Å²	97	59%	0.587	53%	0.528	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.6	2.2	174.1	0	0	0	0	0	113.3	R39 L40 L41 F45	R39-A43 WeakPolarHBondContact O-CB 3.43Å; R39-A43 PolarHBondContact O-N 3.01Å; L40-A43 CarbonylContact O-C 3.59Å; L40-A43 PolarHBondContact O-N 3.27Å; L40-A43 VanDerWaalsContact O-N 3.12Å; L41-A43 VanDerWaalsContact C-N 3.27Å; L41-A43 PolarHBondContact O-N 3.11Å; A43-F45 HydrophobicContact CB-CD2 3.84Å; A43-F45 HydrophobicContact CB-CE2 3.93Å
44	G	97.3	Very high	95.5	Very high	68 Å²	68	98.7 Å²	98.7	70%	0.701	52%	0.524	S	S	*	.	T	Hydrogen-bonded Turn	trans	88.3	12.3	177.1	0	0	0	0	0	114.8	L40 L41 Q42	L40-G44 PolarHBondContact O-N 3.03Å; L41-G44 PolarHBondContact O-N 3.31Å; Q42-G44 PolarHBondContact O-N 3.01Å
45	F	96.7	Very high	94.9	Very high	129 Å²	129	103.2 Å²	103.2	57%	0.566	54%	0.54	S	S	*	.	P	Polyproline II helix	trans	-73.7	147.7	174.1	-70.3	-103	0	0	0	110.9	L40 L41 A43	L40-F45 HydrophobicContact CB-CB 4.15Å; L40-F45 HydrophobicContact CB-CG 4.44Å; L40-F45 HydrophobicContact CD2-CD1 4.47Å; L40-F45 HydrophobicContact CD2-CD2 4.07Å; L40-F45 HydrophobicContact CD2-CE2 4.29Å; L40-F45 HydrophobicContact CD2-CG 4.16Å; L40-F45 WeakPolarHBondContact O-CB 3.36Å; L40-F45 WeakPolarHBondContact O-CD2 3.22Å; L40-F45 PolarHBondContact O-N 3.33Å; L41-F45 WeakPolarHBondContact CD2-O 3.29Å; A43-F45 HydrophobicContact CB-CD2 3.84Å; A43-F45 HydrophobicContact CB-CE2 3.93Å
46	R	94.6	Very high	93.9	Very high	169 Å²	169	110.6 Å²	110.6	64%	0.638	58%	0.579	S	S	*	*	P	Polyproline II helix	trans	-93.8	129.5	173.3	-177.8	174.7	67.7	177.9	2.5	109.6	L48 D55	R46-L48 HydrophobicContact CG-CD2 4.38Å; R46-D55 PolarHBondContact NH2-O 3.16Å
47	E	95.2	Very high	93.7	Very high	107 Å²	107	113.6 Å²	113.6	50%	0.5	59%	0.59	S	S	.	*	P	Polyproline II helix	trans	-71.9	134.3	169.7	-177.6	172.5	-151.6	0	0	110.1	R37 L41	R37-E47 IonicContact CZ-OE1 2.66Å; R37-E47 IonicContact CZ-OE2 2.83Å; R37-E47 IonicContact NE-OE1 3.2Å; R37-E47 PolarHBondContact NE-OE1 3.4Å; R37-E47 IonicContact NE-OE2 2.9Å; R37-E47 PolarHBondContact NE-OE2 2.97Å; R37-E47 IonicContact NH2-OE1 3.48Å; R37-E47 IonicContact NH2-OE2 3.72Å; R37-E47 PolarHBondContact NH2-OE2 2.95Å; L41-E47 HydrophobicContact CD2-CB 4.34Å
48	L	94.9	Very high	93.6	Very high	63 Å²	63	113.3 Å²	113.3	33%	0.33	60%	0.597	S	S	.	*			trans	-115.1	139.4	177.7	-59.4	177.1	0	0	0	108.9	R46 W54 I56	R46-L48 HydrophobicContact CG-CD2 4.38Å; L48-W54 HydrophobicContact CB-CD2 4.22Å; L48-W54 HydrophobicContact CB-CH2 4.4Å; L48-W54 HydrophobicContact CB-CZ2 3.8Å; L48-W54 HydrophobicContact CD1-CD2 3.68Å; L48-W54 HydrophobicContact CD1-CE3 3.66Å; L48-W54 HydrophobicContact CD1-CG 4.19Å; L48-W54 HydrophobicContact CD1-CH2 4.3Å; L48-W54 HydrophobicContact CD1-CZ2 4.32Å; L48-W54 HydrophobicContact CD1-CZ3 3.98Å; L48-I56 HydrophobicContact CD1-CG2 4.3Å
49	K	94.4	Very high	93.5	Very high	126 Å²	126	117 Å²	117	55%	0.548	61%	0.613	S	S	.	*			trans	-90.2	127.6	172.3	-71	178.5	-175.5	168.8	0	109.4	T51 E52 W54	K49-T51 PolarHBondContact O-N 3.13Å; K49-T51 VanDerWaalsContact O-N 3.13Å; K49-E52 HydrophobicContact CB-CB 4.39Å; K49-E52 HydrophobicContact CB-CG 4.02Å; K49-E52 HydrophobicContact CD-CG 4.44Å; K49-E52 VanDerWaalsContact CD-OE1 3.3Å; K49-E52 WeakPolarHBondContact CD-OE1 3.43Å; K49-E52 IonicContact NZ-OE1 3.77Å; K49-E52 PolarHBondContact NZ-OE1 3.41Å; K49-E52 PolarHBondContact O-N 3.4Å; K49-E52 VanDerWaalsContact O-N 3.08Å; K49-W54 PolarHBondContact O-NE1 3.19Å
50	E	94.1	Very high	93.3	Very high	185 Å²	185	118.8 Å²	118.8	86%	0.864	63%	0.63	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.4	-28.1	-178.6	-170	178.1	176.4	0	0	113.2	E52	E50-E52 VanDerWaalsContact C-N 3.33Å; E50-E52 PolarHBondContact O-N 2.95Å
51	T	95.5	Very high	93.1	Very high	133 Å²	133	120.6 Å²	120.6	82%	0.816	64%	0.639	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82	-7.1	-179.1	57.5	0	0	0	0	114.4	K49	K49-T51 PolarHBondContact O-N 3.13Å; K49-T51 VanDerWaalsContact O-N 3.13Å
52	E	94.1	Very high	92.8	Very high	105 Å²	105	123.7 Å²	123.7	49%	0.491	66%	0.657	S	S	.	*	S	Bend	trans	-100.2	147.6	-178.3	-66.9	176.6	175.5	0	0	110	K49 E50 W54	K49-E52 HydrophobicContact CB-CB 4.39Å; K49-E52 HydrophobicContact CB-CG 4.02Å; K49-E52 HydrophobicContact CD-CG 4.44Å; K49-E52 VanDerWaalsContact CD-OE1 3.3Å; K49-E52 WeakPolarHBondContact CD-OE1 3.43Å; K49-E52 IonicContact NZ-OE1 3.77Å; K49-E52 PolarHBondContact NZ-OE1 3.41Å; K49-E52 PolarHBondContact O-N 3.4Å; K49-E52 VanDerWaalsContact O-N 3.08Å; E50-E52 VanDerWaalsContact C-N 3.33Å; E50-E52 PolarHBondContact O-N 2.95Å; E52-W54 PolarHBondContact O-N 3.36Å; E52-W54 PolarHBondContact O-NE1 3.19Å
53	G	90.8	Very high	92.5	Very high	84 Å²	84	121.9 Å²	121.9	87%	0.866	65%	0.653	S	S	*	*	P	Polyproline II helix	trans	-66.8	124.9	170	0	0	0	0	0	109.6
54	W	92.6	Very high	92.1	Very high	135 Å²	135	125.8 Å²	125.8	51%	0.511	66%	0.659	S	S	.	*	P	Polyproline II helix	trans	-89.2	121.8	-179	-60.7	-2.8	0	0	0	110	L48 K49 E52 I56	L48-W54 HydrophobicContact CB-CD2 4.22Å; L48-W54 HydrophobicContact CB-CH2 4.4Å; L48-W54 HydrophobicContact CB-CZ2 3.8Å; L48-W54 HydrophobicContact CD1-CD2 3.68Å; L48-W54 HydrophobicContact CD1-CE3 3.66Å; L48-W54 HydrophobicContact CD1-CG 4.19Å; L48-W54 HydrophobicContact CD1-CH2 4.3Å; L48-W54 HydrophobicContact CD1-CZ2 4.32Å; L48-W54 HydrophobicContact CD1-CZ3 3.98Å; K49-W54 PolarHBondContact O-NE1 3.19Å; E52-W54 PolarHBondContact O-N 3.36Å; E52-W54 PolarHBondContact O-NE1 3.19Å; W54-I56 HydrophobicContact CB-CG1 4.35Å; W54-I56 HydrophobicContact CE3-CD1 4.46Å
55	D	82	Confident	91.7	Very high	151 Å²	151	130.6 Å²	130.6	81%	0.807	66%	0.655	S	S	*	*			trans	-104.5	103.4	165.6	-169	34.1	0	0	0	107.1	R46	R46-D55 PolarHBondContact NH2-O 3.16Å
56	I	75.8	Confident	91.3	Very high	180 Å²	180	130.7 Å²	130.7	92%	0.923	66%	0.663	S	S	*	*			trans	-131.1	0	-170.5	39.5	167.6	0	0	0	111.2	L48 W54	L48-I56 HydrophobicContact CD1-CG2 4.3Å; W54-I56 HydrophobicContact CB-CG1 4.35Å; W54-I56 HydrophobicContact CE3-CD1 4.46Å

Retrieved 56 of 56 residues in 29.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).