A0A087WT04_HUMAN Loading...

PMF1-BGLAP readthrough

AlphaFold DB , UniProt , Accession A0A087WT04, Species HUMAN (Homo sapiens, Human), Gene PMF1-BGLAP, Length 142 aa.

						>A0A087WT04_HUMAN|A0A087WT04|PMF1-BGLAP
MAEASSANLGSGCEEKRHEGSSSESVPPGTTISRVKLLDTMVDTFLQKLVAAGRRPSGIPEKDLHSVMAPYFLQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEELQLQVQAQQQAWQVRSPAVQSPAKVQPLCPSRRAAR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46.1	Very low	44.8	Very low	249 Å²	249	135.8 Å²	135.8	100%	1.227	87%	0.867	S	S	*	*				0	103	0	-88.1	-167.4	-89.3	0	0	108.9
2	A	47.1	Very low	44.3	Very low	104 Å²	104	130.8 Å²	130.8	86%	0.86	86%	0.859	S	S	*	*			trans	179.7	119.8	146.9	0	0	0	0	0	106.2
3	E	38.2	Very low	43.6	Very low	201 Å²	201	131.1 Å²	131.1	94%	0.939	86%	0.863	S	S	*	*			trans	-86.7	171.6	-167.3	-69.1	-160.6	142.6	0	0	114.1
4	A	46.2	Very low	43.3	Very low	94 Å²	94	135.3 Å²	135.3	78%	0.777	87%	0.865	S	S	*	*			trans	-59.6	164.9	-178.7	0	0	0	0	0	115.7
5	S	48	Very low	43.3	Very low	124 Å²	124	137.9 Å²	137.9	87%	0.867	86%	0.862	S	S	*	*			trans	-143.6	100.2	151	-162.1	0	0	0	0	110.7
6	S	52.2	Low	43.2	Very low	111 Å²	111	142.1 Å²	142.1	78%	0.776	86%	0.864	S	S	*	*			trans	-102.3	113.4	164	54.3	0	0	0	0	107.7
7	A	43.3	Very low	43	Very low	98 Å²	98	146.5 Å²	146.5	81%	0.81	86%	0.861	S	S	*	*			trans	-95.1	101.9	171.3	0	0	0	0	0	109.1
8	N	44.9	Very low	42.5	Very low	153 Å²	153	148.2 Å²	148.2	82%	0.818	86%	0.859	S	S	*	*			trans	-100.2	118.1	161.3	-168.9	18.4	0	0	0	106.5
9	L	42.6	Very low	42.7	Very low	166 Å²	166	149.2 Å²	149.2	87%	0.869	86%	0.855	S	S	*	*			trans	-123.4	105.3	170.2	-77.4	172.8	0	0	0	107.8
10	G	43.4	Very low	42.4	Very low	72 Å²	72	145.2 Å²	145.2	74%	0.742	85%	0.848	S	S	*	*			trans	-73.8	151.2	165.6	0	0	0	0	0	111.1
11	S	40.9	Very low	42.4	Very low	122 Å²	122	143.8 Å²	143.8	85%	0.853	85%	0.846	S	S	*	*			trans	-155.8	111.4	154.6	-172.2	0	0	0	0	107.8
12	G	39.3	Very low	42.3	Very low	75 Å²	75	137.2 Å²	137.2	77%	0.773	82%	0.824	S	S	*	*			trans	-87.3	141.2	165.5	0	0	0	0	0	109.6
13	C	34.2	Very low	42	Very low	135 Å²	135	137.2 Å²	137.2	91%	0.912	82%	0.818	S	S	*	*			trans	-154.8	143.7	157.7	-136.4	0	0	0	0	110.2
14	E	39.9	Very low	42.1	Very low	190 Å²	190	136.3 Å²	136.3	89%	0.888	81%	0.814	S	S	*	*			trans	-79.1	157.1	-156.9	-60.4	-173.7	124	0	0	115.9
15	E	44	Very low	42.3	Very low	175 Å²	175	137.5 Å²	137.5	82%	0.818	82%	0.816	S	S	*	*			trans	4.5	115.5	149.8	-162.6	-179.9	145.3	0	0	118.6
16	K	40.6	Very low	42.8	Very low	204 Å²	204	136.2 Å²	136.2	89%	0.887	80%	0.803	S	S	*	*			trans	-139.3	110.9	138.6	-94.2	-167.1	178.1	173.8	0	110.9	H18	K16-H18 PolarHBondContact O-N 3.13Å
17	R	39.8	Very low	42.8	Very low	217 Å²	217	135.5 Å²	135.5	82%	0.819	80%	0.796	S	S	*	*			trans	-56.4	118.2	164.3	-166.8	-178.5	-159.4	-153.7	4.1	109.5
18	H	35	Very low	43.3	Very low	178 Å²	178	137.6 Å²	137.6	82%	0.824	80%	0.801	S	S	*	*			trans	-133.6	93	162	-139.2	-73.1	0	0	0	108.5	K16	K16-H18 PolarHBondContact O-N 3.13Å
19	E	46.5	Very low	43.6	Very low	167 Å²	167	133.4 Å²	133.4	78%	0.78	79%	0.794	S	S	*	*			trans	-59.9	129.2	156	-80.3	-89.2	143.6	0	0	107.6
20	G	35.8	Very low	44.4	Very low	69 Å²	69	131.3 Å²	131.3	71%	0.711	79%	0.788	S	S	*	*			trans	164.1	86.1	-175.8	0	0	0	0	0	111.4
21	S	43.3	Very low	45.2	Very low	116 Å²	116	134.8 Å²	134.8	81%	0.811	80%	0.795	S	S	*	*			trans	-55.3	163.7	-175.2	-53.6	0	0	0	0	117.4
22	S	44	Very low	46.6	Very low	111 Å²	111	133.7 Å²	133.7	78%	0.776	78%	0.779	S	S	*	*			trans	93.2	121.6	143.5	-151.2	0	0	0	0	115.6
23	S	40.9	Very low	48.9	Very low	104 Å²	104	133.1 Å²	133.1	73%	0.727	76%	0.763	S	S	*	*			cis	-151.9	120.5	16.9	-76	0	0	0	0	109.4
24	E	39.9	Very low	51.6	Low	181 Å²	181	137.3 Å²	137.3	85%	0.846	76%	0.76	S	S	*	*			trans	-90.6	102.6	167.1	-179.5	155.1	132.1	0	0	108.3	V26	E24-V26 VanDerWaalsContact C-N 3.31Å; E24-V26 HydrophobicContact CG-CG2 3.79Å; E24-V26 PolarHBondContact O-N 3.35Å; E24-V26 VanDerWaalsContact O-N 3.16Å
25	S	49.9	Very low	54.1	Low	119 Å²	119	132.7 Å²	132.7	83%	0.832	74%	0.744	S	S	*	*			trans	-85.9	75	174.4	52.8	0	0	0	0	109.8
26	V	57.8	Low	56.4	Low	98 Å²	98	131 Å²	131	59%	0.594	73%	0.734	S	S	*	*			trans	-77.5	128.5	161.7	169.1	0	0	0	0	107.6	E24	E24-V26 VanDerWaalsContact C-N 3.31Å; E24-V26 HydrophobicContact CG-CG2 3.79Å; E24-V26 PolarHBondContact O-N 3.35Å; E24-V26 VanDerWaalsContact O-N 3.16Å
27	P	52.5	Low	58.9	Low	96 Å²	96	125.2 Å²	125.2	62%	0.623	71%	0.712	S	S	*	*			trans	-60.9	133.4	178.9	24.9	-33.2	0	0	0	109.9	G29	P27-G29 VanDerWaalsContact C-N 3.32Å; P27-G29 PolarHBondContact O-N 2.94Å
28	P	53.3	Low	61.5	Low	142 Å²	142	119.6 Å²	119.6	92%	0.922	70%	0.698	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.9	85.8	179.6	30.8	-31.8	0	0	0	108.7
29	G	52.7	Low	64.3	Low	64 Å²	64	115.1 Å²	115.1	66%	0.66	68%	0.68	S	S	*	*	T	Hydrogen-bonded Turn	trans	-153.7	-10.5	-174.9	0	0	0	0	0	118.3	P27	P27-G29 VanDerWaalsContact C-N 3.32Å; P27-G29 PolarHBondContact O-N 2.94Å
30	T	58.2	Low	66.6	Low	122 Å²	122	111 Å²	111	75%	0.748	67%	0.666	S	S	*	*			trans	-138.2	24.4	-165.9	-25.6	0	0	0	0	115.7	I32	T30-I32 VanDerWaalsContact C-N 3.34Å; T30-I32 PolarHBondContact O-N 3.07Å
31	T	61.7	Low	69.3	Low	145 Å²	145	112.3 Å²	112.3	89%	0.89	66%	0.655	S	S	*	*			trans	-93.4	72.8	161.3	46.8	0	0	0	0	108.9	S33	T31-S33 PolarHBondContact O-N 3.32Å; T31-S33 VanDerWaalsContact O-N 3.08Å
32	I	70.5	Confident	71.7	Confident	100 Å²	100	109.9 Å²	109.9	51%	0.513	64%	0.635	S	S	.	*			trans	-59.7	117.5	168.2	-61.1	174.3	0	0	0	106.5	T30 R34 K36 L37	T30-I32 VanDerWaalsContact C-N 3.34Å; T30-I32 PolarHBondContact O-N 3.07Å; I32-R34 PolarHBondContact O-N 3Å; I32-K36 HydrophobicContact CG2-CB 3.8Å; I32-L37 HydrophobicContact CG2-CB 3.99Å
33	S	86.3	Confident	74.1	Confident	63 Å²	63	109.9 Å²	109.9	44%	0.441	63%	0.627	S	S	.	*			trans	-49.3	134.8	173.4	170	0	0	0	0	109.5	T31 V35 K36 L37	T31-S33 PolarHBondContact O-N 3.32Å; T31-S33 VanDerWaalsContact O-N 3.08Å; S33-V35 PolarHBondContact O-N 3.18Å; S33-K36 WeakPolarHBondContact O-CA 3.35Å; S33-K36 WeakPolarHBondContact O-CB 3.41Å; S33-K36 PolarHBondContact O-N 3.25Å; S33-L37 PolarHBondContact O-N 3.24Å
34	R	90.7	Very high	76.4	Confident	223 Å²	223	108 Å²	108	84%	0.842	61%	0.611	S	S	*	*	H	α-helix	trans	-50.2	-34	-179.9	-68.8	174.7	65.1	-173.3	0.9	112.5	I32 L38	I32-R34 PolarHBondContact O-N 3Å; R34-L38 WeakPolarHBondContact O-CB 3.34Å; R34-L38 PolarHBondContact O-N 3.36Å
35	V	92.2	Very high	78.6	Confident	92 Å²	92	105.6 Å²	105.6	56%	0.558	60%	0.598	S	S	*	*	H	α-helix	trans	-66.5	-49.6	175.7	-179.3	0	0	0	0	110.9	S33 L37 L38 D39	S33-V35 PolarHBondContact O-N 3.18Å; V35-L37 VanDerWaalsContact C-N 3.25Å; V35-L37 PolarHBondContact O-N 3.42Å; V35-L38 WeakPolarHBondContact O-CB 3.34Å; V35-L38 PolarHBondContact O-N 2.87Å; V35-D39 VanDerWaalsContact O-CG 3.31Å; V35-D39 PolarHBondContact O-N 3.44Å
36	K	92	Very high	80.2	Confident	140 Å²	140	104 Å²	104	61%	0.609	58%	0.58	S	S	*	*	H	α-helix	trans	-61.5	-34.2	176.4	-69.3	-174.4	175.2	-177.9	0	112.6	I32 S33 T40	I32-K36 HydrophobicContact CG2-CB 3.8Å; S33-K36 WeakPolarHBondContact O-CA 3.35Å; S33-K36 WeakPolarHBondContact O-CB 3.41Å; S33-K36 PolarHBondContact O-N 3.25Å; K36-T40 WeakPolarHBondContact O-CB 3.33Å; K36-T40 PolarHBondContact O-N 3.35Å; K36-T40 VanDerWaalsContact O-N 3.08Å; K36-T40 PolarHBondContact O-OG1 2.94Å
37	L	93.9	Very high	81.6	Confident	83 Å²	83	106.6 Å²	106.6	44%	0.435	59%	0.585	S	S	.	*	H	α-helix	trans	-66.5	-43.9	173.9	-179.1	63.3	0	0	0	111	I32 S33 V35 T40 M41	I32-L37 HydrophobicContact CG2-CB 3.99Å; S33-L37 PolarHBondContact O-N 3.24Å; V35-L37 VanDerWaalsContact C-N 3.25Å; V35-L37 PolarHBondContact O-N 3.42Å; L37-T40 PolarHBondContact O-N 2.91Å; L37-M41 HydrophobicContact CG-CE 4.15Å; L37-M41 WeakPolarHBondContact O-CG 3.49Å; L37-M41 PolarHBondContact O-N 3.32Å
38	L	93.9	Very high	83.2	Confident	98 Å²	98	109.4 Å²	109.4	51%	0.513	59%	0.587	S	S	.	*	H	α-helix	trans	-61.3	-47.4	176.2	-167.8	78.8	0	0	0	111.1	R34 V35 T40 M41 V42	R34-L38 WeakPolarHBondContact O-CB 3.34Å; R34-L38 PolarHBondContact O-N 3.36Å; V35-L38 WeakPolarHBondContact O-CB 3.34Å; V35-L38 PolarHBondContact O-N 2.87Å; L38-T40 VanDerWaalsContact C-N 3.3Å; L38-T40 PolarHBondContact O-N 3.21Å; L38-M41 HydrophobicContact CD1-CE 4.14Å; L38-M41 PolarHBondContact O-N 3.48Å; L38-M41 VanDerWaalsContact O-N 3.12Å; L38-V42 HydrophobicContact CG-CG2 4.4Å; L38-V42 WeakPolarHBondContact O-CG2 3.44Å; L38-V42 PolarHBondContact O-N 2.97Å
39	D	95.1	Very high	84.4	Confident	84 Å²	84	104.3 Å²	104.3	45%	0.449	55%	0.553	S	S	.	*	H	α-helix	trans	-56.7	-46.7	178.1	-64.5	-25.2	0	0	0	110.7	V35 M41 V42 D43	V35-D39 VanDerWaalsContact O-CG 3.31Å; V35-D39 PolarHBondContact O-N 3.44Å; D39-M41 PolarHBondContact O-N 2.91Å; D39-V42 PolarHBondContact O-N 3.43Å; D39-D43 WeakPolarHBondContact O-CB 3.35Å; D39-D43 PolarHBondContact O-N 2.89Å
40	T	94.1	Very high	85.7	Confident	80 Å²	80	107 Å²	107	49%	0.491	56%	0.556	S	S	.	*	H	α-helix	trans	-63.4	-41	177.2	-52.7	0	0	0	0	111.9	K36 L37 L38 T44	K36-T40 WeakPolarHBondContact O-CB 3.33Å; K36-T40 PolarHBondContact O-N 3.35Å; K36-T40 VanDerWaalsContact O-N 3.08Å; K36-T40 PolarHBondContact O-OG1 2.94Å; L37-T40 PolarHBondContact O-N 2.91Å; L38-T40 VanDerWaalsContact C-N 3.3Å; L38-T40 PolarHBondContact O-N 3.21Å; T40-T44 HydrophobicContact CG2-CG2 4.45Å; T40-T44 WeakPolarHBondContact O-CB 3.48Å; T40-T44 VanDerWaalsContact O-CG2 3.28Å; T40-T44 WeakPolarHBondContact O-CG2 3.44Å; T40-T44 PolarHBondContact O-N 2.77Å; T40-T44 PolarHBondContact O-OG1 3.11Å
41	M	93.3	Very high	86.8	Confident	97 Å²	97	105.6 Å²	105.6	48%	0.478	56%	0.556	S	S	.	*	H	α-helix	trans	-65.9	-40.1	176.2	-74.5	-170.1	-60	0	0	111.8	L37 L38 D39 T44 F45	L37-M41 HydrophobicContact CG-CE 4.15Å; L37-M41 WeakPolarHBondContact O-CG 3.49Å; L37-M41 PolarHBondContact O-N 3.32Å; L38-M41 HydrophobicContact CD1-CE 4.14Å; L38-M41 PolarHBondContact O-N 3.48Å; L38-M41 VanDerWaalsContact O-N 3.12Å; D39-M41 PolarHBondContact O-N 2.91Å; M41-T44 WeakPolarHBondContact CA-OG1 3.35Å; M41-T44 PolarHBondContact O-OG1 3.4Å; M41-T44 VanDerWaalsContact O-OG1 3.11Å; M41-F45 WeakPolarHBondContact O-CB 3.43Å; M41-F45 PolarHBondContact O-N 2.75Å
42	V	93.1	Very high	87.6	Confident	65 Å²	65	101.5 Å²	101.5	39%	0.394	54%	0.537	S	S	.	.	H	α-helix	trans	-66	-47	177.5	170.7	0	0	0	0	110.3	L38 D39 F45 L46	L38-V42 HydrophobicContact CG-CG2 4.4Å; L38-V42 WeakPolarHBondContact O-CG2 3.44Å; L38-V42 PolarHBondContact O-N 2.97Å; D39-V42 PolarHBondContact O-N 3.43Å; V42-F45 PolarHBondContact O-N 3Å; V42-L46 HydrophobicContact CG1-CD1 3.73Å; V42-L46 HydrophobicContact CG1-CG 4.18Å; V42-L46 WeakPolarHBondContact O-CB 3.45Å; V42-L46 VanDerWaalsContact O-CG 3.24Å; V42-L46 WeakPolarHBondContact O-CG 3.34Å; V42-L46 PolarHBondContact O-N 2.9Å
43	D	93.3	Very high	88	Confident	111 Å²	111	100 Å²	100	59%	0.594	55%	0.547	S	S	*	.	H	α-helix	trans	-61.4	-48.1	178.6	-77.3	-16.7	0	0	0	111.8	D39 F45 L46 Q47	D39-D43 WeakPolarHBondContact O-CB 3.35Å; D39-D43 PolarHBondContact O-N 2.89Å; D43-F45 VanDerWaalsContact C-N 3.33Å; D43-F45 PolarHBondContact O-N 2.87Å; D43-L46 PolarHBondContact O-N 2.87Å; D43-Q47 VanDerWaalsContact O-CB 3.32Å; D43-Q47 WeakPolarHBondContact O-CB 3.3Å; D43-Q47 PolarHBondContact O-N 2.77Å
44	T	89.3	Confident	87.3	Confident	65 Å²	65	105.1 Å²	105.1	40%	0.399	56%	0.556	S	S	.	*	H	α-helix	trans	-66.4	-35.8	178.2	54.6	0	0	0	0	112.3	T40 M41 K48	T40-T44 HydrophobicContact CG2-CG2 4.45Å; T40-T44 WeakPolarHBondContact O-CB 3.48Å; T40-T44 VanDerWaalsContact O-CG2 3.28Å; T40-T44 WeakPolarHBondContact O-CG2 3.44Å; T40-T44 PolarHBondContact O-N 2.77Å; T40-T44 PolarHBondContact O-OG1 3.11Å; M41-T44 WeakPolarHBondContact CA-OG1 3.35Å; M41-T44 PolarHBondContact O-OG1 3.4Å; M41-T44 VanDerWaalsContact O-OG1 3.11Å; T44-K48 WeakPolarHBondContact O-CG 3.38Å; T44-K48 PolarHBondContact O-N 3.49Å
45	F	86.1	Confident	86.7	Confident	131 Å²	131	105.1 Å²	105.1	58%	0.575	56%	0.556	S	S	*	*	H	α-helix	trans	-67	-50.1	175	177.9	-117.1	0	0	0	111.4	M41 V42 D43 Q47 K48 L49	M41-F45 WeakPolarHBondContact O-CB 3.43Å; M41-F45 PolarHBondContact O-N 2.75Å; V42-F45 PolarHBondContact O-N 3Å; D43-F45 VanDerWaalsContact C-N 3.33Å; D43-F45 PolarHBondContact O-N 2.87Å; F45-Q47 VanDerWaalsContact C-N 3.32Å; F45-Q47 PolarHBondContact O-N 3.34Å; F45-K48 PolarHBondContact O-N 3.06Å; F45-L49 HydrophobicContact CD1-CD1 3.55Å; F45-L49 HydrophobicContact CD2-CD1 4.24Å; F45-L49 HydrophobicContact CE1-CD1 3.07Å; F45-L49 HydrophobicContact CE1-CG 4.28Å; F45-L49 HydrophobicContact CE2-CD1 3.82Å; F45-L49 HydrophobicContact CE2-CG 4.26Å; F45-L49 HydrophobicContact CG-CD1 4.12Å; F45-L49 HydrophobicContact CZ-CD1 3.23Å; F45-L49 HydrophobicContact CZ-CG 4.06Å; F45-L49 VanDerWaalsContact O-CB 3.29Å; F45-L49 WeakPolarHBondContact O-CB 3.46Å; F45-L49 PolarHBondContact O-N 3.3Å
46	L	84.9	Confident	86.1	Confident	86 Å²	86	105.6 Å²	105.6	45%	0.45	56%	0.562	S	S	.	*	H	α-helix	trans	-60	-41.8	178.2	-72.3	176.4	0	0	0	111.4	V42 D43 K48 L49 V50	V42-L46 HydrophobicContact CG1-CD1 3.73Å; V42-L46 HydrophobicContact CG1-CG 4.18Å; V42-L46 WeakPolarHBondContact O-CB 3.45Å; V42-L46 VanDerWaalsContact O-CG 3.24Å; V42-L46 WeakPolarHBondContact O-CG 3.34Å; V42-L46 PolarHBondContact O-N 2.9Å; D43-L46 PolarHBondContact O-N 2.87Å; L46-K48 PolarHBondContact O-N 3.29Å; L46-L49 WeakPolarHBondContact O-CB 3.49Å; L46-L49 PolarHBondContact O-N 2.94Å; L46-V50 WeakPolarHBondContact O-CB 3.46Å; L46-V50 VanDerWaalsContact O-CG2 3.24Å; L46-V50 WeakPolarHBondContact O-CG2 3.29Å; L46-V50 PolarHBondContact O-N 3.48Å
47	Q	86.6	Confident	86	Confident	151 Å²	151	101.4 Å²	101.4	71%	0.706	55%	0.55	S	S	*	.	H	α-helix	trans	-61	-44.7	176.5	-171.2	170.7	71.6	0	0	111.9	D43 F45 A51	D43-Q47 VanDerWaalsContact O-CB 3.32Å; D43-Q47 WeakPolarHBondContact O-CB 3.3Å; D43-Q47 PolarHBondContact O-N 2.77Å; F45-Q47 VanDerWaalsContact C-N 3.32Å; F45-Q47 PolarHBondContact O-N 3.34Å; Q47-A51 WeakPolarHBondContact O-CB 3.45Å; Q47-A51 PolarHBondContact O-N 2.99Å; Q47-A51 VanDerWaalsContact O-N 3.13Å
48	K	85.3	Confident	85.8	Confident	155 Å²	155	100.7 Å²	100.7	67%	0.674	56%	0.562	S	S	*	*	H	α-helix	trans	-68	-37.5	175.5	-71.7	176.8	-179.3	-179.3	0	112.4	T44 F45 L46 A52	T44-K48 WeakPolarHBondContact O-CG 3.38Å; T44-K48 PolarHBondContact O-N 3.49Å; F45-K48 PolarHBondContact O-N 3.06Å; L46-K48 PolarHBondContact O-N 3.29Å; K48-A52 VanDerWaalsContact O-CB 3.25Å; K48-A52 WeakPolarHBondContact O-CB 3.46Å; K48-A52 PolarHBondContact O-N 3.18Å
49	L	79.9	Confident	85.8	Confident	36 Å²	36	100.3 Å²	100.3	19%	0.188	56%	0.56	C	S	.	*	H	α-helix	trans	-64.8	-47.8	178.4	-113.7	165.2	0	0	0	112.3	F45 L46 A51 A52 G53 R54 R55	F45-L49 HydrophobicContact CD1-CD1 3.55Å; F45-L49 HydrophobicContact CD2-CD1 4.24Å; F45-L49 HydrophobicContact CE1-CD1 3.07Å; F45-L49 HydrophobicContact CE1-CG 4.28Å; F45-L49 HydrophobicContact CE2-CD1 3.82Å; F45-L49 HydrophobicContact CE2-CG 4.26Å; F45-L49 HydrophobicContact CG-CD1 4.12Å; F45-L49 HydrophobicContact CZ-CD1 3.23Å; F45-L49 HydrophobicContact CZ-CG 4.06Å; F45-L49 VanDerWaalsContact O-CB 3.29Å; F45-L49 WeakPolarHBondContact O-CB 3.46Å; F45-L49 PolarHBondContact O-N 3.3Å; L46-L49 WeakPolarHBondContact O-CB 3.49Å; L46-L49 PolarHBondContact O-N 2.94Å; L49-A51 VanDerWaalsContact C-N 3.32Å; L49-A52 CarbonylContact O-C 3.58Å; L49-A52 PolarHBondContact O-N 2.93Å; L49-G53 PolarHBondContact O-N 3.4Å; L49-R54 WeakPolarHBondContact CD2-O 3.37Å; L49-R55 HydrophobicContact CD2-CG 4.45Å
50	V	79.6	Confident	85.7	Confident	121 Å²	121	100.5 Å²	100.5	73%	0.733	57%	0.566	S	S	*	*	H	α-helix	trans	-63.3	-42.6	177.9	170.4	0	0	0	0	109.7	L46 A52 G53	L46-V50 WeakPolarHBondContact O-CB 3.46Å; L46-V50 VanDerWaalsContact O-CG2 3.24Å; L46-V50 WeakPolarHBondContact O-CG2 3.29Å; L46-V50 PolarHBondContact O-N 3.48Å; V50-A52 VanDerWaalsContact C-N 3.32Å; V50-A52 PolarHBondContact O-N 3.44Å; V50-G53 PolarHBondContact O-N 2.89Å
51	A	80.4	Confident	85.8	Confident	91 Å²	91	102.2 Å²	102.2	75%	0.752	57%	0.568	S	S	*	*	H	α-helix	trans	-63.8	-35.5	175	0	0	0	0	0	113	Q47 L49	Q47-A51 WeakPolarHBondContact O-CB 3.45Å; Q47-A51 PolarHBondContact O-N 2.99Å; Q47-A51 VanDerWaalsContact O-N 3.13Å; L49-A51 VanDerWaalsContact C-N 3.32Å
52	A	79.8	Confident	85.7	Confident	59 Å²	59	103.9 Å²	103.9	49%	0.488	57%	0.573	S	S	.	*	H	α-helix	trans	-85.9	-18.5	-179.8	0	0	0	0	0	114.1	K48 L49 V50 R54	K48-A52 VanDerWaalsContact O-CB 3.25Å; K48-A52 WeakPolarHBondContact O-CB 3.46Å; K48-A52 PolarHBondContact O-N 3.18Å; L49-A52 CarbonylContact O-C 3.58Å; L49-A52 PolarHBondContact O-N 2.93Å; V50-A52 VanDerWaalsContact C-N 3.32Å; V50-A52 PolarHBondContact O-N 3.44Å; A52-R54 HydrophobicContact CB-CB 4.37Å; A52-R54 HydrophobicContact CB-CG 4.43Å; A52-R54 WeakPolarHBondContact O-CG 3.29Å; A52-R54 PolarHBondContact O-N 2.9Å; A52-R54 VanDerWaalsContact O-N 3.1Å
53	G	77.1	Confident	85.7	Confident	70 Å²	70	102.9 Å²	102.9	72%	0.722	57%	0.565	S	S	*	*	T	Hydrogen-bonded Turn	trans	60	14.5	-173.6	0	0	0	0	0	114.7	L49 V50	L49-G53 PolarHBondContact O-N 3.4Å; V50-G53 PolarHBondContact O-N 2.89Å
54	R	73.4	Confident	85.7	Confident	169 Å²	169	102.2 Å²	102.2	64%	0.638	56%	0.561	S	S	*	*			trans	-102.6	98.3	-170	-75.6	-170.3	-174	-99.7	-3.3	112.6	L49 A52 S66	L49-R54 WeakPolarHBondContact CD2-O 3.37Å; A52-R54 HydrophobicContact CB-CB 4.37Å; A52-R54 HydrophobicContact CB-CG 4.43Å; A52-R54 WeakPolarHBondContact O-CG 3.29Å; A52-R54 PolarHBondContact O-N 2.9Å; A52-R54 VanDerWaalsContact O-N 3.1Å; R54-S66 PolarHBondContact NH1-OG 3.47Å; R54-S66 VanDerWaalsContact NH1-OG 3.17Å
55	R	78.1	Confident	85.9	Confident	223 Å²	223	105.4 Å²	105.4	84%	0.842	57%	0.571	S	S	*	*			trans	-87.2	147.6	159.5	-82.5	-177.3	174.5	158.6	-0.9	110.6	L49 S57	L49-R55 HydrophobicContact CD2-CG 4.45Å; R55-S57 PolarHBondContact O-N 3.34Å
56	P	79.8	Confident	86.1	Confident	103 Å²	103	101.7 Å²	101.7	67%	0.669	56%	0.561	S	S	*	*			trans	-52.7	135.1	166.6	-20.4	31.1	0	0	0	109.1	G58 D63	P56-G58 PolarHBondContact O-N 3.46Å; P56-D63 WeakPolarHBondContact CB-OD2 3.48Å
57	S	87.9	Confident	86.4	Confident	51 Å²	51	102.4 Å²	102.4	36%	0.357	57%	0.569	S	S	.	*			trans	-73.9	-15.6	-177.6	63.1	0	0	0	0	112.8	R55 I59 D63	R55-S57 PolarHBondContact O-N 3.34Å; S57-I59 PolarHBondContact O-N 3.07Å; S57-I59 PolarHBondContact OG-N 2.99Å; S57-D63 WeakPolarHBondContact CB-OD1 3.3Å; S57-D63 PolarHBondContact N-OD1 3.15Å; S57-D63 PolarHBondContact N-OD2 3.41Å; S57-D63 PolarHBondContact OG-OD1 3.07Å
58	G	89.9	Confident	86.8	Confident	68 Å²	68	98.5 Å²	98.5	70%	0.701	55%	0.552	S	S	*	*	S	Bend	trans	81	1.5	-172.4	0	0	0	0	0	113	P56 D63	P56-G58 PolarHBondContact O-N 3.46Å; G58-D63 PolarHBondContact N-OD2 3.15Å
59	I	94.2	Very high	87.3	Confident	91 Å²	91	93 Å²	93	47%	0.467	54%	0.535	S	S	.	.			trans	-107	108.7	174.2	-58.2	174.3	0	0	0	107	S57 E61 K62 D63	S57-I59 PolarHBondContact O-N 3.07Å; S57-I59 PolarHBondContact OG-N 2.99Å; I59-E61 VanDerWaalsContact C-N 3.28Å; I59-E61 VanDerWaalsContact CG2-OE2 3.31Å; I59-E61 WeakPolarHBondContact CG2-OE2 3.49Å; I59-E61 PolarHBondContact O-N 3.16Å; I59-K62 HydrophobicContact CB-CB 4.16Å; I59-K62 HydrophobicContact CG2-CB 4.2Å; I59-K62 PolarHBondContact O-N 3.47Å; I59-K62 VanDerWaalsContact O-N 3.12Å; I59-D63 PolarHBondContact O-N 2.97Å; I59-D63 VanDerWaalsContact O-N 3.1Å
60	P	93.8	Very high	88.1	Confident	87 Å²	87	95 Å²	95	57%	0.565	55%	0.55	S	S	*	*	H	α-helix	trans	-60.9	-36.2	-169.5	22.1	-30.9	0	0	0	112.7	K62 D63 L64	P60-K62 PolarHBondContact O-N 3.31Å; P60-D63 PolarHBondContact O-N 3.23Å; P60-L64 WeakPolarHBondContact O-CB 3.46Å; P60-L64 PolarHBondContact O-N 3.47Å
61	E	95.3	Very high	89	Confident	117 Å²	117	96.9 Å²	96.9	55%	0.547	55%	0.545	S	S	.	.	H	α-helix	trans	-62.3	-43.9	178.4	-61.3	73.8	-161.7	0	0	111.2	I59 H65	I59-E61 VanDerWaalsContact C-N 3.28Å; I59-E61 VanDerWaalsContact CG2-OE2 3.31Å; I59-E61 WeakPolarHBondContact CG2-OE2 3.49Å; I59-E61 PolarHBondContact O-N 3.16Å; E61-H65 WeakPolarHBondContact O-CB 3.48Å; E61-H65 PolarHBondContact O-CD2 3.44Å; E61-H65 VanDerWaalsContact O-CG 3.22Å; E61-H65 PolarHBondContact O-N 3.39Å
62	K	92.1	Very high	89.8	Confident	132 Å²	132	97.9 Å²	97.9	57%	0.574	53%	0.533	S	S	*	.	H	α-helix	trans	-68.7	-42.4	-178.9	-179.3	171.6	177.4	175.1	0	111.6	I59 P60 H65 S66	I59-K62 HydrophobicContact CB-CB 4.16Å; I59-K62 HydrophobicContact CG2-CB 4.2Å; I59-K62 PolarHBondContact O-N 3.47Å; I59-K62 VanDerWaalsContact O-N 3.12Å; P60-K62 PolarHBondContact O-N 3.31Å; K62-H65 PolarHBondContact O-N 3.1Å; K62-S66 PolarHBondContact O-N 3.43Å; K62-S66 VanDerWaalsContact O-N 3.08Å
63	D	92.3	Very high	90.7	Very high	44 Å²	44	98.9 Å²	98.9	24%	0.235	53%	0.53	C	S	.	.	H	α-helix	trans	-69.2	-39.6	-179.8	-65.3	-15.1	0	0	0	110.4	P56 S57 G58 I59 P60 S66 V67	P56-D63 WeakPolarHBondContact CB-OD2 3.48Å; S57-D63 WeakPolarHBondContact CB-OD1 3.3Å; S57-D63 PolarHBondContact N-OD1 3.15Å; S57-D63 PolarHBondContact N-OD2 3.41Å; S57-D63 PolarHBondContact OG-OD1 3.07Å; G58-D63 PolarHBondContact N-OD2 3.15Å; I59-D63 PolarHBondContact O-N 2.97Å; I59-D63 VanDerWaalsContact O-N 3.1Å; P60-D63 PolarHBondContact O-N 3.23Å; D63-S66 PolarHBondContact O-N 3.3Å; D63-V67 WeakPolarHBondContact O-CG2 3.33Å; D63-V67 PolarHBondContact O-N 3.22Å
64	L	94.3	Very high	91.7	Very high	97 Å²	97	101.8 Å²	101.8	51%	0.508	53%	0.525	S	S	.	.	H	α-helix	trans	-62.5	-47	173.4	-177.5	64.9	0	0	0	111.7	P60 S66 V67 M68	P60-L64 WeakPolarHBondContact O-CB 3.46Å; P60-L64 PolarHBondContact O-N 3.47Å; L64-S66 VanDerWaalsContact C-N 3.26Å; L64-S66 PolarHBondContact O-N 2.99Å; L64-V67 PolarHBondContact O-N 3Å; L64-V67 VanDerWaalsContact O-N 3.11Å; L64-M68 HydrophobicContact CD1-CG 3.85Å; L64-M68 HydrophobicContact CD1-SD 3.65Å; L64-M68 HydrophobicContact CD2-SD 4.14Å; L64-M68 HydrophobicContact CG-CG 4.14Å; L64-M68 HydrophobicContact CG-SD 3.72Å; L64-M68 WeakPolarHBondContact O-CB 3.43Å; L64-M68 WeakPolarHBondContact O-CG 3.39Å; L64-M68 PolarHBondContact O-N 2.97Å
65	H	92.3	Very high	92.9	Very high	131 Å²	131	99.1 Å²	99.1	61%	0.606	52%	0.519	S	S	*	.	H	α-helix	trans	-58	-41.2	177.6	-78.1	-155.5	0	0	0	111.5	E61 K62 V67 M68 A69	E61-H65 WeakPolarHBondContact O-CB 3.48Å; E61-H65 PolarHBondContact O-CD2 3.44Å; E61-H65 VanDerWaalsContact O-CG 3.22Å; E61-H65 PolarHBondContact O-N 3.39Å; K62-H65 PolarHBondContact O-N 3.1Å; H65-V67 VanDerWaalsContact C-N 3.31Å; H65-V67 PolarHBondContact O-N 3.4Å; H65-M68 PolarHBondContact O-N 3.35Å; H65-A69 WeakPolarHBondContact O-CA 3.39Å; H65-A69 WeakPolarHBondContact O-CB 3.49Å; H65-A69 PolarHBondContact O-N 3.31Å
66	S	90.3	Very high	93.9	Very high	53 Å²	53	93.4 Å²	93.4	37%	0.371	50%	0.498	S	S	.	.	H	α-helix	trans	-62.8	-38.6	177.7	-173.2	0	0	0	0	112.5	R54 K62 D63 L64	R54-S66 PolarHBondContact NH1-OG 3.47Å; R54-S66 VanDerWaalsContact NH1-OG 3.17Å; K62-S66 PolarHBondContact O-N 3.43Å; K62-S66 VanDerWaalsContact O-N 3.08Å; D63-S66 PolarHBondContact O-N 3.3Å; L64-S66 VanDerWaalsContact C-N 3.26Å; L64-S66 PolarHBondContact O-N 2.99Å
67	V	91.2	Very high	94.8	Very high	101 Å²	101	91.6 Å²	91.6	61%	0.612	48%	0.482	S	S	*	.	H	α-helix	trans	-73.4	-39.8	178.1	174.3	0	0	0	0	111	D63 L64 H65 P70	D63-V67 WeakPolarHBondContact O-CG2 3.33Å; D63-V67 PolarHBondContact O-N 3.22Å; L64-V67 PolarHBondContact O-N 3Å; L64-V67 VanDerWaalsContact O-N 3.11Å; H65-V67 VanDerWaalsContact C-N 3.31Å; H65-V67 PolarHBondContact O-N 3.4Å; V67-P70 WeakPolarHBondContact O-CD 3.37Å
68	M	96.4	Very high	95.3	Very high	69 Å²	69	91.1 Å²	91.1	34%	0.34	48%	0.477	S	S	.	.	H	α-helix	trans	-83.3	-24.3	-175.4	-66.8	-169.4	78.4	0	0	114.1	L64 H65 P70 Y71 F72	L64-M68 HydrophobicContact CD1-CG 3.85Å; L64-M68 HydrophobicContact CD1-SD 3.65Å; L64-M68 HydrophobicContact CD2-SD 4.14Å; L64-M68 HydrophobicContact CG-CG 4.14Å; L64-M68 HydrophobicContact CG-SD 3.72Å; L64-M68 WeakPolarHBondContact O-CB 3.43Å; L64-M68 WeakPolarHBondContact O-CG 3.39Å; L64-M68 PolarHBondContact O-N 2.97Å; H65-M68 PolarHBondContact O-N 3.35Å; M68-P70 VanDerWaalsContact C-CD 3.42Å; M68-Y71 PolarHBondContact O-N 2.85Å; M68-F72 HydrophobicContact CB-CD2 4.02Å; M68-F72 HydrophobicContact CB-CE2 3.69Å; M68-F72 HydrophobicContact CE-CE1 4.31Å; M68-F72 HydrophobicContact CE-CE2 3.64Å; M68-F72 HydrophobicContact CE-CZ 3.37Å; M68-F72 PolarHBondContact O-N 3.49Å; M68-F72 HydrophobicContact SD-CE2 4.12Å; M68-F72 HydrophobicContact SD-CZ 4.36Å
69	A	96.1	Very high	95.7	Very high	39 Å²	39	92.7 Å²	92.7	32%	0.322	47%	0.469	S	S	.	.	H	α-helix	trans	-51.1	-43.7	-174.4	0	0	0	0	0	114.5	H65 Y71 F72 L73	H65-A69 WeakPolarHBondContact O-CA 3.39Å; H65-A69 WeakPolarHBondContact O-CB 3.49Å; H65-A69 PolarHBondContact O-N 3.31Å; A69-Y71 VanDerWaalsContact C-N 3.28Å; A69-Y71 PolarHBondContact O-N 3.34Å; A69-F72 PolarHBondContact O-N 2.89Å; A69-L73 WeakPolarHBondContact O-CB 3.29Å; A69-L73 VanDerWaalsContact O-CG 3.24Å; A69-L73 WeakPolarHBondContact O-CG 3.29Å; A69-L73 PolarHBondContact O-N 2.92Å
70	P	96.5	Very high	96	Very high	78 Å²	78	94.4 Å²	94.4	51%	0.506	47%	0.47	S	S	.	.	H	α-helix	trans	-57.3	-39.4	178.4	-25	35.4	0	0	0	113.2	V67 M68 Q74	V67-P70 WeakPolarHBondContact O-CD 3.37Å; M68-P70 VanDerWaalsContact C-CD 3.42Å; P70-Q74 WeakPolarHBondContact O-CB 3.42Å; P70-Q74 PolarHBondContact O-N 3.07Å
71	Y	97.8	Very high	96.2	Very high	161 Å²	161	97.7 Å²	97.7	63%	0.631	47%	0.471	S	S	*	.	H	α-helix	trans	-70.3	-44.2	-179.1	-59	-77.4	0	0	0	112.1	M68 A69 L73 Q74 Q75	M68-Y71 PolarHBondContact O-N 2.85Å; A69-Y71 VanDerWaalsContact C-N 3.28Å; A69-Y71 PolarHBondContact O-N 3.34Å; Y71-L73 VanDerWaalsContact C-N 3.34Å; Y71-L73 PolarHBondContact O-N 3.26Å; Y71-Q74 PolarHBondContact O-N 3.26Å; Y71-Q75 WeakPolarHBondContact O-CB 3.43Å; Y71-Q75 PolarHBondContact O-N 3.2Å
72	F	97.9	Very high	96.4	Very high	113 Å²	113	98 Å²	98	50%	0.496	47%	0.472	S	S	.	.	H	α-helix	trans	-67.8	-35.8	178	-67.4	-47	0	0	0	112.4	M68 A69 Q75 R76	M68-F72 HydrophobicContact CB-CD2 4.02Å; M68-F72 HydrophobicContact CB-CE2 3.69Å; M68-F72 HydrophobicContact CE-CE1 4.31Å; M68-F72 HydrophobicContact CE-CE2 3.64Å; M68-F72 HydrophobicContact CE-CZ 3.37Å; M68-F72 PolarHBondContact O-N 3.49Å; M68-F72 HydrophobicContact SD-CE2 4.12Å; M68-F72 HydrophobicContact SD-CZ 4.36Å; A69-F72 PolarHBondContact O-N 2.89Å; F72-Q75 PolarHBondContact O-N 2.95Å; F72-R76 VanDerWaalsContact O-CB 3.27Å; F72-R76 WeakPolarHBondContact O-CB 3.45Å; F72-R76 PolarHBondContact O-N 3.34Å
73	L	98.4	Very high	96.7	Very high	80 Å²	80	95.3 Å²	95.3	42%	0.419	47%	0.467	S	S	.	.	H	α-helix	trans	-64.4	-46.6	173.1	-69.7	172.7	0	0	0	110.9	A69 Y71 Q75 R76 D77	A69-L73 WeakPolarHBondContact O-CB 3.29Å; A69-L73 VanDerWaalsContact O-CG 3.24Å; A69-L73 WeakPolarHBondContact O-CG 3.29Å; A69-L73 PolarHBondContact O-N 2.92Å; Y71-L73 VanDerWaalsContact C-N 3.34Å; Y71-L73 PolarHBondContact O-N 3.26Å; L73-Q75 VanDerWaalsContact C-N 3.34Å; L73-Q75 PolarHBondContact O-N 3.41Å; L73-R76 PolarHBondContact O-N 2.88Å; L73-D77 WeakPolarHBondContact O-CB 3.46Å; L73-D77 PolarHBondContact O-N 2.9Å
74	Q	98.5	Very high	97	Very high	131 Å²	131	99.1 Å²	99.1	61%	0.612	48%	0.483	S	S	*	.	H	α-helix	trans	-59.4	-42.9	175.6	179.9	178.9	-15.3	0	0	112.4	P70 Y71 T78	P70-Q74 WeakPolarHBondContact O-CB 3.42Å; P70-Q74 PolarHBondContact O-N 3.07Å; Y71-Q74 PolarHBondContact O-N 3.26Å; Q74-T78 WeakPolarHBondContact O-CB 3.35Å; Q74-T78 PolarHBondContact O-N 3.4Å; Q74-T78 PolarHBondContact O-OG1 3.31Å
75	Q	98.6	Very high	97.2	Very high	112 Å²	112	100.8 Å²	100.8	52%	0.523	49%	0.486	S	S	.	.	H	α-helix	trans	-62	-50.3	177	-177.9	-178.7	-1.9	0	0	110.9	Y71 F72 L73 D77 T78 L79	Y71-Q75 WeakPolarHBondContact O-CB 3.43Å; Y71-Q75 PolarHBondContact O-N 3.2Å; F72-Q75 PolarHBondContact O-N 2.95Å; L73-Q75 VanDerWaalsContact C-N 3.34Å; L73-Q75 PolarHBondContact O-N 3.41Å; Q75-D77 VanDerWaalsContact C-N 3.34Å; Q75-D77 PolarHBondContact O-N 2.95Å; Q75-T78 PolarHBondContact O-N 2.87Å; Q75-L79 HydrophobicContact CG-CD1 4.2Å; Q75-L79 WeakPolarHBondContact O-CG 3.36Å; Q75-L79 PolarHBondContact O-N 3.01Å
76	R	98.6	Very high	97.5	Very high	103 Å²	103	99.2 Å²	99.2	39%	0.389	48%	0.479	S	S	.	.	H	α-helix	trans	-57.8	-46.8	178.8	-176.9	-164.6	71.6	179.8	-1.9	111.6	F72 L73 T78 L79 R80	F72-R76 VanDerWaalsContact O-CB 3.27Å; F72-R76 WeakPolarHBondContact O-CB 3.45Å; F72-R76 PolarHBondContact O-N 3.34Å; L73-R76 PolarHBondContact O-N 2.88Å; R76-T78 VanDerWaalsContact C-N 3.3Å; R76-T78 PolarHBondContact O-N 2.85Å; R76-L79 PolarHBondContact O-N 3.34Å; R76-R80 VanDerWaalsContact CD-CZ 3.48Å; R76-R80 VanDerWaalsContact CZ-NH1 3.29Å; R76-R80 VanDerWaalsContact NE-NH1 3.2Å; R76-R80 WeakPolarHBondContact O-CB 3.29Å; R76-R80 VanDerWaalsContact O-CG 3.27Å; R76-R80 WeakPolarHBondContact O-CG 3.36Å; R76-R80 PolarHBondContact O-N 3.46Å
77	D	98.8	Very high	97.9	Very high	65 Å²	65	102.3 Å²	102.3	35%	0.348	49%	0.488	S	S	.	.	H	α-helix	trans	-70.9	-30.2	-176.7	-63.4	-14.6	0	0	0	111.5	L73 Q75 R80 R81	L73-D77 WeakPolarHBondContact O-CB 3.46Å; L73-D77 PolarHBondContact O-N 2.9Å; Q75-D77 VanDerWaalsContact C-N 3.34Å; Q75-D77 PolarHBondContact O-N 2.95Å; D77-R80 IonicContact OD1-NH1 3.75Å; D77-R81 WeakPolarHBondContact O-CG 3.36Å; D77-R81 PolarHBondContact O-N 3.35Å; D77-R81 VanDerWaalsContact O-N 3.17Å; D77-R81 PolarHBondContact O-NE 3.4Å
78	T	98.6	Very high	98.3	Very high	41 Å²	41	99.9 Å²	99.9	25%	0.252	48%	0.478	S	S	.	.	H	α-helix	trans	-66.2	-49.9	170.6	-59.8	0	0	0	0	111.2	Q74 Q75 R76 R80 R81 H82	Q74-T78 WeakPolarHBondContact O-CB 3.35Å; Q74-T78 PolarHBondContact O-N 3.4Å; Q74-T78 PolarHBondContact O-OG1 3.31Å; Q75-T78 PolarHBondContact O-N 2.87Å; R76-T78 VanDerWaalsContact C-N 3.3Å; R76-T78 PolarHBondContact O-N 2.85Å; T78-R80 VanDerWaalsContact C-N 3.33Å; T78-R80 PolarHBondContact O-N 3.05Å; T78-R81 PolarHBondContact O-N 3.41Å; T78-R81 PolarHBondContact OG1-NH2 2.99Å; T78-H82 PolarHBondContact O-N 3.46Å; T78-H82 PolarHBondContact O-ND1 2.92Å
79	L	98.8	Very high	98.4	Very high	101 Å²	101	100.3 Å²	100.3	53%	0.529	48%	0.479	S	S	.	.	H	α-helix	trans	-60.1	-44.2	177.9	-69.2	172.6	0	0	0	111.6	Q75 R76 R81 H82 V83	Q75-L79 HydrophobicContact CG-CD1 4.2Å; Q75-L79 WeakPolarHBondContact O-CG 3.36Å; Q75-L79 PolarHBondContact O-N 3.01Å; R76-L79 PolarHBondContact O-N 3.34Å; L79-R81 VanDerWaalsContact C-N 3.32Å; L79-R81 PolarHBondContact O-N 3.33Å; L79-H82 PolarHBondContact O-N 3.41Å; L79-H82 VanDerWaalsContact O-N 3.09Å; L79-V83 WeakPolarHBondContact O-CG2 2.92Å; L79-V83 PolarHBondContact O-N 2.85Å
80	R	98.8	Very high	98.5	Very high	128 Å²	128	102.3 Å²	102.3	48%	0.483	49%	0.485	S	S	.	.	H	α-helix	trans	-55.7	-44.8	176.2	-77.3	172.1	175.7	-176.1	-5.4	112.6	R76 D77 T78 H82 V83 Q84	R76-R80 VanDerWaalsContact CD-CZ 3.48Å; R76-R80 VanDerWaalsContact CZ-NH1 3.29Å; R76-R80 VanDerWaalsContact NE-NH1 3.2Å; R76-R80 WeakPolarHBondContact O-CB 3.29Å; R76-R80 VanDerWaalsContact O-CG 3.27Å; R76-R80 WeakPolarHBondContact O-CG 3.36Å; R76-R80 PolarHBondContact O-N 3.46Å; D77-R80 IonicContact OD1-NH1 3.75Å; T78-R80 VanDerWaalsContact C-N 3.33Å; T78-R80 PolarHBondContact O-N 3.05Å; R80-H82 VanDerWaalsContact C-N 3.33Å; R80-H82 PolarHBondContact O-N 3.44Å; R80-V83 PolarHBondContact O-N 3.11Å; R80-Q84 WeakPolarHBondContact O-CB 3.27Å; R80-Q84 VanDerWaalsContact O-CG 3.29Å; R80-Q84 WeakPolarHBondContact O-CG 3.44Å; R80-Q84 PolarHBondContact O-N 3Å
81	R	98.8	Very high	98.6	Very high	156 Å²	156	103.8 Å²	103.8	59%	0.589	49%	0.485	S	S	*	.	H	α-helix	trans	-61.5	-40.4	176.5	-75	-178.8	-68.7	158.8	-0.8	112.4	D77 T78 L79 K85	D77-R81 WeakPolarHBondContact O-CG 3.36Å; D77-R81 PolarHBondContact O-N 3.35Å; D77-R81 VanDerWaalsContact O-N 3.17Å; D77-R81 PolarHBondContact O-NE 3.4Å; T78-R81 PolarHBondContact O-N 3.41Å; T78-R81 PolarHBondContact OG1-NH2 2.99Å; L79-R81 VanDerWaalsContact C-N 3.32Å; L79-R81 PolarHBondContact O-N 3.33Å; R81-K85 VanDerWaalsContact O-CB 3.3Å; R81-K85 WeakPolarHBondContact O-CB 3.3Å; R81-K85 PolarHBondContact O-N 3.09Å
82	H	98.7	Very high	98.7	Very high	122 Å²	122	102.7 Å²	102.7	57%	0.565	49%	0.485	S	S	*	.	H	α-helix	trans	-66.8	-43.9	177.9	-71.7	78.4	0	0	0	111.6	T78 L79 R80 K85 Q86	T78-H82 PolarHBondContact O-N 3.46Å; T78-H82 PolarHBondContact O-ND1 2.92Å; L79-H82 PolarHBondContact O-N 3.41Å; L79-H82 VanDerWaalsContact O-N 3.09Å; R80-H82 VanDerWaalsContact C-N 3.33Å; R80-H82 PolarHBondContact O-N 3.44Å; H82-K85 PolarHBondContact O-N 2.87Å; H82-Q86 WeakPolarHBondContact O-CB 3.41Å; H82-Q86 PolarHBondContact O-N 3.35Å
83	V	98.9	Very high	98.7	Very high	77 Å²	77	102.5 Å²	102.5	47%	0.467	49%	0.489	S	S	.	.	H	α-helix	trans	-61.4	-50.2	176.4	174.5	0	0	0	0	110.9	L79 R80 K85 Q86 E87	L79-V83 WeakPolarHBondContact O-CG2 2.92Å; L79-V83 PolarHBondContact O-N 2.85Å; R80-V83 PolarHBondContact O-N 3.11Å; V83-K85 VanDerWaalsContact C-N 3.3Å; V83-K85 PolarHBondContact O-N 3.34Å; V83-Q86 PolarHBondContact O-N 2.89Å; V83-Q86 VanDerWaalsContact O-N 3.11Å; V83-E87 HydrophobicContact CG1-CG 4.2Å; V83-E87 WeakPolarHBondContact CG1-OE1 3.41Å; V83-E87 WeakPolarHBondContact O-CG 3.24Å; V83-E87 PolarHBondContact O-N 3.43Å
84	Q	98.8	Very high	98.7	Very high	123 Å²	123	100.7 Å²	100.7	58%	0.575	49%	0.486	S	S	*	.	H	α-helix	trans	-60.2	-39.9	179.4	-74.1	173.8	-12.7	0	0	112.6	R80 E87 A88	R80-Q84 WeakPolarHBondContact O-CB 3.27Å; R80-Q84 VanDerWaalsContact O-CG 3.29Å; R80-Q84 WeakPolarHBondContact O-CG 3.44Å; R80-Q84 PolarHBondContact O-N 3Å; Q84-E87 PolarHBondContact O-N 3.42Å; Q84-A88 WeakPolarHBondContact O-CB 3.27Å; Q84-A88 PolarHBondContact O-N 2.93Å
85	K	98.7	Very high	98.7	Very high	132 Å²	132	98.3 Å²	98.3	57%	0.574	48%	0.477	S	S	*	.	H	α-helix	trans	-60.8	-48.8	174.8	-179.7	179.2	172	-176.7	0	110.8	R81 H82 V83 E87 A88 E89	R81-K85 VanDerWaalsContact O-CB 3.3Å; R81-K85 WeakPolarHBondContact O-CB 3.3Å; R81-K85 PolarHBondContact O-N 3.09Å; H82-K85 PolarHBondContact O-N 2.87Å; V83-K85 VanDerWaalsContact C-N 3.3Å; V83-K85 PolarHBondContact O-N 3.34Å; K85-E87 VanDerWaalsContact C-N 3.34Å; K85-E87 PolarHBondContact O-N 3.17Å; K85-A88 PolarHBondContact O-N 3.45Å; K85-E89 WeakPolarHBondContact CE-OE1 3.49Å; K85-E89 IonicContact NZ-OE1 3.93Å; K85-E89 WeakPolarHBondContact O-CG 3.43Å; K85-E89 PolarHBondContact O-N 3.24Å
86	Q	98.8	Very high	98.7	Very high	98 Å²	98	95.9 Å²	95.9	46%	0.458	48%	0.476	S	S	.	.	H	α-helix	trans	-63.8	-39.8	-179.9	-168.5	63.8	49.4	0	0	112.1	H82 V83 E89 N90	H82-Q86 WeakPolarHBondContact O-CB 3.41Å; H82-Q86 PolarHBondContact O-N 3.35Å; V83-Q86 PolarHBondContact O-N 2.89Å; V83-Q86 VanDerWaalsContact O-N 3.11Å; Q86-E89 PolarHBondContact O-N 3.17Å; Q86-N90 PolarHBondContact NE2-OD1 3.46Å; Q86-N90 VanDerWaalsContact NE2-OD1 3.09Å; Q86-N90 VanDerWaalsContact O-CB 3.29Å; Q86-N90 WeakPolarHBondContact O-CB 3.35Å; Q86-N90 PolarHBondContact O-N 2.79Å; Q86-N90 PolarHBondContact O-OD1 2.99Å
87	E	98.8	Very high	98.8	Very high	119 Å²	119	94.6 Å²	94.6	56%	0.556	48%	0.48	S	S	*	.	H	α-helix	trans	-63.7	-42	177	-74.3	172.7	169.4	0	0	111.5	V83 Q84 K85 N90 Q91	V83-E87 HydrophobicContact CG1-CG 4.2Å; V83-E87 WeakPolarHBondContact CG1-OE1 3.41Å; V83-E87 WeakPolarHBondContact O-CG 3.24Å; V83-E87 PolarHBondContact O-N 3.43Å; Q84-E87 PolarHBondContact O-N 3.42Å; K85-E87 VanDerWaalsContact C-N 3.34Å; K85-E87 PolarHBondContact O-N 3.17Å; E87-N90 PolarHBondContact O-N 3.32Å; E87-Q91 WeakPolarHBondContact O-CB 3.48Å; E87-Q91 PolarHBondContact O-N 3.36Å
88	A	98.8	Very high	98.8	Very high	50 Å²	50	95.9 Å²	95.9	41%	0.413	49%	0.486	S	S	.	.	H	α-helix	trans	-64	-44.7	176.6	0	0	0	0	0	112.1	Q84 K85 Q91 Q92	Q84-A88 WeakPolarHBondContact O-CB 3.27Å; Q84-A88 PolarHBondContact O-N 2.93Å; K85-A88 PolarHBondContact O-N 3.45Å; A88-Q91 PolarHBondContact O-N 3.09Å; A88-Q92 WeakPolarHBondContact O-CG 3.42Å; A88-Q92 PolarHBondContact O-N 3.33Å; A88-Q92 VanDerWaalsContact O-N 3.07Å
89	E	98.7	Very high	98.8	Very high	77 Å²	77	95.9 Å²	95.9	36%	0.36	49%	0.49	S	S	.	.	H	α-helix	trans	-62.5	-44.6	175.6	-71.7	174.4	-169.6	0	0	111.3	K85 Q86 Q91 Q92 L93	K85-E89 WeakPolarHBondContact CE-OE1 3.49Å; K85-E89 IonicContact NZ-OE1 3.93Å; K85-E89 WeakPolarHBondContact O-CG 3.43Å; K85-E89 PolarHBondContact O-N 3.24Å; Q86-E89 PolarHBondContact O-N 3.17Å; E89-Q91 VanDerWaalsContact C-N 3.31Å; E89-Q91 PolarHBondContact O-N 3.18Å; E89-Q92 PolarHBondContact O-N 2.97Å; E89-L93 WeakPolarHBondContact O-CG 3.39Å; E89-L93 PolarHBondContact O-N 3.29Å
90	N	98.8	Very high	98.8	Very high	81 Å²	81	92.4 Å²	92.4	43%	0.433	48%	0.479	S	S	.	.	H	α-helix	trans	-63.2	-38	177.4	-74.2	-4.1	0	0	0	112	Q86 E87 L93 A94	Q86-N90 PolarHBondContact NE2-OD1 3.46Å; Q86-N90 VanDerWaalsContact NE2-OD1 3.09Å; Q86-N90 VanDerWaalsContact O-CB 3.29Å; Q86-N90 WeakPolarHBondContact O-CB 3.35Å; Q86-N90 PolarHBondContact O-N 2.79Å; Q86-N90 PolarHBondContact O-OD1 2.99Å; E87-N90 PolarHBondContact O-N 3.32Å; N90-L93 PolarHBondContact O-N 3.49Å; N90-A94 WeakPolarHBondContact O-CB 3.47Å; N90-A94 PolarHBondContact O-N 3.26Å
91	Q	98.8	Very high	98.8	Very high	110 Å²	110	93.9 Å²	93.9	51%	0.514	49%	0.485	S	S	.	.	H	α-helix	trans	-63	-46.1	175.9	-173.9	61.5	33.8	0	0	111	E87 A88 E89 L93 A94 D95	E87-Q91 WeakPolarHBondContact O-CB 3.48Å; E87-Q91 PolarHBondContact O-N 3.36Å; A88-Q91 PolarHBondContact O-N 3.09Å; E89-Q91 VanDerWaalsContact C-N 3.31Å; E89-Q91 PolarHBondContact O-N 3.18Å; Q91-L93 VanDerWaalsContact C-N 3.32Å; Q91-L93 PolarHBondContact O-N 3.4Å; Q91-A94 WeakPolarHBondContact O-CB 3.37Å; Q91-A94 PolarHBondContact O-N 3.46Å; Q91-D95 PolarHBondContact NE2-OD1 2.95Å; Q91-D95 VanDerWaalsContact O-CG 3.32Å; Q91-D95 PolarHBondContact O-N 2.88Å
92	Q	98.7	Very high	98.8	Very high	137 Å²	137	93.4 Å²	93.4	64%	0.64	48%	0.483	S	S	*	.	H	α-helix	trans	-60.4	-41.9	175.7	-69.6	174.6	7.2	0	0	111.9	A88 E89 D95 A96	A88-Q92 WeakPolarHBondContact O-CG 3.42Å; A88-Q92 PolarHBondContact O-N 3.33Å; A88-Q92 VanDerWaalsContact O-N 3.07Å; E89-Q92 PolarHBondContact O-N 2.97Å; Q92-D95 PolarHBondContact O-N 2.9Å; Q92-A96 WeakPolarHBondContact O-CB 3.37Å; Q92-A96 PolarHBondContact O-N 3.42Å
93	L	98.8	Very high	98.8	Very high	109 Å²	109	93.4 Å²	93.4	57%	0.571	48%	0.483	S	S	*	.	H	α-helix	trans	-64.9	-40.6	175.7	-70.6	173.7	0	0	0	112	E89 N90 Q91 D95 A96 V97	E89-L93 WeakPolarHBondContact O-CG 3.39Å; E89-L93 PolarHBondContact O-N 3.29Å; N90-L93 PolarHBondContact O-N 3.49Å; Q91-L93 VanDerWaalsContact C-N 3.32Å; Q91-L93 PolarHBondContact O-N 3.4Å; L93-D95 VanDerWaalsContact C-N 3.35Å; L93-A96 PolarHBondContact O-N 2.76Å; L93-V97 WeakPolarHBondContact O-CB 3.39Å; L93-V97 VanDerWaalsContact O-CG2 3.29Å; L93-V97 WeakPolarHBondContact O-CG2 3.14Å; L93-V97 PolarHBondContact O-N 2.82Å
94	A	98.8	Very high	98.8	Very high	43 Å²	43	93.4 Å²	93.4	36%	0.355	48%	0.483	S	S	.	.	H	α-helix	trans	-61.8	-44.1	176.1	0	0	0	0	0	111.2	N90 Q91 A96 V97 L98	N90-A94 WeakPolarHBondContact O-CB 3.47Å; N90-A94 PolarHBondContact O-N 3.26Å; Q91-A94 WeakPolarHBondContact O-CB 3.37Å; Q91-A94 PolarHBondContact O-N 3.46Å; A94-A96 PolarHBondContact O-N 3.43Å; A94-V97 PolarHBondContact O-N 3.1Å; A94-L98 WeakPolarHBondContact O-CG 3.31Å; A94-L98 PolarHBondContact O-N 3.17Å
95	D	98.8	Very high	98.7	Very high	81 Å²	81	93.2 Å²	93.2	43%	0.433	48%	0.482	S	S	.	.	H	α-helix	trans	-63	-42.6	177	-67.2	-23.4	0	0	0	111.5	Q91 Q92 L93 L98 A99	Q91-D95 PolarHBondContact NE2-OD1 2.95Å; Q91-D95 VanDerWaalsContact O-CG 3.32Å; Q91-D95 PolarHBondContact O-N 2.88Å; Q92-D95 PolarHBondContact O-N 2.9Å; L93-D95 VanDerWaalsContact C-N 3.35Å; D95-L98 PolarHBondContact O-N 2.96Å; D95-A99 WeakPolarHBondContact O-CB 3.42Å; D95-A99 PolarHBondContact O-N 2.93Å
96	A	98.8	Very high	98.7	Very high	61 Å²	61	92.3 Å²	92.3	50%	0.504	48%	0.48	S	S	.	.	H	α-helix	trans	-63	-40.9	175	0	0	0	0	0	112.2	Q92 L93 A94 A99 G100	Q92-A96 WeakPolarHBondContact O-CB 3.37Å; Q92-A96 PolarHBondContact O-N 3.42Å; L93-A96 PolarHBondContact O-N 2.76Å; A94-A96 PolarHBondContact O-N 3.43Å; A96-A99 PolarHBondContact O-N 3.18Å; A96-G100 PolarHBondContact O-N 3.34Å
97	V	98.9	Very high	98.7	Very high	75 Å²	75	91.6 Å²	91.6	46%	0.455	48%	0.479	S	S	.	.	H	α-helix	trans	-63.2	-43.8	175.1	165.4	0	0	0	0	110.9	L93 A94 G100 R101	L93-V97 WeakPolarHBondContact O-CB 3.39Å; L93-V97 VanDerWaalsContact O-CG2 3.29Å; L93-V97 WeakPolarHBondContact O-CG2 3.14Å; L93-V97 PolarHBondContact O-N 2.82Å; A94-V97 PolarHBondContact O-N 3.1Å; V97-G100 PolarHBondContact O-N 2.81Å; V97-R101 WeakPolarHBondContact O-CG 3.42Å; V97-R101 PolarHBondContact O-N 3.3Å
98	L	98.9	Very high	98.7	Very high	92 Å²	92	92 Å²	92	48%	0.482	48%	0.481	S	S	.	.	H	α-helix	trans	-64	-41.2	176.5	-69.8	175.3	0	0	0	111.6	A94 D95 R101 R102	A94-L98 WeakPolarHBondContact O-CG 3.31Å; A94-L98 PolarHBondContact O-N 3.17Å; D95-L98 PolarHBondContact O-N 2.96Å; L98-R101 PolarHBondContact O-N 3.11Å; L98-R102 WeakPolarHBondContact O-CG 3.37Å; L98-R102 PolarHBondContact O-N 2.84Å; L98-R102 VanDerWaalsContact O-N 3.15Å; L98-R102 PolarHBondContact O-NH1 3.35Å
99	A	98.7	Very high	98.7	Very high	41 Å²	41	95 Å²	95	34%	0.339	49%	0.489	S	S	.	.	H	α-helix	trans	-61.5	-45.2	173.9	0	0	0	0	0	112	D95 A96 R101 R102 Q103	D95-A99 WeakPolarHBondContact O-CB 3.42Å; D95-A99 PolarHBondContact O-N 2.93Å; A96-A99 PolarHBondContact O-N 3.18Å; A99-R101 PolarHBondContact O-N 3.43Å; A99-R102 PolarHBondContact O-N 3.29Å; A99-Q103 PolarHBondContact O-N 3.04Å; A99-Q103 VanDerWaalsContact O-N 3.1Å
100	G	98.8	Very high	98.7	Very high	29 Å²	29	95.8 Å²	95.8	30%	0.299	49%	0.493	S	S	.	.	H	α-helix	trans	-61.4	-41.6	176	0	0	0	0	0	112.7	A96 V97 R102 Q103 V104	A96-G100 PolarHBondContact O-N 3.34Å; V97-G100 PolarHBondContact O-N 2.81Å; G100-R102 PolarHBondContact O-N 3.37Å; G100-Q103 PolarHBondContact O-N 2.67Å; G100-V104 WeakPolarHBondContact O-CG2 3.36Å; G100-V104 PolarHBondContact O-N 3.08Å
101	R	98.8	Very high	98.6	Very high	158 Å²	158	96.7 Å²	96.7	60%	0.596	50%	0.501	S	S	*	.	H	α-helix	trans	-59.9	-45	176	-74.2	176.6	-165.9	-88.6	0.8	112	V97 L98 A99 Q103 V104 E105	V97-R101 WeakPolarHBondContact O-CG 3.42Å; V97-R101 PolarHBondContact O-N 3.3Å; L98-R101 PolarHBondContact O-N 3.11Å; A99-R101 PolarHBondContact O-N 3.43Å; R101-Q103 VanDerWaalsContact C-N 3.32Å; R101-Q103 PolarHBondContact O-N 3.5Å; R101-V104 PolarHBondContact O-N 3.46Å; R101-E105 WeakPolarHBondContact O-CG 3.37Å; R101-E105 PolarHBondContact O-N 3.33Å
102	R	98.7	Very high	98.6	Very high	147 Å²	147	96.2 Å²	96.2	56%	0.555	50%	0.499	S	S	*	.	H	α-helix	trans	-59.5	-42.5	175.6	-70	-172.3	-63.7	-90.8	6.1	112.1	L98 A99 G100 V104 E105 E106	L98-R102 WeakPolarHBondContact O-CG 3.37Å; L98-R102 PolarHBondContact O-N 2.84Å; L98-R102 VanDerWaalsContact O-N 3.15Å; L98-R102 PolarHBondContact O-NH1 3.35Å; A99-R102 PolarHBondContact O-N 3.29Å; G100-R102 PolarHBondContact O-N 3.37Å; R102-V104 VanDerWaalsContact C-N 3.33Å; R102-V104 PolarHBondContact O-N 3.32Å; R102-E105 PolarHBondContact O-N 2.93Å; R102-E106 PolarHBondContact O-N 3.12Å
103	Q	98.6	Very high	98.5	Very high	122 Å²	122	92.3 Å²	92.3	57%	0.57	49%	0.49	S	S	*	.	H	α-helix	trans	-64	-39.7	178.2	-171	175.6	21.3	0	0	112	A99 G100 R101 E106 L107	A99-Q103 PolarHBondContact O-N 3.04Å; A99-Q103 VanDerWaalsContact O-N 3.1Å; G100-Q103 PolarHBondContact O-N 2.67Å; R101-Q103 VanDerWaalsContact C-N 3.32Å; R101-Q103 PolarHBondContact O-N 3.5Å; Q103-E106 PolarHBondContact O-N 3.45Å; Q103-L107 HydrophobicContact CG-CD1 4.27Å; Q103-L107 WeakPolarHBondContact O-CB 3.24Å; Q103-L107 VanDerWaalsContact O-CG 3.29Å; Q103-L107 WeakPolarHBondContact O-CG 3.39Å; Q103-L107 PolarHBondContact O-N 3.1Å
104	V	98.8	Very high	98.4	Very high	77 Å²	77	92.9 Å²	92.9	47%	0.467	49%	0.49	S	S	.	.	H	α-helix	trans	-64.3	-43.5	175.6	171.6	0	0	0	0	111	G100 R101 R102 E106 L107 Q108	G100-V104 WeakPolarHBondContact O-CG2 3.36Å; G100-V104 PolarHBondContact O-N 3.08Å; R101-V104 PolarHBondContact O-N 3.46Å; R102-V104 VanDerWaalsContact C-N 3.33Å; R102-V104 PolarHBondContact O-N 3.32Å; V104-E106 PolarHBondContact O-N 3.24Å; V104-L107 PolarHBondContact O-N 3.44Å; V104-Q108 HydrophobicContact CG1-CG 4.41Å; V104-Q108 WeakPolarHBondContact O-CB 3.25Å; V104-Q108 VanDerWaalsContact O-CG 3.3Å; V104-Q108 WeakPolarHBondContact O-CG 2.88Å; V104-Q108 PolarHBondContact O-N 2.93Å
105	E	98.7	Very high	98.2	Very high	118 Å²	118	96.5 Å²	96.5	55%	0.551	50%	0.499	S	S	*	.	H	α-helix	trans	-59.4	-45.3	176.1	-72.6	168.7	-173	0	0	111.6	R101 R102 Q108 L109	R101-E105 WeakPolarHBondContact O-CG 3.37Å; R101-E105 PolarHBondContact O-N 3.33Å; R102-E105 PolarHBondContact O-N 2.93Å; E105-Q108 WeakPolarHBondContact O-CB 3.44Å; E105-Q108 PolarHBondContact O-N 3.01Å; E105-L109 WeakPolarHBondContact O-CG 3.29Å; E105-L109 PolarHBondContact O-N 3.46Å
106	E	98.6	Very high	98	Very high	113 Å²	113	97.7 Å²	97.7	53%	0.528	50%	0.503	S	S	.	.	H	α-helix	trans	-61.6	-46.4	176.7	-174.3	-178.4	173.8	0	0	111.9	R102 Q103 V104 Q108 L109 Q110	R102-E106 PolarHBondContact O-N 3.12Å; Q103-E106 PolarHBondContact O-N 3.45Å; V104-E106 PolarHBondContact O-N 3.24Å; E106-Q108 VanDerWaalsContact C-N 3.3Å; E106-Q108 PolarHBondContact O-N 2.85Å; E106-L109 WeakPolarHBondContact O-CB 3.34Å; E106-L109 PolarHBondContact O-N 3.38Å; E106-Q110 WeakPolarHBondContact O-CG 3.33Å; E106-Q110 PolarHBondContact O-N 2.87Å; E106-Q110 PolarHBondContact OE1-NE2 3.13Å
107	L	98.6	Very high	97.7	Very high	83 Å²	83	97.7 Å²	97.7	44%	0.435	50%	0.503	S	S	.	.	H	α-helix	trans	-62.2	-38.8	177.6	-73.7	172.2	0	0	0	111.7	Q103 V104 L109 Q110 V111	Q103-L107 HydrophobicContact CG-CD1 4.27Å; Q103-L107 WeakPolarHBondContact O-CB 3.24Å; Q103-L107 VanDerWaalsContact O-CG 3.29Å; Q103-L107 WeakPolarHBondContact O-CG 3.39Å; Q103-L107 PolarHBondContact O-N 3.1Å; V104-L107 PolarHBondContact O-N 3.44Å; L107-L109 VanDerWaalsContact C-N 3.34Å; L107-L109 PolarHBondContact O-N 3.39Å; L107-Q110 PolarHBondContact O-N 2.89Å; L107-V111 WeakPolarHBondContact O-CB 3.21Å; L107-V111 VanDerWaalsContact O-CG2 3.3Å; L107-V111 WeakPolarHBondContact O-CG2 3.32Å; L107-V111 PolarHBondContact O-N 3.23Å
108	Q	98.4	Very high	97.4	Very high	127 Å²	127	101.4 Å²	101.4	59%	0.593	51%	0.509	S	S	*	.	H	α-helix	trans	-60.5	-43.9	174.8	-76.3	179.6	11.6	0	0	111.6	V104 E105 E106 V111 Q112	V104-Q108 HydrophobicContact CG1-CG 4.41Å; V104-Q108 WeakPolarHBondContact O-CB 3.25Å; V104-Q108 VanDerWaalsContact O-CG 3.3Å; V104-Q108 WeakPolarHBondContact O-CG 2.88Å; V104-Q108 PolarHBondContact O-N 2.93Å; E105-Q108 WeakPolarHBondContact O-CB 3.44Å; E105-Q108 PolarHBondContact O-N 3.01Å; E106-Q108 VanDerWaalsContact C-N 3.3Å; E106-Q108 PolarHBondContact O-N 2.85Å; Q108-V111 PolarHBondContact O-N 3.26Å; Q108-Q112 WeakPolarHBondContact O-CB 3.24Å; Q108-Q112 PolarHBondContact O-N 2.8Å
109	L	98.2	Very high	96.9	Very high	113 Å²	113	101.5 Å²	101.5	59%	0.592	51%	0.506	S	S	*	.	H	α-helix	trans	-63.1	-43	175.9	-68.5	173	0	0	0	111.8	E105 E106 L107 Q112 A113	E105-L109 WeakPolarHBondContact O-CG 3.29Å; E105-L109 PolarHBondContact O-N 3.46Å; E106-L109 WeakPolarHBondContact O-CB 3.34Å; E106-L109 PolarHBondContact O-N 3.38Å; L107-L109 VanDerWaalsContact C-N 3.34Å; L107-L109 PolarHBondContact O-N 3.39Å; L109-Q112 PolarHBondContact O-N 3.32Å; L109-A113 WeakPolarHBondContact O-CB 3.48Å; L109-A113 PolarHBondContact O-N 3.07Å
110	Q	98.3	Very high	96.3	Very high	94 Å²	94	105.4 Å²	105.4	44%	0.439	53%	0.526	S	S	.	.	H	α-helix	trans	-62.4	-46.5	177.2	-70.6	-179.5	12.4	0	0	111.9	E106 L107 Q112 A113 Q114	E106-Q110 WeakPolarHBondContact O-CG 3.33Å; E106-Q110 PolarHBondContact O-N 2.87Å; E106-Q110 PolarHBondContact OE1-NE2 3.13Å; L107-Q110 PolarHBondContact O-N 2.89Å; Q110-Q112 VanDerWaalsContact C-N 3.32Å; Q110-Q112 PolarHBondContact O-N 3.47Å; Q110-A113 PolarHBondContact O-N 3.42Å; Q110-Q114 WeakPolarHBondContact O-CG 3.39Å; Q110-Q114 PolarHBondContact O-N 2.81Å
111	V	97.8	Very high	95.4	Very high	100 Å²	100	113.2 Å²	113.2	61%	0.606	55%	0.546	S	S	*	.	H	α-helix	trans	-60	-45	176.9	168.4	0	0	0	0	110.5	L107 Q108 Q114 Q115	L107-V111 WeakPolarHBondContact O-CB 3.21Å; L107-V111 VanDerWaalsContact O-CG2 3.3Å; L107-V111 WeakPolarHBondContact O-CG2 3.32Å; L107-V111 PolarHBondContact O-N 3.23Å; Q108-V111 PolarHBondContact O-N 3.26Å; V111-Q114 PolarHBondContact O-N 3.46Å; V111-Q115 WeakPolarHBondContact O-CB 3.48Å; V111-Q115 PolarHBondContact O-N 3.3Å
112	Q	97.7	Very high	93.7	Very high	100 Å²	100	108.5 Å²	108.5	47%	0.467	54%	0.538	S	S	.	.	H	α-helix	trans	-63.6	-45.5	178.4	-171.7	175.9	39.1	0	0	111.8	Q108 L109 Q110 Q114 Q115 Q116	Q108-Q112 WeakPolarHBondContact O-CB 3.24Å; Q108-Q112 PolarHBondContact O-N 2.8Å; L109-Q112 PolarHBondContact O-N 3.32Å; Q110-Q112 VanDerWaalsContact C-N 3.32Å; Q110-Q112 PolarHBondContact O-N 3.47Å; Q112-Q114 PolarHBondContact O-N 2.93Å; Q112-Q115 PolarHBondContact O-N 3.21Å; Q112-Q116 WeakPolarHBondContact O-CG 3.28Å; Q112-Q116 PolarHBondContact O-N 3.17Å
113	A	96.1	Very high	91.8	Very high	55 Å²	55	106.1 Å²	106.1	46%	0.455	54%	0.541	S	S	.	.	H	α-helix	trans	-61.5	-43.9	178	0	0	0	0	0	111.7	L109 Q110 Q116 A117	L109-A113 WeakPolarHBondContact O-CB 3.48Å; L109-A113 PolarHBondContact O-N 3.07Å; Q110-A113 PolarHBondContact O-N 3.42Å; A113-Q116 PolarHBondContact O-N 2.88Å; A113-A117 WeakPolarHBondContact O-CB 3.47Å; A113-A117 PolarHBondContact O-N 2.8Å
114	Q	96.9	Very high	89.7	Confident	122 Å²	122	105 Å²	105	57%	0.57	55%	0.553	S	S	*	*	H	α-helix	trans	-60.8	-47.9	173.4	-75	-152	30.9	0	0	111.1	Q110 V111 Q112 Q116 A117 W118	Q110-Q114 WeakPolarHBondContact O-CG 3.39Å; Q110-Q114 PolarHBondContact O-N 2.81Å; V111-Q114 PolarHBondContact O-N 3.46Å; Q112-Q114 PolarHBondContact O-N 2.93Å; Q114-Q116 VanDerWaalsContact C-N 3.28Å; Q114-Q116 PolarHBondContact O-N 3.25Å; Q114-A117 WeakPolarHBondContact O-CB 3.49Å; Q114-A117 PolarHBondContact O-N 3.37Å; Q114-A117 VanDerWaalsContact O-N 3.11Å; Q114-W118 PolarHBondContact O-N 3.44Å
115	Q	95.8	Very high	87.6	Confident	118 Å²	118	107.5 Å²	107.5	55%	0.551	57%	0.568	S	S	*	*	H	α-helix	trans	-58	-42.5	179.9	-168.4	-178	38.3	0	0	111.8	V111 Q112 W118 Q119	V111-Q115 WeakPolarHBondContact O-CB 3.48Å; V111-Q115 PolarHBondContact O-N 3.3Å; Q112-Q115 PolarHBondContact O-N 3.21Å; Q115-W118 PolarHBondContact O-N 2.87Å; Q115-Q119 WeakPolarHBondContact O-CG 3.03Å; Q115-Q119 PolarHBondContact O-N 3Å
116	Q	93.4	Very high	85.4	Confident	107 Å²	107	107.6 Å²	107.6	50%	0.5	57%	0.568	S	S	.	*	H	α-helix	trans	-63.4	-46.1	174.8	-69.9	174.9	9.6	0	0	111.6	Q112 A113 Q114 W118 Q119 V120	Q112-Q116 WeakPolarHBondContact O-CG 3.28Å; Q112-Q116 PolarHBondContact O-N 3.17Å; A113-Q116 PolarHBondContact O-N 2.88Å; Q114-Q116 VanDerWaalsContact C-N 3.28Å; Q114-Q116 PolarHBondContact O-N 3.25Å; Q116-W118 VanDerWaalsContact C-N 3.29Å; Q116-W118 PolarHBondContact O-N 2.81Å; Q116-Q119 PolarHBondContact O-N 3.11Å; Q116-Q119 VanDerWaalsContact O-N 3.13Å; Q116-V120 WeakPolarHBondContact O-CG2 3.33Å; Q116-V120 PolarHBondContact O-N 2.79Å
117	A	93.2	Very high	82.8	Confident	61 Å²	61	106.8 Å²	106.8	50%	0.504	58%	0.575	S	S	.	*	H	α-helix	trans	-58.9	-40.9	177.3	0	0	0	0	0	112.2	A113 Q114 R121	A113-A117 WeakPolarHBondContact O-CB 3.47Å; A113-A117 PolarHBondContact O-N 2.8Å; Q114-A117 WeakPolarHBondContact O-CB 3.49Å; Q114-A117 PolarHBondContact O-N 3.37Å; Q114-A117 VanDerWaalsContact O-N 3.11Å; A117-R121 WeakPolarHBondContact O-CB 3.35Å; A117-R121 PolarHBondContact O-N 3.08Å
118	W	92.3	Very high	80.3	Confident	153 Å²	153	108.3 Å²	108.3	58%	0.58	59%	0.59	S	S	*	*	H	α-helix	trans	-65.2	-41.8	174.3	-79.8	104.9	0	0	0	112.5	Q114 Q115 Q116 R121 S122	Q114-W118 PolarHBondContact O-N 3.44Å; Q115-W118 PolarHBondContact O-N 2.87Å; Q116-W118 VanDerWaalsContact C-N 3.29Å; Q116-W118 PolarHBondContact O-N 2.81Å; W118-R121 PolarHBondContact O-N 3.41Å; W118-S122 PolarHBondContact O-N 3.44Å
119	Q	87.9	Confident	77.8	Confident	94 Å²	94	106 Å²	106	44%	0.439	59%	0.592	S	S	.	*	H	α-helix	trans	-65.2	-39	177.4	-76.5	-175.4	68.2	0	0	112.9	Q115 Q116 R121 S122 Q126	Q115-Q119 WeakPolarHBondContact O-CG 3.03Å; Q115-Q119 PolarHBondContact O-N 3Å; Q116-Q119 PolarHBondContact O-N 3.11Å; Q116-Q119 VanDerWaalsContact O-N 3.13Å; Q119-R121 VanDerWaalsContact C-N 3.34Å; Q119-S122 CarbonylContact O-C 3.54Å; Q119-Q126 PolarHBondContact O-NE2 3.06Å
120	V	87.1	Confident	75.5	Confident	122 Å²	122	109.5 Å²	109.5	74%	0.739	60%	0.603	S	S	*	*	H	α-helix	trans	-67	-37.4	175.7	174.6	0	0	0	0	111	Q116	Q116-V120 WeakPolarHBondContact O-CG2 3.33Å; Q116-V120 PolarHBondContact O-N 2.79Å
121	R	79.8	Confident	73.7	Confident	193 Å²	193	111.3 Å²	111.3	73%	0.728	62%	0.62	S	S	*	*	H	α-helix	trans	-75.2	-27.6	-179.8	-169.9	176.2	-179.2	-149.4	0.5	113.7	A117 W118 Q119 P123	A117-R121 WeakPolarHBondContact O-CB 3.35Å; A117-R121 PolarHBondContact O-N 3.08Å; W118-R121 PolarHBondContact O-N 3.41Å; Q119-R121 VanDerWaalsContact C-N 3.34Å; R121-P123 VanDerWaalsContact C-CD 3.49Å; R121-P123 WeakPolarHBondContact O-CD 3.46Å
122	S	63.6	Low	71.6	Confident	60 Å²	60	113.8 Å²	113.8	42%	0.42	63%	0.625	S	S	.	*			trans	-118.9	75.1	179.3	-72.9	0	0	0	0	112.2	W118 Q119 A124	W118-S122 PolarHBondContact O-N 3.44Å; Q119-S122 CarbonylContact O-C 3.54Å; S122-A124 PolarHBondContact O-N 2.92Å
123	P	58.1	Low	69.5	Low	96 Å²	96	114.3 Å²	114.3	62%	0.623	64%	0.637	S	S	*	*	G	3₁₀ helix	trans	-69.3	-14.8	177.7	27.7	-34.1	0	0	0	113.6	R121 V125 Q126	R121-P123 VanDerWaalsContact C-CD 3.49Å; R121-P123 WeakPolarHBondContact O-CD 3.46Å; P123-V125 PolarHBondContact O-N 2.89Å; P123-Q126 PolarHBondContact O-N 3.12Å
124	A	53.4	Low	67.5	Low	99 Å²	99	119.8 Å²	119.8	82%	0.818	66%	0.658	S	S	*	*	G	3₁₀ helix	trans	-72.9	-8.4	-175.8	0	0	0	0	0	114.9	S122	S122-A124 PolarHBondContact O-N 2.92Å
125	V	56.2	Low	65.2	Low	130 Å²	130	119.1 Å²	119.1	79%	0.788	67%	0.665	S	S	*	*	G	3₁₀ helix	trans	-108.8	24.3	178.8	-173.2	0	0	0	0	111.3	P123	P123-V125 PolarHBondContact O-N 2.89Å
126	Q	52.6	Low	63.2	Low	119 Å²	119	119.4 Å²	119.4	56%	0.556	68%	0.678	S	S	*	*			trans	-108	2.8	179.4	-67.3	-170.7	33.4	0	0	115.1	Q119 P123 P128	Q119-Q126 PolarHBondContact O-NE2 3.06Å; P123-Q126 PolarHBondContact O-N 3.12Å; Q126-P128 WeakPolarHBondContact O-CD 3.45Å
127	S	43.5	Very low	61.4	Low	96 Å²	96	120 Å²	120	67%	0.671	69%	0.694	S	S	*	*			trans	-98.4	111.8	166.4	-170.8	0	0	0	0	109.4	A129	S127-A129 PolarHBondContact O-N 2.98Å
128	P	46.2	Very low	59.4	Low	116 Å²	116	129 Å²	129	75%	0.753	72%	0.715	S	S	*	*			trans	-66.8	92.1	152.7	29.3	-28	0	0	0	104.7	Q126 K130	Q126-P128 WeakPolarHBondContact O-CD 3.45Å; P128-K130 VanDerWaalsContact C-N 3.28Å; P128-K130 PolarHBondContact O-N 3.29Å
129	A	46.4	Very low	57.4	Low	77 Å²	77	133.1 Å²	133.1	64%	0.636	73%	0.73	S	S	*	*			trans	-50.8	106.4	163.7	0	0	0	0	0	105.4	S127 V131	S127-A129 PolarHBondContact O-N 2.98Å; A129-V131 VanDerWaalsContact C-N 3.26Å; A129-V131 PolarHBondContact O-N 2.94Å
130	K	50.2	Low	55.7	Low	187 Å²	187	133.3 Å²	133.3	81%	0.813	75%	0.747	S	S	*	*			trans	-57.2	98.4	175.7	-167.3	174.6	-171	178.3	0	104.6	P128 Q132	P128-K130 VanDerWaalsContact C-N 3.28Å; P128-K130 PolarHBondContact O-N 3.29Å; K130-Q132 PolarHBondContact O-N 2.87Å
131	V	58.7	Low	54.2	Low	133 Å²	133	132.1 Å²	132.1	81%	0.806	75%	0.75	S	S	*	*			trans	-64.2	92.5	175.6	179.4	0	0	0	0	104.9	A129 P133	A129-V131 VanDerWaalsContact C-N 3.26Å; A129-V131 PolarHBondContact O-N 2.94Å; V131-P133 WeakPolarHBondContact O-CD 3.38Å
132	Q	54.8	Low	53	Low	152 Å²	152	138.1 Å²	138.1	71%	0.71	77%	0.773	S	S	*	*			trans	-63.7	123.8	169.9	-73.3	-177.7	18.2	0	0	105.7	K130 L134	K130-Q132 PolarHBondContact O-N 2.87Å; Q132-L134 PolarHBondContact O-N 3.01Å
133	P	52.7	Low	52.5	Low	110 Å²	110	142.1 Å²	142.1	71%	0.714	79%	0.791	S	S	*	*			trans	-63.8	112.7	172.2	25	-28.4	0	0	0	106.8	V131 C135	V131-P133 WeakPolarHBondContact O-CD 3.38Å; P133-C135 VanDerWaalsContact C-N 3.31Å; P133-C135 PolarHBondContact O-N 2.88Å
134	L	54	Low	52.2	Low	170 Å²	170	144.5 Å²	144.5	89%	0.89	80%	0.8	S	S	*	*			trans	-63	96.9	167.8	-113	90.1	0	0	0	107	Q132 P136	Q132-L134 PolarHBondContact O-N 3.01Å; L134-P136 VanDerWaalsContact O-CD 3.29Å; L134-P136 WeakPolarHBondContact O-CD 3.49Å
135	C	49.6	Very low	52.1	Low	108 Å²	108	147 Å²	147	73%	0.73	80%	0.799	S	S	*	*	P	Polyproline II helix	trans	-66.8	117.9	167	-70.6	0	0	0	0	107.9	P133 S137	P133-C135 VanDerWaalsContact C-N 3.31Å; P133-C135 PolarHBondContact O-N 2.88Å; C135-S137 PolarHBondContact O-N 3.08Å; C135-S137 VanDerWaalsContact O-N 3.15Å
136	P	54	Low	51.9	Low	125 Å²	125	148 Å²	148	81%	0.812	80%	0.799	S	S	*	*	P	Polyproline II helix	trans	-68.6	116.9	174.1	26.8	-30.3	0	0	0	108.4	L134 R138	L134-P136 VanDerWaalsContact O-CD 3.29Å; L134-P136 WeakPolarHBondContact O-CD 3.49Å; P136-R138 PolarHBondContact O-N 3.35Å; P136-R138 VanDerWaalsContact O-N 3.07Å
137	S	54.5	Low	51.8	Low	119 Å²	119	149.8 Å²	149.8	83%	0.832	82%	0.815	S	S	*	*	P	Polyproline II helix	trans	-53.6	116.6	173.3	-59.8	0	0	0	0	109.5	C135 R139	C135-S137 PolarHBondContact O-N 3.08Å; C135-S137 VanDerWaalsContact O-N 3.15Å; S137-R139 PolarHBondContact O-N 3.36Å
138	R	51.7	Low	52.4	Low	251 Å²	251	153.4 Å²	153.4	95%	0.947	82%	0.824	S	S	*	*			trans	-59.4	106.3	174.1	-141.9	178.4	-145.3	-134.9	4.3	107.7	P136 A140	P136-R138 PolarHBondContact O-N 3.35Å; P136-R138 VanDerWaalsContact O-N 3.07Å; R138-A140 PolarHBondContact O-N 3.36Å
139	R	51.3	Low	52.8	Low	238 Å²	238	156.1 Å²	156.1	90%	0.898	83%	0.829	S	S	*	*			trans	-67.7	103.6	174.7	-163.2	180	-68.4	-134.1	1.6	107.2	S137 A141	S137-R139 PolarHBondContact O-N 3.36Å; R139-A141 PolarHBondContact O-N 3.16Å; R139-A141 VanDerWaalsContact O-N 3.16Å
140	A	50.7	Low	53.3	Low	98 Å²	98	162.2 Å²	162.2	81%	0.81	84%	0.844	S	S	*	*			trans	-65.9	108.9	170.1	0	0	0	0	0	108.1	R138	R138-A140 PolarHBondContact O-N 3.36Å
141	A	55.5	Low	53.6	Low	97 Å²	97	160.1 Å²	160.1	80%	0.802	85%	0.847	S	S	*	*			trans	-78.1	133.5	165.7	0	0	0	0	0	108.2	R139	R139-A141 PolarHBondContact O-N 3.16Å; R139-A141 VanDerWaalsContact O-N 3.16Å
142	R	55.7	Low	53.1	Low	320 Å²	320	162.5 Å²	162.5	100%	1.208	85%	0.85	S	S	*	*			trans	-64.1	0	173.5	-82.9	175.2	168.5	-119.3	0.4	112

Retrieved 142 of 142 residues in 91.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).