A0A087WSU3_MOUSE Loading...

NADH:ubiquinone oxidoreductase core subunit S1

AlphaFold DB , UniProt , Accession A0A087WSU3, Species MOUSE (Mus musculus, Mouse), Gene Ndufs1, Length 61 aa.

						>A0A087WSU3_MOUSE|A0A087WSU3|Ndufs1
MVVLGSSALQRDDGAAILVAVSNMVQKIRVTTGVAAEWKVMNILHRIASQVAALDLGYKPG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	68.6	Low	75.7	Confident	156 Å²	156	70.6 Å²	70.6	77%	0.768	38%	0.382	S	S	*	.				0	128	0	-179.4	176.8	81	0	0	107.4	V3 N42	M1-V3 HydrophobicContact CE-CG2 4.06Å; M1-V3 HydrophobicContact CG-CG2 4.29Å; M1-N42 WeakPolarHBondContact CG-ND2 3.32Å
2	V	77.1	Confident	75.6	Confident	38 Å²	38	79.8 Å²	79.8	23%	0.23	43%	0.43	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.7	124.2	179.7	-176.9	0	0	0	0	107.6	V21 V25 I28 V40 N42	V2-V21 HydrophobicContact CG1-CG1 3.84Å; V2-V25 HydrophobicContact CB-CG2 4.03Å; V2-V25 HydrophobicContact CG1-CG2 4.43Å; V2-V25 HydrophobicContact CG2-CG2 3.94Å; V2-I28 HydrophobicContact CG2-CD1 4.41Å; V2-V40 HydrophobicContact CG2-CG1 4.33Å; V2-V40 PolarHBondContact N-O 3.13Å; V2-N42 PolarHBondContact O-N 2.83Å
3	V	79.4	Confident	75.9	Confident	79 Å²	79	78.4 Å²	78.4	48%	0.479	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.7	122.1	-178.4	-176.1	0	0	0	0	109.1	M1 N42 L44	M1-V3 HydrophobicContact CE-CG2 4.06Å; M1-V3 HydrophobicContact CG-CG2 4.29Å; V3-N42 CarbonylContact C-O 3.54Å; V3-N42 WeakPolarHBondContact CA-O 3.49Å; V3-N42 HydrophobicContact CG2-CB 4.35Å; V3-L44 HydrophobicContact CG1-CB 3.96Å
4	L	79.3	Confident	76.1	Confident	17 Å²	17	72.9 Å²	72.9	9%	0.089	39%	0.394	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.1	124.6	175.4	-177.9	62.6	0	0	0	110	A8 L9 I17 L18 V21 N42 I43 L44	L4-A8 HydrophobicContact CD1-CB 3.96Å; L4-L9 HydrophobicContact CD2-CD1 4.18Å; L4-L9 HydrophobicContact CD2-CD2 3.9Å; L4-L9 HydrophobicContact CD2-CG 3.99Å; L4-I17 HydrophobicContact CD1-CG2 3.87Å; L4-I17 HydrophobicContact CD2-CG2 4.5Å; L4-L18 HydrophobicContact CD2-CD1 4.17Å; L4-V21 HydrophobicContact CD1-CG2 4.44Å; L4-N42 PolarHBondContact N-O 2.84Å; L4-I43 CarbonylContact O-C 3.57Å; L4-I43 WeakPolarHBondContact O-CA 3.44Å; L4-L44 PolarHBondContact O-N 3.48Å
5	G	80	Confident	76.3	Confident	27 Å²	27	73.1 Å²	73.1	28%	0.278	41%	0.409	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.3	134.9	174.4	0	0	0	0	0	111.8	S7 A8	G5-S7 PolarHBondContact O-N 3.44Å; G5-S7 VanDerWaalsContact O-N 3.13Å; G5-A8 WeakPolarHBondContact O-CB 3.36Å; G5-A8 PolarHBondContact O-N 3.25Å
6	S	75.4	Confident	76.6	Confident	9 Å²	9	72.6 Å²	72.6	6%	0.063	42%	0.417	C	S	.	.	H	α-helix	trans	-57.5	-23.6	176	47.5	0	0	0	0	114.4	A8 L9 L44 H45 R46	S6-A8 VanDerWaalsContact C-N 3.33Å; S6-A8 PolarHBondContact O-N 2.97Å; S6-L9 PolarHBondContact O-N 3.3Å; S6-L44 WeakPolarHBondContact CB-O 3.49Å; S6-L44 PolarHBondContact N-O 2.59Å; S6-L44 PolarHBondContact OG-O 3.21Å; S6-H45 WeakPolarHBondContact OG-CA 3.34Å; S6-R46 PolarHBondContact OG-N 2.85Å
7	S	74.6	Confident	77	Confident	85 Å²	85	70.9 Å²	70.9	59%	0.594	41%	0.406	S	S	*	.	H	α-helix	trans	-67.2	-30.3	173.5	51.8	0	0	0	0	113.5	G5 L9 Q10	G5-S7 PolarHBondContact O-N 3.44Å; G5-S7 VanDerWaalsContact O-N 3.13Å; S7-L9 PolarHBondContact O-N 2.89Å; S7-Q10 PolarHBondContact O-N 3.38Å
8	A	71.9	Confident	77.2	Confident	26 Å²	26	70.5 Å²	70.5	22%	0.215	40%	0.402	C	S	.	.	H	α-helix	trans	-71.6	-22.8	175.9	0	0	0	0	0	112	L4 G5 S6 G14	L4-A8 HydrophobicContact CD1-CB 3.96Å; G5-A8 WeakPolarHBondContact O-CB 3.36Å; G5-A8 PolarHBondContact O-N 3.25Å; S6-A8 VanDerWaalsContact C-N 3.33Å; S6-A8 PolarHBondContact O-N 2.97Å; A8-G14 WeakPolarHBondContact O-CA 3.28Å
9	L	74.3	Confident	77.5	Confident	54 Å²	54	71.2 Å²	71.2	28%	0.283	41%	0.407	S	S	.	.	H	α-helix	trans	-82.9	-16.2	177	-69.3	167.4	0	0	0	113.4	L4 S6 S7 R11 L18 I43	L4-L9 HydrophobicContact CD2-CD1 4.18Å; L4-L9 HydrophobicContact CD2-CD2 3.9Å; L4-L9 HydrophobicContact CD2-CG 3.99Å; S6-L9 PolarHBondContact O-N 3.3Å; S7-L9 PolarHBondContact O-N 2.89Å; L9-R11 VanDerWaalsContact C-N 3.32Å; L9-L18 HydrophobicContact CD2-CB 3.87Å; L9-L18 HydrophobicContact CD2-CD1 4.04Å; L9-L18 HydrophobicContact CD2-CG 4.39Å; L9-I43 HydrophobicContact CD1-CD1 4.29Å; L9-I43 HydrophobicContact CD1-CG2 4.08Å
10	Q	75.3	Confident	77.9	Confident	133 Å²	133	70.6 Å²	70.6	62%	0.621	41%	0.411	S	S	*	.	S	Bend	trans	-83.1	-7.6	179.4	-69.6	174.3	16.9	0	0	113.6	S7	S7-Q10 PolarHBondContact O-N 3.38Å
11	R	76.3	Confident	78.2	Confident	153 Å²	153	68.5 Å²	68.5	58%	0.577	40%	0.399	S	S	*	.	S	Bend	trans	-79.6	157.1	176.7	-65.5	166.3	51.4	117.5	-2.9	110.2	L9 D13 G14	L9-R11 VanDerWaalsContact C-N 3.32Å; R11-D13 WeakPolarHBondContact CB-OD1 3.35Å; R11-D13 IonicContact CZ-OD1 3.64Å; R11-D13 IonicContact CZ-OD2 3.63Å; R11-D13 IonicContact NE-OD1 2.84Å; R11-D13 PolarHBondContact NE-OD1 3.48Å; R11-D13 IonicContact NE-OD2 3.56Å; R11-D13 IonicContact NH2-OD1 3.55Å; R11-D13 IonicContact NH2-OD2 2.84Å; R11-D13 PolarHBondContact NH2-OD2 3.22Å; R11-D13 PolarHBondContact O-N 2.95Å; R11-D13 VanDerWaalsContact O-N 3.1Å; R11-G14 WeakPolarHBondContact O-CA 3.46Å; R11-G14 PolarHBondContact O-N 3.01Å
12	D	74.7	Confident	78.8	Confident	180 Å²	180	62.9 Å²	62.9	96%	0.963	38%	0.376	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.9	-27.2	176.1	-63.4	-48.4	0	0	0	112.9
13	D	79.5	Confident	79.2	Confident	62 Å²	62	65.6 Å²	65.6	33%	0.332	39%	0.389	S	S	.	.	T	Hydrogen-bonded Turn	trans	-91.6	7.3	175.4	60.4	-6.5	0	0	0	114	R11 A15 A16 I17	R11-D13 WeakPolarHBondContact CB-OD1 3.35Å; R11-D13 IonicContact CZ-OD1 3.64Å; R11-D13 IonicContact CZ-OD2 3.63Å; R11-D13 IonicContact NE-OD1 2.84Å; R11-D13 PolarHBondContact NE-OD1 3.48Å; R11-D13 IonicContact NE-OD2 3.56Å; R11-D13 IonicContact NH2-OD1 3.55Å; R11-D13 IonicContact NH2-OD2 2.84Å; R11-D13 PolarHBondContact NH2-OD2 3.22Å; R11-D13 PolarHBondContact O-N 2.95Å; R11-D13 VanDerWaalsContact O-N 3.1Å; D13-A15 VanDerWaalsContact C-N 3.29Å; D13-A15 PolarHBondContact O-N 3.35Å; D13-A16 WeakPolarHBondContact O-CB 3.33Å; D13-A16 PolarHBondContact O-N 3.41Å; D13-I17 WeakPolarHBondContact O-CG1 3.32Å; D13-I17 PolarHBondContact O-N 3.44Å
14	G	78.4	Confident	79.3	Confident	2 Å²	2	67.6 Å²	67.6	2%	0.021	39%	0.394	C	S	.	.	H	α-helix	trans	-58.5	-37.1	-175.3	0	0	0	0	0	113.7	A8 R11 I17 L18	A8-G14 WeakPolarHBondContact O-CA 3.28Å; R11-G14 WeakPolarHBondContact O-CA 3.46Å; R11-G14 PolarHBondContact O-N 3.01Å; G14-I17 PolarHBondContact O-N 3.47Å; G14-L18 PolarHBondContact O-N 3.03Å
15	A	79.2	Confident	79.4	Confident	75 Å²	75	67.2 Å²	67.2	62%	0.62	39%	0.393	S	S	*	.	H	α-helix	trans	-64.6	-40.2	174.4	0	0	0	0	0	112.1	D13 L18 V19	D13-A15 VanDerWaalsContact C-N 3.29Å; D13-A15 PolarHBondContact O-N 3.35Å; A15-L18 PolarHBondContact O-N 3.25Å; A15-V19 WeakPolarHBondContact O-CG2 3.43Å; A15-V19 PolarHBondContact O-N 3.02Å
16	A	81.8	Confident	79.4	Confident	65 Å²	65	70.6 Å²	70.6	54%	0.537	40%	0.401	S	S	.	.	H	α-helix	trans	-67.4	-38.9	177.5	0	0	0	0	0	111.5	D13 V19 A20	D13-A16 WeakPolarHBondContact O-CB 3.33Å; D13-A16 PolarHBondContact O-N 3.41Å; A16-V19 PolarHBondContact O-N 3.48Å; A16-A20 WeakPolarHBondContact O-CB 3.4Å; A16-A20 PolarHBondContact O-N 3.4Å
17	I	82.5	Confident	79.7	Confident	45 Å²	45	77.3 Å²	77.3	23%	0.231	43%	0.429	C	S	.	.	H	α-helix	trans	-62.8	-45.5	174.5	-64.9	168.1	0	0	0	110.3	L4 D13 G14 V19 A20 V21	L4-I17 HydrophobicContact CD1-CG2 3.87Å; L4-I17 HydrophobicContact CD2-CG2 4.5Å; D13-I17 WeakPolarHBondContact O-CG1 3.32Å; D13-I17 PolarHBondContact O-N 3.44Å; G14-I17 PolarHBondContact O-N 3.47Å; I17-V19 VanDerWaalsContact C-N 3.32Å; I17-V19 PolarHBondContact O-N 2.91Å; I17-A20 PolarHBondContact O-N 2.9Å; I17-V21 HydrophobicContact CG2-CG2 4.34Å; I17-V21 WeakPolarHBondContact O-CB 3.27Å; I17-V21 VanDerWaalsContact O-CG2 3.27Å; I17-V21 WeakPolarHBondContact O-CG2 3.47Å; I17-V21 PolarHBondContact O-N 3.26Å
18	L	80.9	Confident	79.9	Confident	63 Å²	63	76.2 Å²	76.2	33%	0.33	42%	0.416	S	S	.	.	H	α-helix	trans	-59.5	-43.3	177.3	-173.7	71.3	0	0	0	111.6	L4 L9 G14 A15 S22	L4-L18 HydrophobicContact CD2-CD1 4.17Å; L9-L18 HydrophobicContact CD2-CB 3.87Å; L9-L18 HydrophobicContact CD2-CD1 4.04Å; L9-L18 HydrophobicContact CD2-CG 4.39Å; G14-L18 PolarHBondContact O-N 3.03Å; A15-L18 PolarHBondContact O-N 3.25Å; L18-S22 VanDerWaalsContact O-CB 3.26Å; L18-S22 WeakPolarHBondContact O-CB 3.26Å; L18-S22 PolarHBondContact O-N 3.27Å; L18-S22 PolarHBondContact O-OG 3.46Å
19	V	83.9	Confident	80.1	Confident	84 Å²	84	79.6 Å²	79.6	51%	0.509	42%	0.423	S	S	.	.	H	α-helix	trans	-64.7	-45	177.5	170.5	0	0	0	0	111.3	A15 A16 I17 V21 S22 N23	A15-V19 WeakPolarHBondContact O-CG2 3.43Å; A15-V19 PolarHBondContact O-N 3.02Å; A16-V19 PolarHBondContact O-N 3.48Å; I17-V19 VanDerWaalsContact C-N 3.32Å; I17-V19 PolarHBondContact O-N 2.91Å; V19-V21 PolarHBondContact O-N 2.88Å; V19-S22 PolarHBondContact O-N 3.33Å; V19-N23 WeakPolarHBondContact O-CB 2.96Å; V19-N23 PolarHBondContact O-N 3.44Å; V19-N23 PolarHBondContact O-ND2 2.78Å
20	A	85.6	Confident	80.2	Confident	59 Å²	59	82.8 Å²	82.8	49%	0.488	45%	0.445	S	S	.	.	H	α-helix	trans	-60.8	-45.6	178.3	0	0	0	0	0	111.8	A16 I17 N23 M24	A16-A20 WeakPolarHBondContact O-CB 3.4Å; A16-A20 PolarHBondContact O-N 3.4Å; I17-A20 PolarHBondContact O-N 2.9Å; A20-N23 PolarHBondContact O-N 2.94Å; A20-M24 PolarHBondContact O-N 3.38Å
21	V	83.4	Confident	80.3	Confident	26 Å²	26	82 Å²	82	16%	0.158	45%	0.449	C	S	.	.	H	α-helix	trans	-66.1	-41.4	177.7	175.2	0	0	0	0	110.9	V2 L4 I17 V19 N23 M24 V25 M41	V2-V21 HydrophobicContact CG1-CG1 3.84Å; L4-V21 HydrophobicContact CD1-CG2 4.44Å; I17-V21 HydrophobicContact CG2-CG2 4.34Å; I17-V21 WeakPolarHBondContact O-CB 3.27Å; I17-V21 VanDerWaalsContact O-CG2 3.27Å; I17-V21 WeakPolarHBondContact O-CG2 3.47Å; I17-V21 PolarHBondContact O-N 3.26Å; V19-V21 PolarHBondContact O-N 2.88Å; V21-N23 PolarHBondContact O-N 3.47Å; V21-M24 PolarHBondContact O-N 2.93Å; V21-V25 HydrophobicContact CG1-CG2 4.37Å; V21-V25 WeakPolarHBondContact O-CB 3.29Å; V21-V25 VanDerWaalsContact O-CG2 3.29Å; V21-V25 WeakPolarHBondContact O-CG2 3.48Å; V21-V25 PolarHBondContact O-N 3.31Å; V21-M41 HydrophobicContact CG1-CE 4.13Å
22	S	81.6	Confident	79.9	Confident	39 Å²	39	79.4 Å²	79.4	27%	0.273	45%	0.45	S	S	.	.	H	α-helix	trans	-59.1	-46.5	175.4	-62.2	0	0	0	0	111.8	L18 V19 M24 V25 Q26 M41	L18-S22 VanDerWaalsContact O-CB 3.26Å; L18-S22 WeakPolarHBondContact O-CB 3.26Å; L18-S22 PolarHBondContact O-N 3.27Å; L18-S22 PolarHBondContact O-OG 3.46Å; V19-S22 PolarHBondContact O-N 3.33Å; S22-M24 VanDerWaalsContact C-N 3.33Å; S22-M24 PolarHBondContact O-N 3.36Å; S22-V25 PolarHBondContact O-N 2.89Å; S22-Q26 WeakPolarHBondContact O-CG 3.49Å; S22-Q26 PolarHBondContact O-N 3.32Å; S22-M41 VanDerWaalsContact CA-CE 3.5Å; S22-M41 WeakPolarHBondContact OG-CE 3.47Å
23	N	84.4	Confident	79.4	Confident	94 Å²	94	74 Å²	74	50%	0.503	44%	0.438	S	S	.	.	H	α-helix	trans	-62.4	-40.5	177.2	-75.7	-23.3	0	0	0	112.1	V19 A20 V21 Q26 K27	V19-N23 WeakPolarHBondContact O-CB 2.96Å; V19-N23 PolarHBondContact O-N 3.44Å; V19-N23 PolarHBondContact O-ND2 2.78Å; A20-N23 PolarHBondContact O-N 2.94Å; V21-N23 PolarHBondContact O-N 3.47Å; N23-Q26 PolarHBondContact O-N 3.29Å; N23-K27 WeakPolarHBondContact O-CG 3.41Å; N23-K27 PolarHBondContact O-N 3.41Å
24	M	82.1	Confident	78.7	Confident	122 Å²	122	73 Å²	73	60%	0.601	43%	0.433	S	S	*	.	H	α-helix	trans	-65.5	-42.7	177	-160.2	-177.7	-106.3	0	0	111.3	A20 V21 S22 K27 I28	A20-M24 PolarHBondContact O-N 3.38Å; V21-M24 PolarHBondContact O-N 2.93Å; S22-M24 VanDerWaalsContact C-N 3.33Å; S22-M24 PolarHBondContact O-N 3.36Å; M24-K27 PolarHBondContact O-N 3.37Å; M24-I28 HydrophobicContact CG-CD1 4.28Å; M24-I28 VanDerWaalsContact O-CG1 3.28Å; M24-I28 WeakPolarHBondContact O-CG1 3.34Å; M24-I28 PolarHBondContact O-N 3.03Å
25	V	81.4	Confident	77.9	Confident	8 Å²	8	76.2 Å²	76.2	5%	0.048	46%	0.46	C	S	.	.	H	α-helix	trans	-64	-42.3	176.6	168	0	0	0	0	112	V2 V21 S22 I28 R29 V40 M41	V2-V25 HydrophobicContact CB-CG2 4.03Å; V2-V25 HydrophobicContact CG1-CG2 4.43Å; V2-V25 HydrophobicContact CG2-CG2 3.94Å; V21-V25 HydrophobicContact CG1-CG2 4.37Å; V21-V25 WeakPolarHBondContact O-CB 3.29Å; V21-V25 VanDerWaalsContact O-CG2 3.29Å; V21-V25 WeakPolarHBondContact O-CG2 3.48Å; V21-V25 PolarHBondContact O-N 3.31Å; S22-V25 PolarHBondContact O-N 2.89Å; V25-I28 PolarHBondContact O-N 2.84Å; V25-R29 PolarHBondContact O-N 2.71Å; V25-V40 HydrophobicContact CB-CG1 4.35Å; V25-V40 HydrophobicContact CG1-CB 3.72Å; V25-V40 HydrophobicContact CG1-CG1 3.72Å; V25-V40 HydrophobicContact CG2-CG1 4.13Å; V25-M41 HydrophobicContact CB-CE 4.3Å; V25-M41 HydrophobicContact CG1-CB 4.26Å; V25-M41 HydrophobicContact CG2-CB 4.19Å; V25-M41 HydrophobicContact CG2-CE 4.09Å
26	Q	80.9	Confident	77.1	Confident	98 Å²	98	77 Å²	77	46%	0.458	47%	0.467	S	S	.	.	H	α-helix	trans	-62.7	-44	175.7	-70.4	-63.2	-25.8	0	0	111.4	S22 N23 I28 R29 V30	S22-Q26 WeakPolarHBondContact O-CG 3.49Å; S22-Q26 PolarHBondContact O-N 3.32Å; N23-Q26 PolarHBondContact O-N 3.29Å; Q26-I28 PolarHBondContact O-N 2.84Å; Q26-R29 PolarHBondContact O-N 2.87Å; Q26-V30 WeakPolarHBondContact O-CG2 3.4Å; Q26-V30 PolarHBondContact O-N 3.24Å
27	K	81.9	Confident	76.2	Confident	151 Å²	151	82.8 Å²	82.8	66%	0.657	48%	0.483	S	S	*	.	H	α-helix	trans	-58.6	-47.6	174.1	-74.5	177.9	-179.1	-176.8	0	111.4	N23 M24 R29 V30 T31	N23-K27 WeakPolarHBondContact O-CG 3.41Å; N23-K27 PolarHBondContact O-N 3.41Å; M24-K27 PolarHBondContact O-N 3.37Å; K27-R29 PolarHBondContact O-N 3Å; K27-V30 PolarHBondContact O-N 2.89Å; K27-T31 WeakPolarHBondContact O-CB 3.49Å; K27-T31 PolarHBondContact O-N 2.99Å; K27-T31 PolarHBondContact O-OG1 2.88Å
28	I	78.2	Confident	75.5	Confident	61 Å²	61	88.2 Å²	88.2	31%	0.313	50%	0.5	S	S	.	.	H	α-helix	trans	-61.1	-43.7	177.8	-67.3	164.7	0	0	0	110.9	V2 M24 V25 Q26 V30 T31 T32 V40	V2-I28 HydrophobicContact CG2-CD1 4.41Å; M24-I28 HydrophobicContact CG-CD1 4.28Å; M24-I28 VanDerWaalsContact O-CG1 3.28Å; M24-I28 WeakPolarHBondContact O-CG1 3.34Å; M24-I28 PolarHBondContact O-N 3.03Å; V25-I28 PolarHBondContact O-N 2.84Å; Q26-I28 PolarHBondContact O-N 2.84Å; I28-V30 VanDerWaalsContact C-N 3.33Å; I28-V30 PolarHBondContact O-N 3.01Å; I28-T31 PolarHBondContact O-N 2.98Å; I28-T32 PolarHBondContact O-N 2.88Å; I28-T32 PolarHBondContact O-OG1 3.27Å; I28-V40 HydrophobicContact CG2-CG1 4.4Å
29	R	75.6	Confident	74.9	Confident	98 Å²	98	93 Å²	93	37%	0.37	52%	0.518	S	S	.	.	H	α-helix	trans	-56.8	-46.1	175.7	-90.8	-178.5	71.6	-156.3	6.8	112.4	V25 Q26 K27 G33 V40	V25-R29 PolarHBondContact O-N 2.71Å; Q26-R29 PolarHBondContact O-N 2.87Å; K27-R29 PolarHBondContact O-N 3Å; R29-G33 PolarHBondContact O-N 3.1Å; R29-V40 HydrophobicContact CG-CG2 3.93Å
30	V	76.3	Confident	74.4	Confident	120 Å²	120	89.3 Å²	89.3	73%	0.727	50%	0.496	S	S	*	.	H	α-helix	trans	-68.8	-38.8	-179.3	173.9	0	0	0	0	111.6	Q26 K27 I28	Q26-V30 WeakPolarHBondContact O-CG2 3.4Å; Q26-V30 PolarHBondContact O-N 3.24Å; K27-V30 PolarHBondContact O-N 2.89Å; I28-V30 VanDerWaalsContact C-N 3.33Å; I28-V30 PolarHBondContact O-N 3.01Å
31	T	76.9	Confident	73.8	Confident	117 Å²	117	89.4 Å²	89.4	72%	0.718	49%	0.487	S	S	*	.	H	α-helix	trans	-79.9	-38.4	-172.8	-36.9	0	0	0	0	112.5	K27 I28	K27-T31 WeakPolarHBondContact O-CB 3.49Å; K27-T31 PolarHBondContact O-N 2.99Å; K27-T31 PolarHBondContact O-OG1 2.88Å; I28-T31 PolarHBondContact O-N 2.98Å
32	T	68.1	Low	73.5	Confident	98 Å²	98	90.9 Å²	90.9	60%	0.601	49%	0.494	S	S	*	.	H	α-helix	trans	-96.6	1.9	-172	-18.7	0	0	0	0	113.3	I28 V34	I28-T32 PolarHBondContact O-N 2.88Å; I28-T32 PolarHBondContact O-OG1 3.27Å; T32-V34 PolarHBondContact O-N 2.95Å
33	G	63.8	Low	73.4	Confident	68 Å²	68	92.1 Å²	92.1	70%	0.701	50%	0.497	S	S	*	.	T	Hydrogen-bonded Turn	trans	59.7	31.3	179.5	0	0	0	0	0	112.8	R29 A35	R29-G33 PolarHBondContact O-N 3.1Å; G33-A35 PolarHBondContact O-N 3.39Å
34	V	64.8	Low	73	Confident	39 Å²	39	93.2 Å²	93.2	24%	0.236	50%	0.502	C	S	.	.			trans	-63.7	127	-174.7	-176.9	0	0	0	0	109.1	T32 A36 W38 V40	T32-V34 PolarHBondContact O-N 2.95Å; V34-A36 PolarHBondContact O-N 2.83Å; V34-W38 HydrophobicContact CG1-CB 3.46Å; V34-W38 VanDerWaalsContact CG1-CB 3.46Å; V34-W38 HydrophobicContact CG1-CG 3.77Å; V34-V40 HydrophobicContact CG1-CG2 4.11Å
35	A	62.5	Low	72.6	Confident	70 Å²	70	90.6 Å²	90.6	58%	0.579	49%	0.488	S	S	*	.			trans	-48.8	137.6	177	0	0	0	0	0	110.9	G33 E37 W38	G33-A35 PolarHBondContact O-N 3.39Å; A35-E37 PolarHBondContact O-N 3.44Å; A35-W38 PolarHBondContact O-N 3.26Å
36	A	62.5	Low	72.1	Confident	92 Å²	92	101.3 Å²	101.3	76%	0.76	53%	0.528	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.8	-23.3	-174.4	0	0	0	0	0	113.8	V34	V34-A36 PolarHBondContact O-N 2.83Å
37	E	63.5	Low	71.6	Confident	187 Å²	187	100.3 Å²	100.3	87%	0.874	53%	0.525	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.8	-19.5	175.3	-78.7	-161.3	129.3	0	0	114.9	A35 K39	A35-E37 PolarHBondContact O-N 3.44Å; E37-K39 PolarHBondContact O-N 3.5Å
38	W	67.6	Low	70.8	Confident	159 Å²	159	97.4 Å²	97.4	60%	0.602	53%	0.529	S	S	*	.			trans	-81.2	114.1	-174	-172.6	-96.3	0	0	0	111.4	V34 A35 V40	V34-W38 HydrophobicContact CG1-CB 3.46Å; V34-W38 VanDerWaalsContact CG1-CB 3.46Å; V34-W38 HydrophobicContact CG1-CG 3.77Å; A35-W38 PolarHBondContact O-N 3.26Å; W38-V40 PolarHBondContact O-N 3Å
39	K	68.3	Low	70.4	Confident	164 Å²	164	98.6 Å²	98.6	71%	0.713	54%	0.542	S	S	*	.			trans	-73.1	96.2	176.2	-62.9	-167.6	-178.4	-176.9	0	110.4	E37	E37-K39 PolarHBondContact O-N 3.5Å
40	V	72.4	Confident	69.8	Low	6 Å²	6	96.3 Å²	96.3	4%	0.036	54%	0.536	C	S	.	.			trans	-73.9	-30.4	178.5	-178.7	0	0	0	0	111.8	V2 V25 I28 R29 V34 W38	V2-V40 HydrophobicContact CG2-CG1 4.33Å; V2-V40 PolarHBondContact N-O 3.13Å; V25-V40 HydrophobicContact CB-CG1 4.35Å; V25-V40 HydrophobicContact CG1-CB 3.72Å; V25-V40 HydrophobicContact CG1-CG1 3.72Å; V25-V40 HydrophobicContact CG2-CG1 4.13Å; I28-V40 HydrophobicContact CG2-CG1 4.4Å; R29-V40 HydrophobicContact CG-CG2 3.93Å; V34-V40 HydrophobicContact CG1-CG2 4.11Å; W38-V40 PolarHBondContact O-N 3Å
41	M	74	Confident	69.6	Low	60 Å²	60	93.2 Å²	93.2	30%	0.296	52%	0.517	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.2	125.5	179.6	-180	-180	-69.1	0	0	111.2	V21 S22 V25	V21-M41 HydrophobicContact CG1-CE 4.13Å; S22-M41 VanDerWaalsContact CA-CE 3.5Å; S22-M41 WeakPolarHBondContact OG-CE 3.47Å; V25-M41 HydrophobicContact CB-CE 4.3Å; V25-M41 HydrophobicContact CG1-CB 4.26Å; V25-M41 HydrophobicContact CG2-CB 4.19Å; V25-M41 HydrophobicContact CG2-CE 4.09Å
42	N	76.6	Confident	69.2	Low	58 Å²	58	90 Å²	90	31%	0.31	50%	0.503	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127	140.6	171.8	-66.5	-46.3	0	0	0	110	M1 V2 V3 L4	M1-N42 WeakPolarHBondContact CG-ND2 3.32Å; V2-N42 PolarHBondContact O-N 2.83Å; V3-N42 CarbonylContact C-O 3.54Å; V3-N42 WeakPolarHBondContact CA-O 3.49Å; V3-N42 HydrophobicContact CG2-CB 4.35Å; L4-N42 PolarHBondContact N-O 2.84Å
43	I	78.5	Confident	69.3	Low	65 Å²	65	86.9 Å²	86.9	33%	0.333	49%	0.487	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.7	126.2	173.3	-60.3	174.5	0	0	0	108	L4 L9 H45	L4-I43 CarbonylContact O-C 3.57Å; L4-I43 WeakPolarHBondContact O-CA 3.44Å; L9-I43 HydrophobicContact CD1-CD1 4.29Å; L9-I43 HydrophobicContact CD1-CG2 4.08Å; I43-H45 PolarHBondContact O-CD2 2.94Å
44	L	77.6	Confident	69.6	Low	116 Å²	116	87.2 Å²	87.2	61%	0.607	47%	0.472	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-92.2	104.8	176.9	-172.8	67.5	0	0	0	109.6	V3 L4 S6	V3-L44 HydrophobicContact CG1-CB 3.96Å; L4-L44 PolarHBondContact O-N 3.48Å; S6-L44 WeakPolarHBondContact CB-O 3.49Å; S6-L44 PolarHBondContact N-O 2.59Å; S6-L44 PolarHBondContact OG-O 3.21Å
45	H	73.4	Confident	69.9	Low	67 Å²	67	92 Å²	92	31%	0.31	50%	0.496	S	S	.	.			trans	-82.1	130.6	175.8	-67.5	-96.8	0	0	0	110.4	S6 I43 V51	S6-H45 WeakPolarHBondContact OG-CA 3.34Å; I43-H45 PolarHBondContact O-CD2 2.94Å; H45-V51 HydrophobicContact CB-CG2 3.55Å
46	R	71.4	Confident	70.4	Confident	233 Å²	233	94.7 Å²	94.7	88%	0.879	50%	0.5	S	S	*	.	S	Bend	trans	-85.7	-23.8	176	-172.1	177.5	177.3	-164.6	-0.4	112.7	S6	S6-R46 PolarHBondContact OG-N 2.85Å
47	I	69.6	Low	70.9	Confident	78 Å²	78	93.4 Å²	93.4	40%	0.4	50%	0.496	S	S	.	.			trans	-114.8	117	-172.6	-56.8	176.7	0	0	0	108.7	S49 Q50	I47-S49 VanDerWaalsContact C-N 3.34Å; I47-S49 WeakPolarHBondContact CG2-OG 3.4Å; I47-S49 PolarHBondContact O-N 3.44Å; I47-Q50 HydrophobicContact CB-CB 3.86Å; I47-Q50 HydrophobicContact CG2-CB 4.03Å; I47-Q50 WeakPolarHBondContact O-CB 3.46Å; I47-Q50 PolarHBondContact O-N 3.07Å
48	A	65.9	Low	71.2	Confident	89 Å²	89	92.2 Å²	92.2	74%	0.736	48%	0.484	S	S	*	.	H	α-helix	trans	-63.7	-37.7	-179.4	0	0	0	0	0	112.7	Q50 V51 A52	A48-Q50 VanDerWaalsContact C-N 3.26Å; A48-Q50 PolarHBondContact O-N 3.36Å; A48-V51 PolarHBondContact O-N 2.9Å; A48-A52 PolarHBondContact O-N 3.07Å
49	S	69	Low	71.2	Confident	86 Å²	86	94.3 Å²	94.3	60%	0.601	50%	0.498	S	S	*	.	H	α-helix	trans	-68	-23.6	176.6	52.2	0	0	0	0	113.5	I47 A52 A53	I47-S49 VanDerWaalsContact C-N 3.34Å; I47-S49 WeakPolarHBondContact CG2-OG 3.4Å; I47-S49 PolarHBondContact O-N 3.44Å; S49-A52 PolarHBondContact O-N 3.43Å; S49-A53 WeakPolarHBondContact O-CB 3.13Å; S49-A53 PolarHBondContact O-N 3.35Å
50	Q	63.8	Low	71.1	Confident	50 Å²	50	91 Å²	91	23%	0.234	49%	0.493	C	S	.	.	H	α-helix	trans	-72.3	-32.5	178	-169.1	173.4	9.5	0	0	111.8	I47 A48 L54	I47-Q50 HydrophobicContact CB-CB 3.86Å; I47-Q50 HydrophobicContact CG2-CB 4.03Å; I47-Q50 WeakPolarHBondContact O-CB 3.46Å; I47-Q50 PolarHBondContact O-N 3.07Å; A48-Q50 VanDerWaalsContact C-N 3.26Å; A48-Q50 PolarHBondContact O-N 3.36Å; Q50-L54 HydrophobicContact CG-CD1 4.42Å; Q50-L54 WeakPolarHBondContact O-CB 3.3Å; Q50-L54 WeakPolarHBondContact O-CD1 3.42Å; Q50-L54 VanDerWaalsContact O-CG 3.3Å; Q50-L54 WeakPolarHBondContact O-CG 3.49Å; Q50-L54 PolarHBondContact O-N 3.2Å
51	V	71.7	Confident	70.4	Confident	56 Å²	56	98 Å²	98	34%	0.339	57%	0.567	S	S	.	*	H	α-helix	trans	-66.5	-46.6	173.4	-177.6	0	0	0	0	109.9	H45 A48 A53 L54 D55	H45-V51 HydrophobicContact CB-CG2 3.55Å; A48-V51 PolarHBondContact O-N 2.9Å; V51-A53 VanDerWaalsContact C-N 3.35Å; V51-A53 PolarHBondContact O-N 3.5Å; V51-L54 PolarHBondContact O-N 3.23Å; V51-D55 PolarHBondContact O-N 2.9Å
52	A	68.7	Low	70.2	Confident	49 Å²	49	100 Å²	100	41%	0.405	58%	0.58	S	S	.	*	H	α-helix	trans	-63.7	-38	177	0	0	0	0	0	112.9	A48 S49 D55 L56	A48-A52 PolarHBondContact O-N 3.07Å; S49-A52 PolarHBondContact O-N 3.43Å; A52-D55 PolarHBondContact O-N 3.43Å; A52-L56 WeakPolarHBondContact O-CG 3.34Å; A52-L56 PolarHBondContact O-N 3.45Å
53	A	70.6	Confident	69.9	Low	32 Å²	32	102.2 Å²	102.2	26%	0.264	59%	0.594	S	S	.	*	H	α-helix	trans	-64.5	-40.5	175.4	0	0	0	0	0	112	S49 V51 L56 G57 Y58	S49-A53 WeakPolarHBondContact O-CB 3.13Å; S49-A53 PolarHBondContact O-N 3.35Å; V51-A53 VanDerWaalsContact C-N 3.35Å; V51-A53 PolarHBondContact O-N 3.5Å; A53-L56 PolarHBondContact O-N 3.45Å; A53-G57 PolarHBondContact O-N 3.37Å; A53-Y58 WeakPolarHBondContact O-CB 3.37Å; A53-Y58 PolarHBondContact O-N 2.97Å
54	L	69.2	Low	69.4	Low	75 Å²	75	104.2 Å²	104.2	39%	0.393	61%	0.609	S	S	.	*	H	α-helix	trans	-67.1	-38	175.4	-74.3	164.6	0	0	0	112	Q50 V51 L56 G57 P60	Q50-L54 HydrophobicContact CG-CD1 4.42Å; Q50-L54 WeakPolarHBondContact O-CB 3.3Å; Q50-L54 WeakPolarHBondContact O-CD1 3.42Å; Q50-L54 VanDerWaalsContact O-CG 3.3Å; Q50-L54 WeakPolarHBondContact O-CG 3.49Å; Q50-L54 PolarHBondContact O-N 3.2Å; V51-L54 PolarHBondContact O-N 3.23Å; L54-L56 VanDerWaalsContact C-N 3.29Å; L54-L56 PolarHBondContact O-N 3.27Å; L54-G57 PolarHBondContact O-N 3.35Å; L54-P60 HydrophobicContact CD2-CB 4.44Å; L54-P60 HydrophobicContact CD2-CG 4.14Å
55	D	70.4	Confident	68.9	Low	139 Å²	139	103.5 Å²	103.5	74%	0.743	61%	0.609	S	S	*	*	H	α-helix	trans	-63.8	-34.4	174.7	-78.8	-18.5	0	0	0	112.3	V51 A52 G57	V51-D55 PolarHBondContact O-N 2.9Å; A52-D55 PolarHBondContact O-N 3.43Å; D55-G57 PolarHBondContact O-N 3.06Å
56	L	73.3	Confident	68.6	Low	128 Å²	128	105.8 Å²	105.8	67%	0.67	63%	0.628	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.6	-0.8	174.8	-68.2	170	0	0	0	113.5	A52 A53 L54 Y58	A52-L56 WeakPolarHBondContact O-CG 3.34Å; A52-L56 PolarHBondContact O-N 3.45Å; A53-L56 PolarHBondContact O-N 3.45Å; L54-L56 VanDerWaalsContact C-N 3.29Å; L54-L56 PolarHBondContact O-N 3.27Å; L56-Y58 VanDerWaalsContact C-N 3.33Å; L56-Y58 HydrophobicContact CB-CD1 4.2Å; L56-Y58 HydrophobicContact CB-CE1 4.44Å
57	G	74.1	Confident	68.5	Low	64 Å²	64	97.3 Å²	97.3	66%	0.66	61%	0.611	S	S	*	*	T	Hydrogen-bonded Turn	trans	74.7	19.2	-179.9	0	0	0	0	0	114.3	A53 L54 D55	A53-G57 PolarHBondContact O-N 3.37Å; L54-G57 PolarHBondContact O-N 3.35Å; D55-G57 PolarHBondContact O-N 3.06Å
58	Y	69.1	Low	68.4	Low	163 Å²	163	98.7 Å²	98.7	64%	0.639	63%	0.626	S	S	*	*	P	Polyproline II helix	trans	-71	143.1	175.8	-77.8	20	0	0	0	109.9	A53 L56 P60	A53-Y58 WeakPolarHBondContact O-CB 3.37Å; A53-Y58 PolarHBondContact O-N 2.97Å; L56-Y58 VanDerWaalsContact C-N 3.33Å; L56-Y58 HydrophobicContact CB-CD1 4.2Å; L56-Y58 HydrophobicContact CB-CE1 4.44Å; Y58-P60 WeakPolarHBondContact O-CD 3.34Å
59	K	67.6	Low	68.6	Low	203 Å²	203	99.5 Å²	99.5	88%	0.883	62%	0.618	S	S	*	*	P	Polyproline II helix	trans	-70.3	124	177.7	-71.1	-177.6	-179.3	176.1	0	109.1	G61	K59-G61 PolarHBondContact O-N 3.41Å
60	P	66.6	Low	68.5	Low	94 Å²	94	100.6 Å²	100.6	61%	0.61	62%	0.619	S	S	*	*	P	Polyproline II helix	trans	-66.7	129.1	170.8	26.3	-31	0	0	0	109.3	L54 Y58	L54-P60 HydrophobicContact CD2-CB 4.44Å; L54-P60 HydrophobicContact CD2-CG 4.14Å; Y58-P60 WeakPolarHBondContact O-CD 3.34Å
61	G	57.3	Low	69	Low	154 Å²	154	105.2 Å²	105.2	100%	1.588	65%	0.654	S	S	*	*			trans	-171	0	179.8	0	0	0	0	0	109.8	K59	K59-G61 PolarHBondContact O-N 3.41Å

Retrieved 61 of 61 residues in 34.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).