A0A087WT92_HUMAN Loading...

Ragulator complex protein LAMTOR4

As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator plays a dual role for the small GTPases Rag (RagA/RRAGA, RagB/RRAGB, RagC/RRAGC and/or RagD/RRAGD): it (1) acts as a guanine nucleotide exchange factor (GEF), activating the small GTPases Rag and (2) mediates recruitment of Rag GTPases to the lysosome membrane. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated.

AlphaFold DB , UniProt , Accession A0A087WT92, Species HUMAN (Homo sapiens, Human), Gene LAMTOR4, Length 72 aa.

						>A0A087WT92_HUMAN|A0A087WT92|LAMTOR4
MSSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46.7	Very low	69.5	Low	246 Å²	246	116.7 Å²	116.7	100%	1.212	64%	0.635	S	S	*	*				0	114.2	0	-68.8	171.5	171.4	0	0	106.1
2	S	59.4	Low	70.8	Confident	79 Å²	79	109 Å²	109	55%	0.552	60%	0.599	S	S	*	*			trans	-77.2	142.9	171.8	-170.4	0	0	0	0	108.1	L6	S2-L6 PolarHBondContact OG-O 2.71Å; S2-L6 VanDerWaalsContact OG-O 3.11Å
3	S	62.9	Low	72.1	Confident	102 Å²	102	104.7 Å²	104.7	71%	0.713	59%	0.587	S	S	*	*			trans	-155.6	147.5	179.7	-174.6	0	0	0	0	110.3
4	G	69.5	Low	73.4	Confident	46 Å²	46	101.8 Å²	101.8	47%	0.474	58%	0.577	S	S	.	*	S	Bend	trans	103	-158.6	179.8	0	0	0	0	0	113.5	L6 E7	G4-L6 PolarHBondContact O-N 3.24Å; G4-E7 WeakPolarHBondContact O-CB 3.46Å; G4-E7 PolarHBondContact O-N 3.09Å
5	D	63.7	Low	74.6	Confident	126 Å²	126	98.7 Å²	98.7	67%	0.674	57%	0.569	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.1	-13	178	-88.6	16.2	0	0	0	115.1	K61	D5-K61 HydrophobicContact CB-CD 3.86Å; D5-K61 IonicContact OD2-NZ 2.81Å; D5-K61 PolarHBondContact OD2-NZ 2.97Å
6	L	68.9	Low	75.7	Confident	37 Å²	37	93.8 Å²	93.8	19%	0.194	54%	0.54	C	S	.	.	T	Hydrogen-bonded Turn	trans	-110.2	13.8	-178.6	-59.8	174.3	0	0	0	111.9	S2 G4 N8 V59 K61	S2-L6 PolarHBondContact OG-O 2.71Å; S2-L6 VanDerWaalsContact OG-O 3.11Å; G4-L6 PolarHBondContact O-N 3.24Å; L6-N8 PolarHBondContact O-N 3.5Å; L6-V59 HydrophobicContact CD1-CB 4.1Å; L6-V59 HydrophobicContact CD1-CG1 3.53Å; L6-K61 HydrophobicContact CD1-CB 4.32Å
7	E	70.1	Confident	76.5	Confident	125 Å²	125	91.9 Å²	91.9	58%	0.584	53%	0.534	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.8	124.5	178.7	-169.3	168.5	168.5	0	0	110.1	G4 D9	G4-E7 WeakPolarHBondContact O-CB 3.46Å; G4-E7 PolarHBondContact O-N 3.09Å; E7-D9 PolarHBondContact O-N 3.1Å; E7-D9 VanDerWaalsContact O-N 3.15Å
8	N	70.3	Confident	77.4	Confident	137 Å²	137	94.1 Å²	94.1	73%	0.733	54%	0.538	S	S	*	.	T	Hydrogen-bonded Turn	trans	60.8	17	177.3	-150.5	35.3	0	0	0	116.7	L6 E10	L6-N8 PolarHBondContact O-N 3.5Å; N8-E10 PolarHBondContact O-N 3.27Å; N8-E10 VanDerWaalsContact O-N 3.13Å
9	D	83.5	Confident	78.2	Confident	72 Å²	72	93 Å²	93	39%	0.385	53%	0.53	S	S	.	.			trans	-84.1	80.4	170.8	-168.1	-17.8	0	0	0	110.3	E7 Q11 A12 A13	E7-D9 PolarHBondContact O-N 3.1Å; E7-D9 VanDerWaalsContact O-N 3.15Å; D9-Q11 PolarHBondContact O-N 3.39Å; D9-Q11 PolarHBondContact OD1-N 3.27Å; D9-A12 HydrophobicContact CB-CB 4.02Å; D9-A12 PolarHBondContact O-N 3.1Å; D9-A12 WeakPolarHBondContact OD1-CB 3.25Å; D9-A12 PolarHBondContact OD1-N 3.27Å; D9-A12 WeakPolarHBondContact OD2-CB 3.17Å; D9-A13 WeakPolarHBondContact O-CB 3.06Å; D9-A13 PolarHBondContact O-N 2.79Å
10	E	83.5	Confident	78.8	Confident	152 Å²	152	88.9 Å²	88.9	71%	0.71	51%	0.506	S	S	*	.	H	α-helix	trans	-60.5	-31.8	177.6	-72.2	-176.1	172.1	0	0	112.3	N8 A13 S14	N8-E10 PolarHBondContact O-N 3.27Å; N8-E10 VanDerWaalsContact O-N 3.13Å; E10-A13 PolarHBondContact O-N 3.29Å; E10-S14 WeakPolarHBondContact O-CB 3.29Å; E10-S14 PolarHBondContact O-N 3.48Å
11	Q	85.8	Confident	79.3	Confident	162 Å²	162	88.7 Å²	88.7	76%	0.757	51%	0.511	S	S	*	.	H	α-helix	trans	-68.6	-46.7	179.9	-169.8	175	26.4	0	0	110.8	D9 S14 A15	D9-Q11 PolarHBondContact O-N 3.39Å; D9-Q11 PolarHBondContact OD1-N 3.27Å; Q11-S14 PolarHBondContact O-N 2.9Å; Q11-A15 WeakPolarHBondContact O-CB 3.41Å; Q11-A15 PolarHBondContact O-N 3.21Å
12	A	85.9	Confident	81.3	Confident	24 Å²	24	82 Å²	82	20%	0.198	48%	0.484	C	S	.	.	H	α-helix	trans	-63.8	-41.4	173.9	0	0	0	0	0	111.5	D9 S14 A15 I16	D9-A12 HydrophobicContact CB-CB 4.02Å; D9-A12 PolarHBondContact O-N 3.1Å; D9-A12 WeakPolarHBondContact OD1-CB 3.25Å; D9-A12 PolarHBondContact OD1-N 3.27Å; D9-A12 WeakPolarHBondContact OD2-CB 3.17Å; A12-S14 VanDerWaalsContact C-N 3.31Å; A12-S14 PolarHBondContact O-N 3Å; A12-A15 PolarHBondContact O-N 3.47Å; A12-I16 WeakPolarHBondContact O-CB 3.28Å; A12-I16 WeakPolarHBondContact O-CG1 3.31Å; A12-I16 PolarHBondContact O-N 3.33Å
13	A	87.2	Confident	82.7	Confident	53 Å²	53	79.3 Å²	79.3	44%	0.438	47%	0.466	S	S	.	.	H	α-helix	trans	-59.9	-42.3	176.9	0	0	0	0	0	111.9	D9 E10 S17	D9-A13 WeakPolarHBondContact O-CB 3.06Å; D9-A13 PolarHBondContact O-N 2.79Å; E10-A13 PolarHBondContact O-N 3.29Å; A13-S17 WeakPolarHBondContact O-CB 3.05Å; A13-S17 PolarHBondContact O-N 2.9Å; A13-S17 PolarHBondContact O-OG 3.43Å
14	S	90.3	Very high	83.6	Confident	64 Å²	64	77 Å²	77	45%	0.448	45%	0.449	S	S	.	.	H	α-helix	trans	-63.3	-52.3	175.7	-172.2	0	0	0	0	111.5	E10 Q11 A12 I16 S17 E18	E10-S14 WeakPolarHBondContact O-CB 3.29Å; E10-S14 PolarHBondContact O-N 3.48Å; Q11-S14 PolarHBondContact O-N 2.9Å; A12-S14 VanDerWaalsContact C-N 3.31Å; A12-S14 PolarHBondContact O-N 3Å; S14-I16 VanDerWaalsContact C-N 3.33Å; S14-I16 PolarHBondContact O-N 2.98Å; S14-S17 WeakPolarHBondContact O-CB 3.29Å; S14-S17 PolarHBondContact O-N 2.83Å; S14-E18 PolarHBondContact O-N 2.84Å
15	A	91.7	Very high	84.1	Confident	56 Å²	56	77.4 Å²	77.4	46%	0.463	45%	0.454	S	S	.	.	H	α-helix	trans	-60.2	-41.1	-179.4	0	0	0	0	0	112.6	Q11 A12 S17 L19	Q11-A15 WeakPolarHBondContact O-CB 3.41Å; Q11-A15 PolarHBondContact O-N 3.21Å; A12-A15 PolarHBondContact O-N 3.47Å; A15-S17 VanDerWaalsContact C-N 3.34Å; A15-L19 VanDerWaalsContact O-CB 3.25Å; A15-L19 WeakPolarHBondContact O-CB 3.42Å; A15-L19 PolarHBondContact O-N 2.97Å
16	I	91.6	Very high	84.8	Confident	19 Å²	19	77.5 Å²	77.5	10%	0.097	45%	0.448	C	S	.	.	H	α-helix	trans	-66	-39.9	176.1	-67.9	170.5	0	0	0	110.6	A12 S14 L19 V20 L48 V50 V57 V59	A12-I16 WeakPolarHBondContact O-CB 3.28Å; A12-I16 WeakPolarHBondContact O-CG1 3.31Å; A12-I16 PolarHBondContact O-N 3.33Å; S14-I16 VanDerWaalsContact C-N 3.33Å; S14-I16 PolarHBondContact O-N 2.98Å; I16-L19 PolarHBondContact O-N 3.07Å; I16-V20 HydrophobicContact CG2-CG2 4.25Å; I16-V20 WeakPolarHBondContact O-CB 3.28Å; I16-V20 VanDerWaalsContact O-CG2 3.28Å; I16-V20 WeakPolarHBondContact O-CG2 3.41Å; I16-V20 PolarHBondContact O-N 2.83Å; I16-L48 HydrophobicContact CD1-CD1 4.3Å; I16-V50 HydrophobicContact CG2-CG1 4.05Å; I16-V50 HydrophobicContact CG2-CG2 4.08Å; I16-V57 HydrophobicContact CG2-CG1 4.31Å; I16-V59 HydrophobicContact CD1-CB 4.43Å; I16-V59 HydrophobicContact CD1-CG1 3.71Å; I16-V59 HydrophobicContact CD1-CG2 3.95Å; I16-V59 HydrophobicContact CG2-CG2 3.86Å
17	S	90.4	Very high	84.7	Confident	63 Å²	63	86.3 Å²	86.3	44%	0.441	48%	0.479	S	S	.	.	H	α-helix	trans	-64.7	-43.4	179.6	-62.1	0	0	0	0	111.8	A13 S14 A15 V20 S21	A13-S17 WeakPolarHBondContact O-CB 3.05Å; A13-S17 PolarHBondContact O-N 2.9Å; A13-S17 PolarHBondContact O-OG 3.43Å; S14-S17 WeakPolarHBondContact O-CB 3.29Å; S14-S17 PolarHBondContact O-N 2.83Å; A15-S17 VanDerWaalsContact C-N 3.34Å; S17-V20 PolarHBondContact O-N 3.06Å; S17-S21 WeakPolarHBondContact O-CB 3.32Å; S17-S21 PolarHBondContact O-N 3.23Å
18	E	92.6	Very high	84.6	Confident	131 Å²	131	86 Å²	86	61%	0.612	48%	0.481	S	S	*	.	H	α-helix	trans	-62.6	-42.6	173.6	-74.1	-174.6	169.3	0	0	112.1	S14 S21 T22	S14-E18 PolarHBondContact O-N 2.84Å; E18-S21 PolarHBondContact O-N 2.84Å; E18-T22 WeakPolarHBondContact O-CB 3.25Å; E18-T22 PolarHBondContact O-N 3.32Å; E18-T22 PolarHBondContact O-OG1 2.93Å
19	L	92	Very high	84.4	Confident	73 Å²	73	88.8 Å²	88.8	38%	0.382	49%	0.489	S	S	.	.	H	α-helix	trans	-64.9	-42.4	179	-175.6	141.3	0	0	0	111.7	A15 I16 T22 A23 L39 V41	A15-L19 VanDerWaalsContact O-CB 3.25Å; A15-L19 WeakPolarHBondContact O-CB 3.42Å; A15-L19 PolarHBondContact O-N 2.97Å; I16-L19 PolarHBondContact O-N 3.07Å; L19-T22 PolarHBondContact O-N 3.3Å; L19-A23 VanDerWaalsContact O-CB 3.29Å; L19-A23 WeakPolarHBondContact O-CB 3.35Å; L19-A23 PolarHBondContact O-N 3.44Å; L19-L39 HydrophobicContact CD2-CD1 3.38Å; L19-L39 HydrophobicContact CD2-CD2 3.32Å; L19-L39 HydrophobicContact CD2-CG 3.97Å; L19-V41 HydrophobicContact CD1-CG2 4.4Å; L19-V41 HydrophobicContact CD2-CG2 4.44Å
20	V	89.9	Confident	83.3	Confident	10 Å²	10	97.1 Å²	97.1	6%	0.061	52%	0.515	C	S	.	.	H	α-helix	trans	-63.8	-44.7	173.4	167.1	0	0	0	0	111	I16 S17 T22 A23 C24 V50 V52 V57	I16-V20 HydrophobicContact CG2-CG2 4.25Å; I16-V20 WeakPolarHBondContact O-CB 3.28Å; I16-V20 VanDerWaalsContact O-CG2 3.28Å; I16-V20 WeakPolarHBondContact O-CG2 3.41Å; I16-V20 PolarHBondContact O-N 2.83Å; S17-V20 PolarHBondContact O-N 3.06Å; V20-T22 VanDerWaalsContact C-N 3.32Å; V20-T22 PolarHBondContact O-N 2.89Å; V20-A23 PolarHBondContact O-N 3.01Å; V20-C24 VanDerWaalsContact O-CB 3.29Å; V20-C24 WeakPolarHBondContact O-CB 3.5Å; V20-C24 PolarHBondContact O-N 2.85Å; V20-C24 PolarHBondContact O-SG 2.68Å; V20-V50 HydrophobicContact CG2-CG1 3.54Å; V20-V52 HydrophobicContact CG1-CG2 3.48Å; V20-V52 VanDerWaalsContact CG1-CG2 3.48Å; V20-V52 HydrophobicContact CG2-CG2 4.43Å; V20-V57 HydrophobicContact CG1-CG2 4.43Å; V20-V57 HydrophobicContact CG2-CG1 4.28Å
21	S	89.4	Confident	82.2	Confident	85 Å²	85	92.4 Å²	92.4	59%	0.594	51%	0.508	S	S	*	.	H	α-helix	trans	-58.1	-46.8	178	-175.5	0	0	0	0	111.1	S17 E18 C24 G25	S17-S21 WeakPolarHBondContact O-CB 3.32Å; S17-S21 PolarHBondContact O-N 3.23Å; E18-S21 PolarHBondContact O-N 2.84Å; S21-C24 PolarHBondContact O-N 2.79Å; S21-G25 PolarHBondContact O-N 3.19Å
22	T	89.9	Confident	80.9	Confident	107 Å²	107	94.3 Å²	94.3	66%	0.656	52%	0.519	S	S	*	.	H	α-helix	trans	-63.1	-46.3	177.4	-56.4	0	0	0	0	111.5	E18 L19 V20 C24 G25 F26	E18-T22 WeakPolarHBondContact O-CB 3.25Å; E18-T22 PolarHBondContact O-N 3.32Å; E18-T22 PolarHBondContact O-OG1 2.93Å; L19-T22 PolarHBondContact O-N 3.3Å; V20-T22 VanDerWaalsContact C-N 3.32Å; V20-T22 PolarHBondContact O-N 2.89Å; T22-C24 VanDerWaalsContact C-N 3.35Å; T22-C24 PolarHBondContact O-N 3.03Å; T22-G25 PolarHBondContact O-N 2.69Å; T22-F26 PolarHBondContact O-N 3.35Å
23	A	87.4	Confident	79.9	Confident	21 Å²	21	100.3 Å²	100.3	17%	0.174	55%	0.548	C	S	.	.	H	α-helix	trans	-65.4	-36.7	178	0	0	0	0	0	112.1	L19 V20 G25 F26 P35 F36 L39	L19-A23 VanDerWaalsContact O-CB 3.29Å; L19-A23 WeakPolarHBondContact O-CB 3.35Å; L19-A23 PolarHBondContact O-N 3.44Å; V20-A23 PolarHBondContact O-N 3.01Å; A23-G25 VanDerWaalsContact C-N 3.32Å; A23-F26 WeakPolarHBondContact O-CB 3.49Å; A23-F26 PolarHBondContact O-N 2.85Å; A23-F26 VanDerWaalsContact O-N 3.1Å; A23-P35 WeakPolarHBondContact O-CG 3.33Å; A23-F36 VanDerWaalsContact C-CE1 3.5Å; A23-F36 HydrophobicContact CB-CD1 4.11Å; A23-F36 HydrophobicContact CB-CE1 3.44Å; A23-F36 VanDerWaalsContact CB-CE1 3.44Å; A23-F36 HydrophobicContact CB-CZ 3.97Å; A23-L39 HydrophobicContact CB-CD1 3.65Å
24	C	82.3	Confident	78.8	Confident	53 Å²	53	102.6 Å²	102.6	36%	0.358	56%	0.556	S	S	.	*	H	α-helix	trans	-68.7	-32.6	176.9	-77.4	0	0	0	0	111.8	V20 S21 T22 F26	V20-C24 VanDerWaalsContact O-CB 3.29Å; V20-C24 WeakPolarHBondContact O-CB 3.5Å; V20-C24 PolarHBondContact O-N 2.85Å; V20-C24 PolarHBondContact O-SG 2.68Å; S21-C24 PolarHBondContact O-N 2.79Å; T22-C24 VanDerWaalsContact C-N 3.35Å; T22-C24 PolarHBondContact O-N 3.03Å; C24-F26 PolarHBondContact O-N 2.85Å
25	G	80	Confident	78	Confident	55 Å²	55	102 Å²	102	57%	0.567	55%	0.551	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.8	-13.2	170.5	0	0	0	0	0	113.8	S21 T22 A23 R27	S21-G25 PolarHBondContact O-N 3.19Å; T22-G25 PolarHBondContact O-N 2.69Å; A23-G25 VanDerWaalsContact C-N 3.32Å; G25-R27 PolarHBondContact O-N 2.84Å; G25-R27 VanDerWaalsContact O-N 3.1Å
26	F	79.4	Confident	77.5	Confident	129 Å²	129	101.2 Å²	101.2	57%	0.566	54%	0.537	S	S	*	.			trans	-68.4	107.9	179.3	-164.8	-98.9	0	0	0	110.5	T22 A23 C24 L28 P35	T22-F26 PolarHBondContact O-N 3.35Å; A23-F26 WeakPolarHBondContact O-CB 3.49Å; A23-F26 PolarHBondContact O-N 2.85Å; A23-F26 VanDerWaalsContact O-N 3.1Å; C24-F26 PolarHBondContact O-N 2.85Å; F26-L28 HydrophobicContact CE1-CD1 3.81Å; F26-L28 PolarHBondContact O-N 2.82Å; F26-P35 HydrophobicContact CB-CB 4.49Å; F26-P35 HydrophobicContact CB-CG 4.42Å; F26-P35 WeakPolarHBondContact O-CB 3.24Å; F26-P35 VanDerWaalsContact O-CG 3.25Å; F26-P35 WeakPolarHBondContact O-CG 3.49Å
27	R	66.1	Low	77.2	Confident	221 Å²	221	110.2 Å²	110.2	83%	0.834	58%	0.575	S	S	*	*			trans	-92.8	103.9	174.3	-67	-172.2	-179.8	-163.8	0.8	109.5	G25	G25-R27 PolarHBondContact O-N 2.84Å; G25-R27 VanDerWaalsContact O-N 3.1Å
28	L	67.7	Low	77.2	Confident	118 Å²	118	114.9 Å²	114.9	62%	0.618	58%	0.583	S	S	*	*			trans	-68	137.1	163.8	-154.3	78.7	0	0	0	107.7	F26 R30	F26-L28 HydrophobicContact CE1-CD1 3.81Å; F26-L28 PolarHBondContact O-N 2.82Å; L28-R30 PolarHBondContact O-N 2.87Å
29	H	65.4	Low	77.1	Confident	197 Å²	197	110 Å²	110	91%	0.912	56%	0.561	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.7	12.8	-168.5	-70.6	59.3	0	0	0	115.5
30	R	61.2	Low	77.2	Confident	246 Å²	246	109.3 Å²	109.3	93%	0.928	56%	0.562	S	S	*	*	T	Hydrogen-bonded Turn	trans	-133.5	32.8	-173.7	-80.4	-169.4	175.7	-170.5	-0	115.3	L28	L28-R30 PolarHBondContact O-N 2.87Å
31	G	60	Low	77.3	Confident	54 Å²	54	110.8 Å²	110.8	56%	0.557	57%	0.571	S	S	*	*			trans	150.3	164.2	159.1	0	0	0	0	0	116.7	N33	G31-N33 PolarHBondContact O-N 2.9Å
32	M	59.1	Low	77.4	Confident	201 Å²	201	111.8 Å²	111.8	99%	0.99	57%	0.573	S	S	*	*	S	Bend	trans	-76.3	9	178.7	-66.8	175.7	60.6	0	0	114.4
33	N	63.6	Low	77.3	Confident	151 Å²	151	111.3 Å²	111.3	81%	0.807	56%	0.562	S	S	*	*	S	Bend	trans	-82.8	153.4	-178.2	-98	-28.3	0	0	0	111.7	G31	G31-N33 PolarHBondContact O-N 2.9Å
34	V	65	Low	77.3	Confident	101 Å²	101	113.5 Å²	113.5	61%	0.612	59%	0.587	S	S	*	*			trans	-50.3	126.1	173.4	-178.5	0	0	0	0	108.8	F36	V34-F36 WeakPolarHBondContact CG1-O 3.31Å; V34-F36 PolarHBondContact O-N 3.02Å; V34-F36 VanDerWaalsContact O-N 3.09Å
35	P	73.6	Confident	77.6	Confident	51 Å²	51	118.2 Å²	118.2	33%	0.331	60%	0.604	S	S	.	*	S	Bend	trans	-68.1	-15	-166.8	20.7	-30.1	0	0	0	114.2	A23 F26	A23-P35 WeakPolarHBondContact O-CG 3.33Å; F26-P35 HydrophobicContact CB-CB 4.49Å; F26-P35 HydrophobicContact CB-CG 4.42Å; F26-P35 WeakPolarHBondContact O-CB 3.24Å; F26-P35 VanDerWaalsContact O-CG 3.25Å; F26-P35 WeakPolarHBondContact O-CG 3.49Å
36	F	80.3	Confident	78.1	Confident	40 Å²	40	118 Å²	118	18%	0.175	59%	0.588	C	S	.	*			trans	-146.9	144.7	-180	57.6	-86.8	0	0	0	112.1	A23 V34 L39 V52	A23-F36 VanDerWaalsContact C-CE1 3.5Å; A23-F36 HydrophobicContact CB-CD1 4.11Å; A23-F36 HydrophobicContact CB-CE1 3.44Å; A23-F36 VanDerWaalsContact CB-CE1 3.44Å; A23-F36 HydrophobicContact CB-CZ 3.97Å; V34-F36 WeakPolarHBondContact CG1-O 3.31Å; V34-F36 PolarHBondContact O-N 3.02Å; V34-F36 VanDerWaalsContact O-N 3.09Å; F36-L39 HydrophobicContact CD2-CB 4.05Å; F36-L39 HydrophobicContact CE2-CB 4.07Å; F36-V52 HydrophobicContact CE2-CG2 4.32Å
37	K	85.9	Confident	78.7	Confident	207 Å²	207	112.6 Å²	112.6	90%	0.9	57%	0.566	S	S	*	*	S	Bend	trans	-81.7	-28.3	167.4	-67.2	-177.2	178.9	179.9	0	112.1
38	R	89.9	Confident	79.9	Confident	162 Å²	162	103 Å²	103	61%	0.611	53%	0.531	S	S	*	.			trans	-155.8	138.1	-178.9	-177.2	173.3	67	-135.3	-1.3	109.3	T51	R38-T51 HydrophobicContact CB-CG2 4Å; R38-T51 HydrophobicContact CG-CG2 3.82Å
39	L	91.7	Very high	81.2	Confident	28 Å²	28	99.5 Å²	99.5	15%	0.147	51%	0.513	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.3	143.2	171	-176.7	148.6	0	0	0	108.7	L19 A23 F36 V41 V50	L19-L39 HydrophobicContact CD2-CD1 3.38Å; L19-L39 HydrophobicContact CD2-CD2 3.32Å; L19-L39 HydrophobicContact CD2-CG 3.97Å; A23-L39 HydrophobicContact CB-CD1 3.65Å; F36-L39 HydrophobicContact CD2-CB 4.05Å; F36-L39 HydrophobicContact CE2-CB 4.07Å; L39-V41 HydrophobicContact CD2-CG2 3.72Å; L39-V50 HydrophobicContact CB-CB 4.25Å; L39-V50 HydrophobicContact CD2-CB 4.18Å; L39-V50 HydrophobicContact CD2-CG2 4.17Å; L39-V50 PolarHBondContact N-O 2.99Å; L39-V50 PolarHBondContact O-N 3.33Å
40	S	92.8	Very high	82.5	Confident	58 Å²	58	90.2 Å²	90.2	41%	0.406	47%	0.47	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.9	123.6	179.8	-58	0	0	0	0	110.3	L48 L49	S40-L48 CarbonylContact C-O 3.59Å; S40-L48 VanDerWaalsContact CA-O 3.31Å; S40-L48 WeakPolarHBondContact CA-O 3.4Å; S40-L49 VanDerWaalsContact OG-CD2 3.28Å; S40-L49 WeakPolarHBondContact OG-CD2 3.44Å
41	V	92.4	Very high	84	Confident	42 Å²	42	81 Å²	81	26%	0.255	44%	0.441	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.3	110.3	173.9	-172.1	0	0	0	0	107.3	L19 L39 F43 T47 L48	L19-V41 HydrophobicContact CD1-CG2 4.4Å; L19-V41 HydrophobicContact CD2-CG2 4.44Å; L39-V41 HydrophobicContact CD2-CG2 3.72Å; V41-F43 HydrophobicContact CB-CE2 4.11Å; V41-F43 HydrophobicContact CG1-CD2 4.31Å; V41-F43 HydrophobicContact CG1-CE1 4.45Å; V41-F43 HydrophobicContact CG1-CE2 3.53Å; V41-F43 HydrophobicContact CG1-CZ 3.62Å; V41-T47 CarbonylContact O-C 3.49Å; V41-T47 VanDerWaalsContact O-CA 3.31Å; V41-T47 WeakPolarHBondContact O-CA 3.33Å; V41-L48 HydrophobicContact CB-CB 4.28Å; V41-L48 PolarHBondContact N-O 3.06Å; V41-L48 PolarHBondContact O-N 2.97Å
42	V	91.6	Very high	85.4	Confident	105 Å²	105	81 Å²	81	64%	0.636	43%	0.43	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-98.6	110.7	-174.4	-176.6	0	0	0	0	109	T47	V42-T47 HydrophobicContact CG2-CG2 3.99Å
43	F	88.6	Confident	86.7	Confident	97 Å²	97	75.4 Å²	75.4	43%	0.425	41%	0.411	S	S	.	.			trans	-91.8	174.3	166.5	-56.6	-90.2	0	0	0	109.3	V41 H46 L48 N64	V41-F43 HydrophobicContact CB-CE2 4.11Å; V41-F43 HydrophobicContact CG1-CD2 4.31Å; V41-F43 HydrophobicContact CG1-CE1 4.45Å; V41-F43 HydrophobicContact CG1-CE2 3.53Å; V41-F43 HydrophobicContact CG1-CZ 3.62Å; F43-H46 CarbonylContact C-O 3.55Å; F43-H46 WeakPolarHBondContact CA-O 3.19Å; F43-H46 VanDerWaalsContact CB-O 3.24Å; F43-H46 WeakPolarHBondContact CB-O 3.36Å; F43-H46 AromaticContact CD2-CD2 3.81Å; F43-H46 AromaticContact CD2-NE2 3.52Å; F43-H46 AromaticContact CG-NE2 3.98Å; F43-H46 PolarHBondContact N-O 2.72Å; F43-L48 HydrophobicContact CE2-CD1 3.83Å; F43-L48 HydrophobicContact CE2-CG 3.96Å; F43-L48 HydrophobicContact CZ-CD1 4.47Å; F43-N64 PolarHBondContact O-ND2 3.39Å
44	G	87.2	Confident	87.7	Confident	68 Å²	68	71.7 Å²	71.7	70%	0.701	41%	0.408	S	S	*	.	S	Bend	trans	-59.3	-51.4	176.7	0	0	0	0	0	112.6	N64	G44-N64 PolarHBondContact O-ND2 3.34Å
45	E	89.1	Confident	88.6	Confident	152 Å²	152	76.4 Å²	76.4	71%	0.71	42%	0.424	S	S	*	.	S	Bend	trans	-90.4	-22.9	-172.6	-59.3	-53.2	126.2	0	0	114.4	N64	E45-N64 PolarHBondContact O-N 2.89Å
46	H	88.9	Confident	89.2	Confident	49 Å²	49	82.8 Å²	82.8	23%	0.227	44%	0.441	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-152.4	162.4	-174.7	65.8	-84	0	0	0	112.1	F43 K61 R62 N64	F43-H46 CarbonylContact C-O 3.55Å; F43-H46 WeakPolarHBondContact CA-O 3.19Å; F43-H46 VanDerWaalsContact CB-O 3.24Å; F43-H46 WeakPolarHBondContact CB-O 3.36Å; F43-H46 AromaticContact CD2-CD2 3.81Å; F43-H46 AromaticContact CD2-NE2 3.52Å; F43-H46 AromaticContact CG-NE2 3.98Å; F43-H46 PolarHBondContact N-O 2.72Å; H46-K61 HydrophobicContact CB-CG 4.38Å; H46-R62 CarbonylContact C-O 3.58Å; H46-R62 VanDerWaalsContact CA-O 3.27Å; H46-R62 WeakPolarHBondContact CA-O 3.35Å; H46-R62 WeakPolarHBondContact CB-O 3.44Å; H46-N64 WeakPolarHBondContact CA-OD1 3.37Å; H46-N64 PolarHBondContact N-ND2 3.36Å
47	T	92.3	Very high	89.7	Confident	17 Å²	17	83.8 Å²	83.8	10%	0.104	45%	0.45	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.5	132.5	175.5	-64.5	0	0	0	0	108.9	V41 V42 L49 R62 N64	V41-T47 CarbonylContact O-C 3.49Å; V41-T47 VanDerWaalsContact O-CA 3.31Å; V41-T47 WeakPolarHBondContact O-CA 3.33Å; V42-T47 HydrophobicContact CG2-CG2 3.99Å; T47-L49 HydrophobicContact CG2-CD2 3.77Å; T47-L49 HydrophobicContact CG2-CG 4.31Å; T47-R62 PolarHBondContact N-O 3.42Å; T47-R62 PolarHBondContact O-N 3.43Å; T47-N64 WeakPolarHBondContact CB-OD1 3.17Å; T47-N64 PolarHBondContact N-OD1 2.89Å; T47-N64 PolarHBondContact OG1-OD1 2.81Å
48	L	92.8	Very high	89.9	Confident	20 Å²	20	78.7 Å²	78.7	11%	0.105	43%	0.428	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.6	121	166.3	-59.3	177.9	0	0	0	108.8	I16 S40 V41 F43 V60 K61	I16-L48 HydrophobicContact CD1-CD1 4.3Å; S40-L48 CarbonylContact C-O 3.59Å; S40-L48 VanDerWaalsContact CA-O 3.31Å; S40-L48 WeakPolarHBondContact CA-O 3.4Å; V41-L48 HydrophobicContact CB-CB 4.28Å; V41-L48 PolarHBondContact N-O 3.06Å; V41-L48 PolarHBondContact O-N 2.97Å; F43-L48 HydrophobicContact CE2-CD1 3.83Å; F43-L48 HydrophobicContact CE2-CG 3.96Å; F43-L48 HydrophobicContact CZ-CD1 4.47Å; L48-V60 WeakPolarHBondContact CA-O 3.44Å; L48-K61 HydrophobicContact CD2-CB 3.76Å; L48-K61 HydrophobicContact CD2-CG 3.86Å
49	L	93.4	Very high	90	Very high	43 Å²	43	73.1 Å²	73.1	23%	0.225	41%	0.412	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101	120	173.9	-59.2	175.9	0	0	0	108.3	S40 T47 V59 V60	S40-L49 VanDerWaalsContact OG-CD2 3.28Å; S40-L49 WeakPolarHBondContact OG-CD2 3.44Å; T47-L49 HydrophobicContact CG2-CD2 3.77Å; T47-L49 HydrophobicContact CG2-CG 4.31Å; L49-V59 CarbonylContact O-C 3.5Å; L49-V59 WeakPolarHBondContact O-CA 3.49Å; L49-V60 HydrophobicContact CB-CB 4.41Å; L49-V60 PolarHBondContact N-O 3.11Å; L49-V60 PolarHBondContact O-N 2.84Å
50	V	93.3	Very high	89.9	Confident	2 Å²	2	75.9 Å²	75.9	1%	0.012	43%	0.43	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.5	129	-176.6	-172.5	0	0	0	0	109.7	I16 V20 L39 V57 F58 V59	I16-V50 HydrophobicContact CG2-CG1 4.05Å; I16-V50 HydrophobicContact CG2-CG2 4.08Å; V20-V50 HydrophobicContact CG2-CG1 3.54Å; L39-V50 HydrophobicContact CB-CB 4.25Å; L39-V50 HydrophobicContact CD2-CB 4.18Å; L39-V50 HydrophobicContact CD2-CG2 4.17Å; L39-V50 PolarHBondContact N-O 2.99Å; L39-V50 PolarHBondContact O-N 3.33Å; V50-V57 HydrophobicContact CG1-CG1 3.75Å; V50-F58 WeakPolarHBondContact CA-O 3.36Å; V50-V59 HydrophobicContact CG1-CG2 4.46Å; V50-V59 HydrophobicContact CG2-CG1 4.36Å; V50-V59 HydrophobicContact CG2-CG2 4.41Å
51	T	92.3	Very high	89.8	Confident	54 Å²	54	77 Å²	77	33%	0.331	43%	0.427	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132	143.7	174.6	53.3	0	0	0	0	110.4	R38 F58	R38-T51 HydrophobicContact CB-CG2 4Å; R38-T51 HydrophobicContact CG-CG2 3.82Å; T51-F58 PolarHBondContact N-O 3.04Å; T51-F58 PolarHBondContact O-N 2.91Å
52	V	88.9	Confident	89.7	Confident	52 Å²	52	82.6 Å²	82.6	32%	0.315	44%	0.444	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.8	129.9	177.9	-174	0	0	0	0	108.7	V20 F36 R56 V57	V20-V52 HydrophobicContact CG1-CG2 3.48Å; V20-V52 VanDerWaalsContact CG1-CG2 3.48Å; V20-V52 HydrophobicContact CG2-CG2 4.43Å; F36-V52 HydrophobicContact CE2-CG2 4.32Å; V52-R56 WeakPolarHBondContact CA-O 3.27Å; V52-V57 HydrophobicContact CG2-CG2 4.44Å
53	S	86.7	Confident	89.6	Confident	84 Å²	84	84.9 Å²	84.9	59%	0.587	45%	0.448	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-132.3	112.4	172.1	-178.5	0	0	0	0	109.3	Q55 R56	S53-Q55 PolarHBondContact O-N 2.85Å; S53-R56 PolarHBondContact N-O 2.76Å; S53-R56 PolarHBondContact O-N 3.46Å
54	G	84.6	Confident	89.5	Confident	73 Å²	73	82.8 Å²	82.8	75%	0.753	44%	0.441	S	S	*	.	T	Hydrogen-bonded Turn	trans	59.7	-119	-170.2	0	0	0	0	0	110.7
55	Q	83.8	Confident	88.7	Confident	201 Å²	201	90 Å²	90	94%	0.939	45%	0.447	S	S	*	.	T	Hydrogen-bonded Turn	trans	-98.3	3.9	177.9	-66.7	177.1	-12	0	0	113.6	S53	S53-Q55 PolarHBondContact O-N 2.85Å
56	R	87.4	Confident	87.4	Confident	185 Å²	185	86 Å²	86	70%	0.698	45%	0.446	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-101.4	130.6	-176.7	-65.3	-175.3	-177.8	173.8	1.7	110.9	V52 S53 F58	V52-R56 WeakPolarHBondContact CA-O 3.27Å; S53-R56 PolarHBondContact N-O 2.76Å; S53-R56 PolarHBondContact O-N 3.46Å; R56-F58 HydrophobicContact CB-CD2 4.45Å; R56-F58 HydrophobicContact CB-CE2 3.66Å; R56-F58 HydrophobicContact CB-CZ 3.94Å
57	V	89.3	Confident	85.8	Confident	61 Å²	61	94.6 Å²	94.6	37%	0.37	48%	0.477	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99	129	170.9	-175.7	0	0	0	0	108.4	I16 V20 V50 V52 V59	I16-V57 HydrophobicContact CG2-CG1 4.31Å; V20-V57 HydrophobicContact CG1-CG2 4.43Å; V20-V57 HydrophobicContact CG2-CG1 4.28Å; V50-V57 HydrophobicContact CG1-CG1 3.75Å; V52-V57 HydrophobicContact CG2-CG2 4.44Å; V57-V59 HydrophobicContact CG1-CG2 4.1Å
58	F	90.6	Very high	83.9	Confident	100 Å²	100	101.8 Å²	101.8	44%	0.439	51%	0.509	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.7	130.3	174.9	-58.7	-95.4	0	0	0	108.4	V50 T51 R56	V50-F58 WeakPolarHBondContact CA-O 3.36Å; T51-F58 PolarHBondContact N-O 3.04Å; T51-F58 PolarHBondContact O-N 2.91Å; R56-F58 HydrophobicContact CB-CD2 4.45Å; R56-F58 HydrophobicContact CB-CE2 3.66Å; R56-F58 HydrophobicContact CB-CZ 3.94Å
59	V	91.4	Very high	82.3	Confident	45 Å²	45	106.5 Å²	106.5	27%	0.273	54%	0.541	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.4	130	-178.9	-173.3	0	0	0	0	108.4	L6 I16 L49 V50 V57	L6-V59 HydrophobicContact CD1-CB 4.1Å; L6-V59 HydrophobicContact CD1-CG1 3.53Å; I16-V59 HydrophobicContact CD1-CB 4.43Å; I16-V59 HydrophobicContact CD1-CG1 3.71Å; I16-V59 HydrophobicContact CD1-CG2 3.95Å; I16-V59 HydrophobicContact CG2-CG2 3.86Å; L49-V59 CarbonylContact O-C 3.5Å; L49-V59 WeakPolarHBondContact O-CA 3.49Å; V50-V59 HydrophobicContact CG1-CG2 4.46Å; V50-V59 HydrophobicContact CG2-CG1 4.36Å; V50-V59 HydrophobicContact CG2-CG2 4.41Å; V57-V59 HydrophobicContact CG1-CG2 4.1Å
60	V	91.1	Very high	80.9	Confident	85 Å²	85	111 Å²	111	52%	0.515	56%	0.564	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-125.9	123.4	174.1	-179.5	0	0	0	0	108.6	L48 L49	L48-V60 WeakPolarHBondContact CA-O 3.44Å; L49-V60 HydrophobicContact CB-CB 4.41Å; L49-V60 PolarHBondContact N-O 3.11Å; L49-V60 PolarHBondContact O-N 2.84Å
61	K	90.2	Very high	79.4	Confident	82 Å²	82	118.7 Å²	118.7	36%	0.357	61%	0.605	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-86.9	119.3	169	-173.4	-177.8	177	-163.2	0	108.8	D5 L6 H46 L48	D5-K61 HydrophobicContact CB-CD 3.86Å; D5-K61 IonicContact OD2-NZ 2.81Å; D5-K61 PolarHBondContact OD2-NZ 2.97Å; L6-K61 HydrophobicContact CD1-CB 4.32Å; H46-K61 HydrophobicContact CB-CG 4.38Å; L48-K61 HydrophobicContact CD2-CB 3.76Å; L48-K61 HydrophobicContact CD2-CG 3.86Å
62	R	90.1	Very high	77.9	Confident	160 Å²	160	125.8 Å²	125.8	60%	0.604	65%	0.648	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-115.6	126.4	177.3	-175.6	-175.5	178.2	-172.2	0.6	108.7	H46 T47 N64	H46-R62 CarbonylContact C-O 3.58Å; H46-R62 VanDerWaalsContact CA-O 3.27Å; H46-R62 WeakPolarHBondContact CA-O 3.35Å; H46-R62 WeakPolarHBondContact CB-O 3.44Å; T47-R62 PolarHBondContact N-O 3.42Å; T47-R62 PolarHBondContact O-N 3.43Å; R62-N64 PolarHBondContact O-N 3.37Å
63	Q	90	Very high	77.3	Confident	152 Å²	152	129.5 Å²	129.5	71%	0.71	66%	0.664	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-62.4	136.4	169.2	-73.9	-173.7	-9.2	0	0	110.2	R65	Q63-R65 VanDerWaalsContact C-N 3.26Å; Q63-R65 PolarHBondContact O-N 3.15Å
64	N	85.1	Confident	76.8	Confident	53 Å²	53	131.9 Å²	131.9	28%	0.283	67%	0.669	S	S	.	*			trans	-73.1	91.3	170.8	-66.3	-12.4	0	0	0	106.1	F43 G44 E45 H46 T47 R62 G66	F43-N64 PolarHBondContact O-ND2 3.39Å; G44-N64 PolarHBondContact O-ND2 3.34Å; E45-N64 PolarHBondContact O-N 2.89Å; H46-N64 WeakPolarHBondContact CA-OD1 3.37Å; H46-N64 PolarHBondContact N-ND2 3.36Å; T47-N64 WeakPolarHBondContact CB-OD1 3.17Å; T47-N64 PolarHBondContact N-OD1 2.89Å; T47-N64 PolarHBondContact OG1-OD1 2.81Å; R62-N64 PolarHBondContact O-N 3.37Å; N64-G66 PolarHBondContact O-N 2.92Å
65	R	71.8	Confident	76.4	Confident	221 Å²	221	135.2 Å²	135.2	83%	0.834	66%	0.664	S	S	*	*			trans	-56.5	119.7	163.4	-69.9	-170.1	175.6	-178.2	-2.1	105.5	Q63 R67	Q63-R65 VanDerWaalsContact C-N 3.26Å; Q63-R65 PolarHBondContact O-N 3.15Å; R65-R67 PolarHBondContact O-N 3.36Å
66	G	60.5	Low	75.9	Confident	67 Å²	67	131.3 Å²	131.3	69%	0.691	65%	0.648	S	S	*	*			trans	-41.2	120.8	178.5	0	0	0	0	0	107.6	N64 E68	N64-G66 PolarHBondContact O-N 2.92Å; G66-E68 PolarHBondContact O-N 2.88Å
67	R	55.7	Low	75.2	Confident	230 Å²	230	127.9 Å²	127.9	87%	0.868	64%	0.644	S	S	*	*			trans	-61.6	98.3	172.3	-140.2	-178.8	-176.4	-174.5	-1.3	103.2	R65 P69	R65-R67 PolarHBondContact O-N 3.36Å; R67-P69 VanDerWaalsContact O-N 3.16Å
68	E	52.9	Low	74.3	Confident	167 Å²	167	132.4 Å²	132.4	78%	0.78	66%	0.663	S	S	*	*			trans	-52.6	127.3	168.3	-74.8	-177.2	162.6	0	0	105	G66 I70	G66-E68 PolarHBondContact O-N 2.88Å; E68-I70 PolarHBondContact O-N 3.13Å
69	P	59.7	Low	73.1	Confident	119 Å²	119	134.7 Å²	134.7	77%	0.773	68%	0.679	S	S	*	*			trans	-53.1	124.8	176.7	20.1	-28.8	0	0	0	106.9	R67 D71	R67-P69 VanDerWaalsContact O-N 3.16Å; P69-D71 VanDerWaalsContact C-N 3.31Å; P69-D71 PolarHBondContact O-N 2.85Å
70	I	63.5	Low	71.7	Confident	138 Å²	138	141.6 Å²	141.6	71%	0.708	71%	0.71	S	S	*	*			trans	-68.8	102.5	169.1	-59.3	172.7	0	0	0	103.7	E68 V72	E68-I70 PolarHBondContact O-N 3.13Å; I70-V72 HydrophobicContact CG2-CG1 4.4Å; I70-V72 PolarHBondContact O-N 3.27Å
71	D	61.8	Low	70.1	Confident	163 Å²	163	146.3 Å²	146.3	87%	0.872	73%	0.726	S	S	*	*			trans	-58.9	118.9	165.3	-108.4	-16.2	0	0	0	106.9	P69	P69-D71 VanDerWaalsContact C-N 3.31Å; P69-D71 PolarHBondContact O-N 2.85Å
72	V	60	Low	68.3	Low	204 Å²	204	152.2 Å²	152.2	100%	1.236	76%	0.76	S	S	*	*			trans	-103.8	0	174.8	-86	0	0	0	0	110.2	I70	I70-V72 HydrophobicContact CG2-CG1 4.4Å; I70-V72 PolarHBondContact O-N 3.27Å

Retrieved 72 of 72 residues in 60.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).