A0A087WT96_HUMAN Loading...

Ariadne RBR E3 ubiquitin protein ligase 1

AlphaFold DB , UniProt , Accession A0A087WT96, Species HUMAN (Homo sapiens, Human), Gene ARIH1, Length 114 aa.

						>A0A087WT96_HUMAN|A0A087WT96|ARIH1
RSRAALQRYLFYCNRYMNHMQSLRFEHKLYAQVKQKMEEMQQHNMSWIENNQADLENATEVLSGYLERDISQDSLQDIKQKVQDKYRYCESRRRVLLQHVHEGYEKDLWEYIED
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	R	49.3	Very low	57.2	Low	279 Å²	279	133.2 Å²	133.2	100%	1.053	63%	0.63	S	S	*	*				0	-46	0	-75.2	-177.5	-179.8	-178.9	0.1	112.3	R3	R1-R3 PolarHBondContact O-N 2.97Å
2	S	55.1	Low	57.8	Low	104 Å²	104	132.6 Å²	132.6	73%	0.727	62%	0.619	S	S	*	*	H	α-helix	trans	-59.7	-40.5	176.9	49.4	0	0	0	0	115.3	A4 A5 L6	S2-A4 PolarHBondContact O-N 2.8Å; S2-A5 PolarHBondContact O-N 3.01Å; S2-L6 PolarHBondContact O-N 2.87Å; S2-L6 VanDerWaalsContact O-N 3.1Å
3	R	46.3	Very low	57.9	Low	196 Å²	196	125.6 Å²	125.6	74%	0.74	59%	0.593	S	S	*	*	H	α-helix	trans	-63.2	-40.1	-178.6	-169.4	173.9	-179.8	158.3	-0.3	114.2	R1 L6 Q7	R1-R3 PolarHBondContact O-N 2.97Å; R3-L6 PolarHBondContact O-N 3.43Å; R3-Q7 WeakPolarHBondContact O-CG 3.32Å; R3-Q7 PolarHBondContact O-N 3.16Å
4	A	53.2	Low	58.6	Low	63 Å²	63	123.6 Å²	123.6	52%	0.521	59%	0.588	S	S	.	*	H	α-helix	trans	-70	-36.1	178.6	0	0	0	0	0	112.1	S2 Q7 R8	S2-A4 PolarHBondContact O-N 2.8Å; A4-Q7 PolarHBondContact O-N 2.93Å; A4-R8 PolarHBondContact O-N 3.37Å; A4-R8 VanDerWaalsContact O-N 3.08Å
5	A	55.3	Low	59.8	Low	64 Å²	64	124.5 Å²	124.5	53%	0.529	58%	0.583	S	S	.	*	H	α-helix	trans	-65.3	-41.3	174.4	0	0	0	0	0	111.7	S2 R8 Y9	S2-A5 PolarHBondContact O-N 3.01Å; A5-R8 PolarHBondContact O-N 3.44Å; A5-Y9 WeakPolarHBondContact O-CB 3.45Å; A5-Y9 PolarHBondContact O-N 3.34Å
6	L	55.3	Low	60.9	Low	101 Å²	101	125.6 Å²	125.6	53%	0.529	58%	0.582	S	S	.	*	H	α-helix	trans	-64.8	-43.1	175.5	-177.4	63.4	0	0	0	112.2	S2 R3 R8 Y9 L10	S2-L6 PolarHBondContact O-N 2.87Å; S2-L6 VanDerWaalsContact O-N 3.1Å; R3-L6 PolarHBondContact O-N 3.43Å; L6-R8 VanDerWaalsContact C-N 3.3Å; L6-R8 PolarHBondContact O-N 2.89Å; L6-Y9 PolarHBondContact O-N 2.84Å; L6-L10 HydrophobicContact CD1-CD1 4.47Å; L6-L10 HydrophobicContact CD1-CG 4.35Å; L6-L10 HydrophobicContact CG-CD1 4.12Å; L6-L10 HydrophobicContact CG-CG 4.44Å; L6-L10 WeakPolarHBondContact O-CB 3.4Å; L6-L10 VanDerWaalsContact O-CG 3.3Å; L6-L10 WeakPolarHBondContact O-CG 3.4Å; L6-L10 PolarHBondContact O-N 3.49Å
7	Q	59.6	Low	61.7	Low	120 Å²	120	124.3 Å²	124.3	56%	0.561	58%	0.577	S	S	*	*	H	α-helix	trans	-60.5	-40.8	176	-77.9	177.1	-47.5	0	0	112.1	R3 A4 L10 F11	R3-Q7 WeakPolarHBondContact O-CG 3.32Å; R3-Q7 PolarHBondContact O-N 3.16Å; A4-Q7 PolarHBondContact O-N 2.93Å; Q7-L10 PolarHBondContact O-N 3.05Å; Q7-F11 WeakPolarHBondContact O-CB 3.45Å; Q7-F11 PolarHBondContact O-N 2.89Å
8	R	60.1	Low	62.8	Low	163 Å²	163	121.3 Å²	121.3	62%	0.615	57%	0.566	S	S	*	*	H	α-helix	trans	-66	-41.7	176.4	-168	174.4	-169.2	-179.5	1.2	111.9	A4 A5 L6 F11 Y12	A4-R8 PolarHBondContact O-N 3.37Å; A4-R8 VanDerWaalsContact O-N 3.08Å; A5-R8 PolarHBondContact O-N 3.44Å; L6-R8 VanDerWaalsContact C-N 3.3Å; L6-R8 PolarHBondContact O-N 2.89Å; R8-F11 PolarHBondContact O-N 3.29Å; R8-Y12 HydrophobicContact CG-CD2 4.01Å; R8-Y12 HydrophobicContact CG-CE2 3.62Å; R8-Y12 WeakPolarHBondContact O-CD2 3.32Å; R8-Y12 PolarHBondContact O-N 2.98Å
9	Y	58.9	Low	63.9	Low	154 Å²	154	120.4 Å²	120.4	60%	0.604	56%	0.562	S	S	*	*	H	α-helix	trans	-60.5	-49.1	174.6	178.5	-100.6	0	0	0	111.7	A5 L6 F11 Y12 C13	A5-Y9 WeakPolarHBondContact O-CB 3.45Å; A5-Y9 PolarHBondContact O-N 3.34Å; L6-Y9 PolarHBondContact O-N 2.84Å; Y9-F11 VanDerWaalsContact C-N 3.3Å; Y9-F11 PolarHBondContact O-N 3.49Å; Y9-Y12 PolarHBondContact O-N 3.06Å; Y9-C13 VanDerWaalsContact CE1-SG 3.52Å; Y9-C13 PolarHBondContact O-N 3.28Å; Y9-C13 PolarHBondContact O-SG 3.44Å; Y9-C13 VanDerWaalsContact O-SG 3.34Å
10	L	61.8	Low	64.6	Low	98 Å²	98	117.5 Å²	117.5	51%	0.513	55%	0.549	S	S	.	.	H	α-helix	trans	-60.5	-37.9	178	-70.2	173.2	0	0	0	112.6	L6 Q7 C13 N14	L6-L10 HydrophobicContact CD1-CD1 4.47Å; L6-L10 HydrophobicContact CD1-CG 4.35Å; L6-L10 HydrophobicContact CG-CD1 4.12Å; L6-L10 HydrophobicContact CG-CG 4.44Å; L6-L10 WeakPolarHBondContact O-CB 3.4Å; L6-L10 VanDerWaalsContact O-CG 3.3Å; L6-L10 WeakPolarHBondContact O-CG 3.4Å; L6-L10 PolarHBondContact O-N 3.49Å; Q7-L10 PolarHBondContact O-N 3.05Å; L10-C13 PolarHBondContact O-N 2.88Å; L10-N14 VanDerWaalsContact O-CB 3.31Å; L10-N14 WeakPolarHBondContact O-CB 3.21Å; L10-N14 PolarHBondContact O-N 3.35Å
11	F	74.1	Confident	65.5	Low	123 Å²	123	116.5 Å²	116.5	54%	0.539	54%	0.544	S	S	.	.	H	α-helix	trans	-60.7	-48.6	175	175	-96.9	0	0	0	112.1	Q7 R8 Y9 N14 R15	Q7-F11 WeakPolarHBondContact O-CB 3.45Å; Q7-F11 PolarHBondContact O-N 2.89Å; R8-F11 PolarHBondContact O-N 3.29Å; Y9-F11 VanDerWaalsContact C-N 3.3Å; Y9-F11 PolarHBondContact O-N 3.49Å; F11-N14 PolarHBondContact O-N 3.46Å; F11-R15 WeakPolarHBondContact O-CB 3.44Å; F11-R15 PolarHBondContact O-N 3.43Å
12	Y	65.3	Low	67.1	Low	126 Å²	126	106.5 Å²	106.5	49%	0.494	52%	0.517	S	S	.	.	H	α-helix	trans	-68	-38.1	178.4	-73.2	-64.4	0	0	0	112.3	R8 Y9 R15 Y16	R8-Y12 HydrophobicContact CG-CD2 4.01Å; R8-Y12 HydrophobicContact CG-CE2 3.62Å; R8-Y12 WeakPolarHBondContact O-CD2 3.32Å; R8-Y12 PolarHBondContact O-N 2.98Å; Y9-Y12 PolarHBondContact O-N 3.06Å; Y12-R15 PolarHBondContact O-N 3.38Å; Y12-Y16 WeakPolarHBondContact O-CB 3.28Å; Y12-Y16 PolarHBondContact O-N 2.71Å
13	C	58.9	Low	68.4	Low	42 Å²	42	105.4 Å²	105.4	28%	0.284	50%	0.503	S	S	.	.	H	α-helix	trans	-62.1	-44.9	173.8	-70.2	0	0	0	0	111.8	Y9 L10 Y16 M17	Y9-C13 VanDerWaalsContact CE1-SG 3.52Å; Y9-C13 PolarHBondContact O-N 3.28Å; Y9-C13 PolarHBondContact O-SG 3.44Å; Y9-C13 VanDerWaalsContact O-SG 3.34Å; L10-C13 PolarHBondContact O-N 2.88Å; C13-Y16 PolarHBondContact O-N 2.97Å; C13-M17 WeakPolarHBondContact O-CB 3.31Å; C13-M17 WeakPolarHBondContact O-CG 3.32Å; C13-M17 PolarHBondContact O-N 2.98Å
14	N	67.8	Low	70.2	Confident	97 Å²	97	103.9 Å²	103.9	52%	0.519	50%	0.497	S	S	.	.	H	α-helix	trans	-62.8	-44.3	178.1	-173.2	-87.6	0	0	0	111.3	L10 F11 Y16 M17 N18	L10-N14 VanDerWaalsContact O-CB 3.31Å; L10-N14 WeakPolarHBondContact O-CB 3.21Å; L10-N14 PolarHBondContact O-N 3.35Å; F11-N14 PolarHBondContact O-N 3.46Å; N14-Y16 PolarHBondContact O-N 3.23Å; N14-M17 PolarHBondContact O-N 3.41Å; N14-N18 WeakPolarHBondContact O-CB 3.34Å; N14-N18 PolarHBondContact O-N 3.45Å; N14-N18 PolarHBondContact O-ND2 3.46Å; N14-N18 PolarHBondContact OD1-ND2 3.29Å
15	R	75.9	Confident	71.9	Confident	137 Å²	137	107.2 Å²	107.2	52%	0.517	50%	0.5	S	S	.	.	H	α-helix	trans	-61.1	-44.4	176.6	-173	173.4	-175.4	127.9	-1.6	112.4	F11 Y12 N18 H19	F11-R15 WeakPolarHBondContact O-CB 3.44Å; F11-R15 PolarHBondContact O-N 3.43Å; Y12-R15 PolarHBondContact O-N 3.38Å; R15-N18 PolarHBondContact O-N 2.82Å; R15-H19 PolarHBondContact NE-NE2 3Å; R15-H19 PolarHBondContact O-CD2 3.35Å; R15-H19 VanDerWaalsContact O-CD2 3.31Å; R15-H19 PolarHBondContact O-N 3.03Å
16	Y	77.1	Confident	73.4	Confident	143 Å²	143	110.3 Å²	110.3	56%	0.561	50%	0.503	S	S	*	.	H	α-helix	trans	-61.3	-46.1	175.7	174	-99.7	0	0	0	111.8	Y12 C13 N14 N18 H19 M20	Y12-Y16 WeakPolarHBondContact O-CB 3.28Å; Y12-Y16 PolarHBondContact O-N 2.71Å; C13-Y16 PolarHBondContact O-N 2.97Å; N14-Y16 PolarHBondContact O-N 3.23Å; Y16-N18 VanDerWaalsContact C-N 3.33Å; Y16-N18 PolarHBondContact O-N 3.4Å; Y16-H19 PolarHBondContact O-N 3.47Å; Y16-M20 HydrophobicContact CE1-CE 4.38Å; Y16-M20 HydrophobicContact CE2-CE 4.17Å; Y16-M20 WeakPolarHBondContact O-CB 3.41Å; Y16-M20 PolarHBondContact O-N 3.26Å; Y16-M20 VanDerWaalsContact OH-CE 3.28Å; Y16-M20 WeakPolarHBondContact OH-CE 3.44Å
17	M	75.4	Confident	75	Confident	103 Å²	103	111.5 Å²	111.5	51%	0.507	51%	0.506	S	S	.	.	H	α-helix	trans	-61.8	-40.3	177.8	-71.7	-64.8	-73.4	0	0	112	C13 N14 M20 Q21	C13-M17 WeakPolarHBondContact O-CB 3.31Å; C13-M17 WeakPolarHBondContact O-CG 3.32Å; C13-M17 PolarHBondContact O-N 2.98Å; N14-M17 PolarHBondContact O-N 3.41Å; M17-M20 PolarHBondContact O-N 3.4Å; M17-Q21 WeakPolarHBondContact O-CG 3.35Å; M17-Q21 PolarHBondContact O-N 3.09Å
18	N	80.4	Confident	76.5	Confident	71 Å²	71	112.2 Å²	112.2	38%	0.38	51%	0.507	S	S	.	.	H	α-helix	trans	-65.6	-46.5	176	-68.1	-19.7	0	0	0	111.5	N14 R15 Y16 M20 Q21 S22	N14-N18 WeakPolarHBondContact O-CB 3.34Å; N14-N18 PolarHBondContact O-N 3.45Å; N14-N18 PolarHBondContact O-ND2 3.46Å; N14-N18 PolarHBondContact OD1-ND2 3.29Å; R15-N18 PolarHBondContact O-N 2.82Å; Y16-N18 VanDerWaalsContact C-N 3.33Å; Y16-N18 PolarHBondContact O-N 3.4Å; N18-M20 VanDerWaalsContact C-N 3.28Å; N18-M20 PolarHBondContact O-N 2.93Å; N18-Q21 PolarHBondContact O-N 3.35Å; N18-Q21 VanDerWaalsContact O-N 3.12Å; N18-S22 PolarHBondContact O-N 2.99Å; N18-S22 PolarHBondContact O-OG 3.21Å
19	H	83.6	Confident	77.9	Confident	104 Å²	104	109.4 Å²	109.4	48%	0.481	50%	0.504	S	S	.	.	H	α-helix	trans	-60.5	-39.4	175.6	-71.3	-37.7	0	0	0	112.1	R15 Y16 Q21 S22 L23	R15-H19 PolarHBondContact NE-NE2 3Å; R15-H19 PolarHBondContact O-CD2 3.35Å; R15-H19 VanDerWaalsContact O-CD2 3.31Å; R15-H19 PolarHBondContact O-N 3.03Å; Y16-H19 PolarHBondContact O-N 3.47Å; H19-Q21 VanDerWaalsContact C-N 3.33Å; H19-Q21 PolarHBondContact O-N 3.4Å; H19-S22 PolarHBondContact O-N 2.93Å; H19-L23 WeakPolarHBondContact O-CB 3.32Å; H19-L23 PolarHBondContact O-N 2.99Å
20	M	79.4	Confident	79.4	Confident	62 Å²	62	110.1 Å²	110.1	31%	0.305	51%	0.507	S	S	.	.	H	α-helix	trans	-63.2	-38.3	174.9	-173	60.4	65.2	0	0	112.2	Y16 M17 N18 R24	Y16-M20 HydrophobicContact CE1-CE 4.38Å; Y16-M20 HydrophobicContact CE2-CE 4.17Å; Y16-M20 WeakPolarHBondContact O-CB 3.41Å; Y16-M20 PolarHBondContact O-N 3.26Å; Y16-M20 VanDerWaalsContact OH-CE 3.28Å; Y16-M20 WeakPolarHBondContact OH-CE 3.44Å; M17-M20 PolarHBondContact O-N 3.4Å; N18-M20 VanDerWaalsContact C-N 3.28Å; N18-M20 PolarHBondContact O-N 2.93Å; M20-R24 VanDerWaalsContact O-CG 3.32Å; M20-R24 WeakPolarHBondContact O-CG 3.49Å; M20-R24 PolarHBondContact O-N 3.31Å
21	Q	82.3	Confident	80.8	Confident	96 Å²	96	108.2 Å²	108.2	45%	0.449	51%	0.505	S	S	.	.	H	α-helix	trans	-69.7	-44.3	174.6	-73.8	178.7	2.1	0	0	112.2	M17 N18 H19 L23 R24 F25	M17-Q21 WeakPolarHBondContact O-CG 3.35Å; M17-Q21 PolarHBondContact O-N 3.09Å; N18-Q21 PolarHBondContact O-N 3.35Å; N18-Q21 VanDerWaalsContact O-N 3.12Å; H19-Q21 VanDerWaalsContact C-N 3.33Å; H19-Q21 PolarHBondContact O-N 3.4Å; Q21-L23 VanDerWaalsContact C-N 3.31Å; Q21-L23 PolarHBondContact O-N 3.41Å; Q21-R24 WeakPolarHBondContact O-CB 3.48Å; Q21-R24 PolarHBondContact O-N 2.93Å; Q21-R24 VanDerWaalsContact O-N 3.16Å; Q21-F25 HydrophobicContact CB-CE2 4.41Å; Q21-F25 WeakPolarHBondContact O-CD2 3.42Å; Q21-F25 PolarHBondContact O-N 3.44Å
22	S	83.9	Confident	81.8	Confident	70 Å²	70	108.4 Å²	108.4	49%	0.49	51%	0.508	S	S	.	.	H	α-helix	trans	-56.1	-46.5	175	-63.3	0	0	0	0	111.5	N18 H19 R24 F25 E26	N18-S22 PolarHBondContact O-N 2.99Å; N18-S22 PolarHBondContact O-OG 3.21Å; H19-S22 PolarHBondContact O-N 2.93Å; S22-R24 VanDerWaalsContact C-N 3.32Å; S22-R24 PolarHBondContact O-N 3.47Å; S22-F25 PolarHBondContact O-N 2.88Å; S22-F25 VanDerWaalsContact O-N 3.11Å; S22-E26 PolarHBondContact O-N 2.98Å
23	L	82.4	Confident	83	Confident	80 Å²	80	105.7 Å²	105.7	42%	0.419	50%	0.504	S	S	.	.	H	α-helix	trans	-61.5	-39.6	177.8	-173.1	65	0	0	0	112	H19 Q21 F25 E26 H27	H19-L23 WeakPolarHBondContact O-CB 3.32Å; H19-L23 PolarHBondContact O-N 2.99Å; Q21-L23 VanDerWaalsContact C-N 3.31Å; Q21-L23 PolarHBondContact O-N 3.41Å; L23-F25 VanDerWaalsContact C-N 3.33Å; L23-F25 PolarHBondContact O-N 2.87Å; L23-E26 WeakPolarHBondContact O-CB 3.32Å; L23-E26 PolarHBondContact O-N 3.34Å; L23-H27 PolarHBondContact O-CD2 3.38Å; L23-H27 PolarHBondContact O-N 3.23Å
24	R	84.3	Confident	84.6	Confident	164 Å²	164	109 Å²	109	62%	0.619	51%	0.514	S	S	*	.	H	α-helix	trans	-63.5	-37.5	174.8	-73.5	173.8	179.2	-171.1	-0.7	112.7	M20 Q21 S22 K28	M20-R24 VanDerWaalsContact O-CG 3.32Å; M20-R24 WeakPolarHBondContact O-CG 3.49Å; M20-R24 PolarHBondContact O-N 3.31Å; Q21-R24 WeakPolarHBondContact O-CB 3.48Å; Q21-R24 PolarHBondContact O-N 2.93Å; Q21-R24 VanDerWaalsContact O-N 3.16Å; S22-R24 VanDerWaalsContact C-N 3.32Å; S22-R24 PolarHBondContact O-N 3.47Å; R24-K28 WeakPolarHBondContact O-CG 3.4Å; R24-K28 PolarHBondContact O-N 2.84Å
25	F	87.6	Confident	85.8	Confident	134 Å²	134	109.7 Å²	109.7	59%	0.588	51%	0.514	S	S	*	.	H	α-helix	trans	-69.2	-39.4	175.2	-68.9	-53.8	0	0	0	111.7	Q21 S22 L23 K28 L29	Q21-F25 HydrophobicContact CB-CE2 4.41Å; Q21-F25 WeakPolarHBondContact O-CD2 3.42Å; Q21-F25 PolarHBondContact O-N 3.44Å; S22-F25 PolarHBondContact O-N 2.88Å; S22-F25 VanDerWaalsContact O-N 3.11Å; L23-F25 VanDerWaalsContact C-N 3.33Å; L23-F25 PolarHBondContact O-N 2.87Å; F25-K28 PolarHBondContact O-N 3.28Å; F25-L29 WeakPolarHBondContact O-CB 3.26Å; F25-L29 PolarHBondContact O-N 3.41Å
26	E	88.1	Confident	86.5	Confident	128 Å²	128	109.8 Å²	109.8	60%	0.598	52%	0.518	S	S	*	.	H	α-helix	trans	-60.2	-46.4	176.4	-169.4	178.2	164.9	0	0	111.8	S22 L23 K28 L29 Y30	S22-E26 PolarHBondContact O-N 2.98Å; L23-E26 WeakPolarHBondContact O-CB 3.32Å; L23-E26 PolarHBondContact O-N 3.34Å; E26-K28 VanDerWaalsContact C-N 3.34Å; E26-K28 PolarHBondContact O-N 3.01Å; E26-L29 PolarHBondContact O-N 2.85Å; E26-Y30 PolarHBondContact O-N 3.49Å
27	H	88.1	Confident	86.9	Confident	127 Å²	127	108.6 Å²	108.6	59%	0.588	52%	0.519	S	S	*	.	H	α-helix	trans	-60.5	-41	175.3	-80.6	-68.2	0	0	0	113.2	L23 Y30 A31	L23-H27 PolarHBondContact O-CD2 3.38Å; L23-H27 PolarHBondContact O-N 3.23Å; H27-Y30 PolarHBondContact O-N 2.94Å; H27-A31 PolarHBondContact O-N 3.07Å; H27-A31 VanDerWaalsContact O-N 3.1Å
28	K	90.4	Very high	87.7	Confident	135 Å²	135	108.1 Å²	108.1	59%	0.587	52%	0.515	S	S	*	.	H	α-helix	trans	-65.3	-43	176.5	-74.9	177.6	177.2	-174.4	0	111.6	R24 F25 E26 Y30 A31 Q32	R24-K28 WeakPolarHBondContact O-CG 3.4Å; R24-K28 PolarHBondContact O-N 2.84Å; F25-K28 PolarHBondContact O-N 3.28Å; E26-K28 VanDerWaalsContact C-N 3.34Å; E26-K28 PolarHBondContact O-N 3.01Å; K28-Y30 VanDerWaalsContact C-N 3.34Å; K28-A31 PolarHBondContact O-N 3.38Å; K28-Q32 WeakPolarHBondContact O-CG 3.2Å; K28-Q32 PolarHBondContact O-N 2.87Å
29	L	89.2	Confident	88.1	Confident	103 Å²	103	108.7 Å²	108.7	54%	0.539	52%	0.516	S	S	.	.	H	α-helix	trans	-61.5	-45.1	177.2	-177.9	66	0	0	0	110.8	F25 E26 A31 Q32 V33	F25-L29 WeakPolarHBondContact O-CB 3.26Å; F25-L29 PolarHBondContact O-N 3.41Å; E26-L29 PolarHBondContact O-N 2.85Å; L29-A31 VanDerWaalsContact C-N 3.33Å; L29-A31 PolarHBondContact O-N 3.22Å; L29-Q32 PolarHBondContact O-N 3.36Å; L29-V33 HydrophobicContact CD1-CG2 4.34Å; L29-V33 HydrophobicContact CG-CG2 4.43Å; L29-V33 WeakPolarHBondContact O-CG2 3.41Å; L29-V33 PolarHBondContact O-N 3Å
30	Y	90.5	Very high	88.1	Confident	170 Å²	170	110 Å²	110	67%	0.667	52%	0.524	S	S	*	.	H	α-helix	trans	-59	-44.6	177.3	-173.6	-93.3	0	0	0	112	E26 H27 K28 Q32 V33 K34	E26-Y30 PolarHBondContact O-N 3.49Å; H27-Y30 PolarHBondContact O-N 2.94Å; K28-Y30 VanDerWaalsContact C-N 3.34Å; Y30-Q32 PolarHBondContact O-N 2.81Å; Y30-V33 PolarHBondContact O-N 3.13Å; Y30-K34 WeakPolarHBondContact O-CB 3.43Å; Y30-K34 PolarHBondContact O-N 3.24Å
31	A	92.6	Very high	88.2	Confident	58 Å²	58	113.4 Å²	113.4	48%	0.479	54%	0.539	S	S	.	.	H	α-helix	trans	-61.2	-43.6	176.6	0	0	0	0	0	112.3	H27 K28 L29 K34 Q35	H27-A31 PolarHBondContact O-N 3.07Å; H27-A31 VanDerWaalsContact O-N 3.1Å; K28-A31 PolarHBondContact O-N 3.38Å; L29-A31 VanDerWaalsContact C-N 3.33Å; L29-A31 PolarHBondContact O-N 3.22Å; A31-K34 PolarHBondContact O-N 3.04Å; A31-Q35 PolarHBondContact O-N 2.96Å
32	Q	93.9	Very high	88.3	Confident	127 Å²	127	115.6 Å²	115.6	59%	0.593	55%	0.549	S	S	*	.	H	α-helix	trans	-64.6	-43.4	178.1	-73.1	176.7	-24.3	0	0	112.6	K28 L29 Y30 K36	K28-Q32 WeakPolarHBondContact O-CG 3.2Å; K28-Q32 PolarHBondContact O-N 2.87Å; L29-Q32 PolarHBondContact O-N 3.36Å; Y30-Q32 PolarHBondContact O-N 2.81Å; Q32-K36 WeakPolarHBondContact O-CB 3.3Å; Q32-K36 PolarHBondContact O-N 2.99Å
33	V	90.4	Very high	88.3	Confident	68 Å²	68	119.1 Å²	119.1	41%	0.412	56%	0.558	S	S	.	*	H	α-helix	trans	-64.1	-44.1	177.8	170.7	0	0	0	0	110.5	L29 Y30 K36 M37	L29-V33 HydrophobicContact CD1-CG2 4.34Å; L29-V33 HydrophobicContact CG-CG2 4.43Å; L29-V33 WeakPolarHBondContact O-CG2 3.41Å; L29-V33 PolarHBondContact O-N 3Å; Y30-V33 PolarHBondContact O-N 3.13Å; V33-K36 PolarHBondContact O-N 2.81Å; V33-M37 HydrophobicContact CG1-CE 3.75Å; V33-M37 HydrophobicContact CG1-SD 4.33Å; V33-M37 WeakPolarHBondContact O-CG 3.25Å; V33-M37 PolarHBondContact O-N 3.36Å
34	K	92.3	Very high	88.3	Confident	112 Å²	112	119.6 Å²	119.6	49%	0.487	56%	0.561	S	S	.	*	H	α-helix	trans	-59.7	-49.7	177.8	-174.3	-178.4	176.1	-170.4	0	111.8	Y30 A31 K36 M37 E38	Y30-K34 WeakPolarHBondContact O-CB 3.43Å; Y30-K34 PolarHBondContact O-N 3.24Å; A31-K34 PolarHBondContact O-N 3.04Å; K34-K36 VanDerWaalsContact C-N 3.3Å; K34-K36 PolarHBondContact O-N 2.91Å; K34-M37 PolarHBondContact O-N 2.82Å; K34-E38 WeakPolarHBondContact CE-OE1 3.25Å; K34-E38 IonicContact NZ-OE1 3.46Å; K34-E38 WeakPolarHBondContact O-CG 3.45Å; K34-E38 PolarHBondContact O-N 2.86Å; K34-E38 VanDerWaalsContact O-N 3.1Å
35	Q	93.4	Very high	88	Confident	111 Å²	111	116.8 Å²	116.8	52%	0.519	56%	0.556	S	S	.	*	H	α-helix	trans	-57.4	-45.1	177.6	-178.1	-175	-16.1	0	0	111.4	A31 M37 E38 E39	A31-Q35 PolarHBondContact O-N 2.96Å; Q35-M37 VanDerWaalsContact C-N 3.32Å; Q35-M37 PolarHBondContact O-N 3.41Å; Q35-E38 PolarHBondContact O-N 3.42Å; Q35-E39 PolarHBondContact NE2-OE1 3.49Å; Q35-E39 WeakPolarHBondContact O-CG 3.31Å; Q35-E39 PolarHBondContact O-N 2.94Å
36	K	90.6	Very high	87.9	Confident	139 Å²	139	112.9 Å²	112.9	60%	0.604	55%	0.545	S	S	*	.	H	α-helix	trans	-66.5	-33.1	-179	-164.6	150.9	-174.8	167.2	0	113	Q32 V33 K34 M40	Q32-K36 WeakPolarHBondContact O-CB 3.3Å; Q32-K36 PolarHBondContact O-N 2.99Å; V33-K36 PolarHBondContact O-N 2.81Å; K34-K36 VanDerWaalsContact C-N 3.3Å; K34-K36 PolarHBondContact O-N 2.91Å; K36-M40 WeakPolarHBondContact O-CG 3.31Å; K36-M40 PolarHBondContact O-N 3.33Å; K36-M40 VanDerWaalsContact O-N 3.14Å
37	M	86.9	Confident	87.7	Confident	119 Å²	119	114.3 Å²	114.3	59%	0.586	55%	0.545	S	S	*	.	H	α-helix	trans	-65.5	-41.6	172.2	-73.7	-178.8	177.9	0	0	111.9	V33 K34 Q35 M40 Q41	V33-M37 HydrophobicContact CG1-CE 3.75Å; V33-M37 HydrophobicContact CG1-SD 4.33Å; V33-M37 WeakPolarHBondContact O-CG 3.25Å; V33-M37 PolarHBondContact O-N 3.36Å; K34-M37 PolarHBondContact O-N 2.82Å; Q35-M37 VanDerWaalsContact C-N 3.32Å; Q35-M37 PolarHBondContact O-N 3.41Å; M37-M40 PolarHBondContact O-N 2.77Å; M37-Q41 WeakPolarHBondContact O-CG 3.47Å; M37-Q41 PolarHBondContact O-N 2.91Å; M37-Q41 VanDerWaalsContact O-N 3.08Å
38	E	90.6	Very high	87.5	Confident	92 Å²	92	112 Å²	112	43%	0.43	54%	0.536	S	S	.	.	H	α-helix	trans	-64	-43.7	177.5	-69.7	170.7	178.3	0	0	111.6	K34 Q35 M40 Q41 Q42	K34-E38 WeakPolarHBondContact CE-OE1 3.25Å; K34-E38 IonicContact NZ-OE1 3.46Å; K34-E38 WeakPolarHBondContact O-CG 3.45Å; K34-E38 PolarHBondContact O-N 2.86Å; K34-E38 VanDerWaalsContact O-N 3.1Å; Q35-E38 PolarHBondContact O-N 3.42Å; E38-M40 PolarHBondContact O-N 2.88Å; E38-Q41 PolarHBondContact O-N 3.47Å; E38-Q42 WeakPolarHBondContact O-CG 3.36Å; E38-Q42 PolarHBondContact O-N 3.27Å
39	E	89.3	Confident	87.3	Confident	83 Å²	83	111.1 Å²	111.1	39%	0.388	53%	0.534	S	S	.	.	H	α-helix	trans	-59.1	-45.6	175.2	-71.9	169.6	-173.1	0	0	111.8	Q35 Q41 Q42 H43	Q35-E39 PolarHBondContact NE2-OE1 3.49Å; Q35-E39 WeakPolarHBondContact O-CG 3.31Å; Q35-E39 PolarHBondContact O-N 2.94Å; E39-Q41 PolarHBondContact O-N 2.83Å; E39-Q42 PolarHBondContact O-N 2.78Å; E39-H43 PolarHBondContact O-CD2 3.15Å; E39-H43 VanDerWaalsContact O-CD2 3.26Å; E39-H43 PolarHBondContact O-N 3.3Å
40	M	83.3	Confident	87.1	Confident	132 Å²	132	110.6 Å²	110.6	65%	0.65	53%	0.532	S	S	*	.	H	α-helix	trans	-62.7	-40.2	177.8	-74.7	-178.1	67.1	0	0	112.6	K36 M37 E38 N44	K36-M40 WeakPolarHBondContact O-CG 3.31Å; K36-M40 PolarHBondContact O-N 3.33Å; K36-M40 VanDerWaalsContact O-N 3.14Å; M37-M40 PolarHBondContact O-N 2.77Å; E38-M40 PolarHBondContact O-N 2.88Å; M40-N44 WeakPolarHBondContact O-CB 3.34Å; M40-N44 PolarHBondContact O-N 3.31Å
41	Q	82.5	Confident	86.8	Confident	134 Å²	134	105.6 Å²	105.6	63%	0.626	52%	0.517	S	S	*	.	H	α-helix	trans	-63.9	-44.9	177	-75.6	-179.9	-17.5	0	0	111.6	M37 E38 E39 N44 M45	M37-Q41 WeakPolarHBondContact O-CG 3.47Å; M37-Q41 PolarHBondContact O-N 2.91Å; M37-Q41 VanDerWaalsContact O-N 3.08Å; E38-Q41 PolarHBondContact O-N 3.47Å; E39-Q41 PolarHBondContact O-N 2.83Å; Q41-N44 PolarHBondContact O-N 2.95Å; Q41-M45 VanDerWaalsContact O-CG 3.3Å; Q41-M45 WeakPolarHBondContact O-CG 3.23Å; Q41-M45 PolarHBondContact O-N 3.2Å
42	Q	83.9	Confident	86.5	Confident	141 Å²	141	108.1 Å²	108.1	66%	0.659	52%	0.518	S	S	*	.	H	α-helix	trans	-61.3	-45.4	177.7	-72.7	179.3	-6.7	0	0	112.3	E38 E39 N44 M45 S46	E38-Q42 WeakPolarHBondContact O-CG 3.36Å; E38-Q42 PolarHBondContact O-N 3.27Å; E39-Q42 PolarHBondContact O-N 2.78Å; Q42-N44 VanDerWaalsContact C-N 3.35Å; Q42-N44 PolarHBondContact O-N 2.85Å; Q42-M45 PolarHBondContact O-N 2.98Å; Q42-S46 PolarHBondContact O-N 3.29Å
43	H	84.5	Confident	86.2	Confident	145 Å²	145	104.5 Å²	104.5	67%	0.671	51%	0.511	S	S	*	.	H	α-helix	trans	-61.5	-42.2	176.7	-85.5	-67.2	0	0	0	112.6	E39 S46 W47	E39-H43 PolarHBondContact O-CD2 3.15Å; E39-H43 VanDerWaalsContact O-CD2 3.26Å; E39-H43 PolarHBondContact O-N 3.3Å; H43-S46 PolarHBondContact O-N 3.11Å; H43-W47 PolarHBondContact O-N 2.88Å
44	N	82	Confident	86	Confident	90 Å²	90	106.7 Å²	106.7	48%	0.481	52%	0.52	S	S	.	.	H	α-helix	trans	-66.2	-41.1	178.6	-169	64.6	0	0	0	112	M40 Q41 Q42 W47 I48	M40-N44 WeakPolarHBondContact O-CB 3.34Å; M40-N44 PolarHBondContact O-N 3.31Å; Q41-N44 PolarHBondContact O-N 2.95Å; Q42-N44 VanDerWaalsContact C-N 3.35Å; Q42-N44 PolarHBondContact O-N 2.85Å; N44-W47 PolarHBondContact O-N 3.25Å; N44-I48 WeakPolarHBondContact O-CG1 3.34Å; N44-I48 PolarHBondContact O-N 3.45Å
45	M	78.6	Confident	85.7	Confident	105 Å²	105	107 Å²	107	52%	0.517	53%	0.526	S	S	.	.	H	α-helix	trans	-59.4	-47.6	174.4	-71.9	-60.4	-60.7	0	0	111.4	Q41 Q42 W47 I48 E49	Q41-M45 VanDerWaalsContact O-CG 3.3Å; Q41-M45 WeakPolarHBondContact O-CG 3.23Å; Q41-M45 PolarHBondContact O-N 3.2Å; Q42-M45 PolarHBondContact O-N 2.98Å; M45-W47 VanDerWaalsContact C-N 3.31Å; M45-W47 PolarHBondContact O-N 3.03Å; M45-I48 PolarHBondContact O-N 2.96Å; M45-E49 WeakPolarHBondContact O-CG 3.21Å; M45-E49 PolarHBondContact O-N 3.25Å
46	S	84.9	Confident	85.5	Confident	52 Å²	52	107.1 Å²	107.1	36%	0.364	53%	0.527	S	S	.	.	H	α-helix	trans	-60.6	-39	177.1	177.5	0	0	0	0	112.7	Q42 H43 E49 N50	Q42-S46 PolarHBondContact O-N 3.29Å; H43-S46 PolarHBondContact O-N 3.11Å; S46-E49 PolarHBondContact O-N 3.41Å; S46-N50 PolarHBondContact O-N 3.45Å; S46-N50 PolarHBondContact O-ND2 2.95Å; S46-N50 VanDerWaalsContact O-ND2 3.1Å
47	W	82.9	Confident	85.4	Confident	158 Å²	158	105.5 Å²	105.5	60%	0.598	53%	0.525	S	S	*	.	H	α-helix	trans	-65.5	-40.8	177.3	-175.8	82.1	0	0	0	112.5	H43 N44 M45 N50 N51	H43-W47 PolarHBondContact O-N 2.88Å; N44-W47 PolarHBondContact O-N 3.25Å; M45-W47 VanDerWaalsContact C-N 3.31Å; M45-W47 PolarHBondContact O-N 3.03Å; W47-N50 PolarHBondContact O-N 3.43Å; W47-N51 WeakPolarHBondContact CH2-ND2 3.32Å; W47-N51 WeakPolarHBondContact CZ2-ND2 3.27Å; W47-N51 WeakPolarHBondContact CZ3-ND2 3.32Å; W47-N51 PolarHBondContact O-N 3.28Å; W47-N51 VanDerWaalsContact O-N 3.13Å
48	I	84.6	Confident	85.2	Confident	77 Å²	77	102.6 Å²	102.6	40%	0.395	52%	0.52	S	S	.	.	H	α-helix	trans	-63.4	-45.9	176	-68.2	169.1	0	0	0	110.7	N44 M45 N50 N51 Q52	N44-I48 WeakPolarHBondContact O-CG1 3.34Å; N44-I48 PolarHBondContact O-N 3.45Å; M45-I48 PolarHBondContact O-N 2.96Å; I48-N50 PolarHBondContact O-N 3.43Å; I48-N51 PolarHBondContact O-N 2.98Å; I48-Q52 PolarHBondContact O-N 3.09Å
49	E	86.7	Confident	84.8	Confident	117 Å²	117	102.2 Å²	102.2	55%	0.547	52%	0.524	S	S	.	.	H	α-helix	trans	-60.2	-44.4	179	-72.3	173.3	168.4	0	0	111.9	M45 S46 Q52 A53	M45-E49 WeakPolarHBondContact O-CG 3.21Å; M45-E49 PolarHBondContact O-N 3.25Å; S46-E49 PolarHBondContact O-N 3.41Å; E49-Q52 PolarHBondContact O-N 3.43Å; E49-A53 PolarHBondContact O-N 3.04Å
50	N	85.1	Confident	84.6	Confident	92 Å²	92	104.8 Å²	104.8	49%	0.492	54%	0.536	S	S	.	.	H	α-helix	trans	-62.3	-45.1	178	-69.6	-28.8	0	0	0	111.9	S46 W47 I48 Q52 A53 D54	S46-N50 PolarHBondContact O-N 3.45Å; S46-N50 PolarHBondContact O-ND2 2.95Å; S46-N50 VanDerWaalsContact O-ND2 3.1Å; W47-N50 PolarHBondContact O-N 3.43Å; I48-N50 PolarHBondContact O-N 3.43Å; N50-Q52 VanDerWaalsContact C-N 3.31Å; N50-Q52 PolarHBondContact O-N 3.45Å; N50-A53 PolarHBondContact O-N 3.01Å; N50-D54 PolarHBondContact O-N 3.34Å
51	N	84.4	Confident	84.4	Confident	65 Å²	65	103 Å²	103	35%	0.348	53%	0.532	S	S	.	.	H	α-helix	trans	-64.5	-36.1	178.1	-74.4	-19.2	0	0	0	112.7	W47 I48 L55	W47-N51 WeakPolarHBondContact CH2-ND2 3.32Å; W47-N51 WeakPolarHBondContact CZ2-ND2 3.27Å; W47-N51 WeakPolarHBondContact CZ3-ND2 3.32Å; W47-N51 PolarHBondContact O-N 3.28Å; W47-N51 VanDerWaalsContact O-N 3.13Å; I48-N51 PolarHBondContact O-N 2.98Å; N51-L55 PolarHBondContact O-N 3.47Å; N51-L55 VanDerWaalsContact O-N 3.09Å
52	Q	86.3	Confident	83.9	Confident	111 Å²	111	101.5 Å²	101.5	52%	0.519	53%	0.528	S	S	.	.	H	α-helix	trans	-64.4	-45.5	176.1	-175.6	-178	-31.7	0	0	110.7	I48 E49 N50 D54 L55 E56	I48-Q52 PolarHBondContact O-N 3.09Å; E49-Q52 PolarHBondContact O-N 3.43Å; N50-Q52 VanDerWaalsContact C-N 3.31Å; N50-Q52 PolarHBondContact O-N 3.45Å; Q52-D54 VanDerWaalsContact C-N 3.34Å; Q52-D54 PolarHBondContact O-N 3Å; Q52-L55 PolarHBondContact O-N 3.22Å; Q52-E56 PolarHBondContact NE2-OE1 3.13Å; Q52-E56 WeakPolarHBondContact O-CG 3.26Å; Q52-E56 PolarHBondContact O-N 3.06Å
53	A	86.8	Confident	83.5	Confident	52 Å²	52	96.8 Å²	96.8	43%	0.43	51%	0.511	S	S	.	.	H	α-helix	trans	-61.2	-40.5	177.7	0	0	0	0	0	112.6	E49 N50 E56 N57	E49-A53 PolarHBondContact O-N 3.04Å; N50-A53 PolarHBondContact O-N 3.01Å; A53-E56 PolarHBondContact O-N 3.31Å; A53-N57 WeakPolarHBondContact O-CB 3.25Å; A53-N57 PolarHBondContact O-N 3.5Å
54	D	87.1	Confident	82.9	Confident	114 Å²	114	90.6 Å²	90.6	61%	0.61	49%	0.486	S	S	*	.	H	α-helix	trans	-63.5	-42.5	176	-76.7	-18	0	0	0	111.9	N50 Q52 N57 A58	N50-D54 PolarHBondContact O-N 3.34Å; Q52-D54 VanDerWaalsContact C-N 3.34Å; Q52-D54 PolarHBondContact O-N 3Å; D54-N57 PolarHBondContact O-N 3.32Å; D54-A58 WeakPolarHBondContact O-CB 2.81Å; D54-A58 PolarHBondContact O-N 2.96Å
55	L	85.8	Confident	82.2	Confident	118 Å²	118	92.8 Å²	92.8	62%	0.618	49%	0.488	S	S	*	.	H	α-helix	trans	-65.8	-42.1	177.6	-179.8	63.2	0	0	0	112.2	N51 Q52 A58 T59	N51-L55 PolarHBondContact O-N 3.47Å; N51-L55 VanDerWaalsContact O-N 3.09Å; Q52-L55 PolarHBondContact O-N 3.22Å; L55-A58 PolarHBondContact O-N 3.06Å; L55-T59 WeakPolarHBondContact O-CB 3.37Å; L55-T59 PolarHBondContact O-N 3.3Å; L55-T59 PolarHBondContact O-OG1 3.1Å
56	E	88.7	Confident	81.2	Confident	113 Å²	113	92.1 Å²	92.1	53%	0.528	49%	0.486	S	S	.	.	H	α-helix	trans	-60.5	-45.5	175.8	-75.2	175.9	-169.1	0	0	110.9	Q52 A53 T59 E60	Q52-E56 PolarHBondContact NE2-OE1 3.13Å; Q52-E56 WeakPolarHBondContact O-CG 3.26Å; Q52-E56 PolarHBondContact O-N 3.06Å; A53-E56 PolarHBondContact O-N 3.31Å; E56-T59 PolarHBondContact O-N 3.04Å; E56-E60 PolarHBondContact O-N 3.05Å
57	N	88.1	Confident	80.3	Confident	105 Å²	105	96.4 Å²	96.4	56%	0.561	50%	0.501	S	S	*	.	H	α-helix	trans	-61.7	-47.6	176.8	-170	-42.2	0	0	0	112	A53 D54 T59 E60 V61	A53-N57 WeakPolarHBondContact O-CB 3.25Å; A53-N57 PolarHBondContact O-N 3.5Å; D54-N57 PolarHBondContact O-N 3.32Å; N57-T59 PolarHBondContact O-N 3.46Å; N57-E60 PolarHBondContact O-N 3.41Å; N57-V61 WeakPolarHBondContact O-CG2 3.37Å; N57-V61 PolarHBondContact O-N 3.01Å
58	A	83	Confident	79.3	Confident	59 Å²	59	98.6 Å²	98.6	49%	0.488	51%	0.509	S	S	.	.	H	α-helix	trans	-59.6	-36.9	177.3	0	0	0	0	0	112.3	D54 L55 L62	D54-A58 WeakPolarHBondContact O-CB 2.81Å; D54-A58 PolarHBondContact O-N 2.96Å; L55-A58 PolarHBondContact O-N 3.06Å; A58-L62 WeakPolarHBondContact O-CB 3.24Å; A58-L62 PolarHBondContact O-N 3.36Å; A58-L62 VanDerWaalsContact O-N 3.11Å
59	T	82.4	Confident	77.6	Confident	83 Å²	83	99.5 Å²	99.5	51%	0.509	52%	0.515	S	S	.	.	H	α-helix	trans	-68.3	-43.9	176.9	-56.9	0	0	0	0	111.5	L55 E56 N57 L62 S63	L55-T59 WeakPolarHBondContact O-CB 3.37Å; L55-T59 PolarHBondContact O-N 3.3Å; L55-T59 PolarHBondContact O-OG1 3.1Å; E56-T59 PolarHBondContact O-N 3.04Å; N57-T59 PolarHBondContact O-N 3.46Å; T59-L62 PolarHBondContact O-N 3.36Å; T59-S63 PolarHBondContact O-N 3.03Å
60	E	84.6	Confident	75.9	Confident	137 Å²	137	98 Å²	98	64%	0.64	51%	0.509	S	S	*	.	H	α-helix	trans	-64.2	-42.8	178.1	-172.7	62.5	-156.1	0	0	111.8	E56 N57 L62 S63 G64	E56-E60 PolarHBondContact O-N 3.05Å; N57-E60 PolarHBondContact O-N 3.41Å; E60-L62 VanDerWaalsContact C-N 3.33Å; E60-L62 PolarHBondContact O-N 3.29Å; E60-S63 PolarHBondContact O-N 3.47Å; E60-G64 PolarHBondContact O-N 3.06Å
61	V	78.9	Confident	74.3	Confident	95 Å²	95	98 Å²	98	58%	0.576	52%	0.517	S	S	*	.	H	α-helix	trans	-60.9	-43.5	175.4	171	0	0	0	0	111	N57 G64 Y65	N57-V61 WeakPolarHBondContact O-CG2 3.37Å; N57-V61 PolarHBondContact O-N 3.01Å; V61-G64 PolarHBondContact O-N 3.41Å; V61-Y65 WeakPolarHBondContact O-CB 3.21Å; V61-Y65 PolarHBondContact O-N 3.36Å
62	L	73.4	Confident	72.8	Confident	102 Å²	102	103.7 Å²	103.7	53%	0.534	54%	0.541	S	S	.	.	H	α-helix	trans	-65.7	-42.2	176.6	-178.8	62.9	0	0	0	111.7	A58 T59 E60 Y65 L66	A58-L62 WeakPolarHBondContact O-CB 3.24Å; A58-L62 PolarHBondContact O-N 3.36Å; A58-L62 VanDerWaalsContact O-N 3.11Å; T59-L62 PolarHBondContact O-N 3.36Å; E60-L62 VanDerWaalsContact C-N 3.33Å; E60-L62 PolarHBondContact O-N 3.29Å; L62-Y65 PolarHBondContact O-N 3.08Å; L62-L66 HydrophobicContact CD1-CD1 4.35Å; L62-L66 HydrophobicContact CD1-CG 4.39Å; L62-L66 HydrophobicContact CG-CD1 4.13Å; L62-L66 VanDerWaalsContact O-CG 3.26Å; L62-L66 WeakPolarHBondContact O-CG 3.38Å; L62-L66 PolarHBondContact O-N 3.46Å
63	S	75.5	Confident	71.2	Confident	43 Å²	43	105.9 Å²	105.9	30%	0.301	56%	0.557	S	S	.	*	H	α-helix	trans	-60.9	-48.2	175.4	-157	0	0	0	0	110.8	T59 E60 Y65 L66 E67	T59-S63 PolarHBondContact O-N 3.03Å; E60-S63 PolarHBondContact O-N 3.47Å; S63-Y65 VanDerWaalsContact C-N 3.29Å; S63-Y65 PolarHBondContact O-N 3.26Å; S63-L66 PolarHBondContact O-N 3.05Å; S63-L66 VanDerWaalsContact O-N 3.15Å; S63-E67 WeakPolarHBondContact O-CB 3.42Å; S63-E67 VanDerWaalsContact O-CG 3.27Å; S63-E67 WeakPolarHBondContact O-CG 3.46Å; S63-E67 PolarHBondContact O-N 3.01Å; S63-E67 PolarHBondContact OG-OE1 3.1Å
64	G	71.6	Confident	70	Confident	14 Å²	14	105.6 Å²	105.6	14%	0.144	55%	0.551	C	S	.	*	H	α-helix	trans	-61.7	-35.3	177	0	0	0	0	0	113.2	E60 V61 R68	E60-G64 PolarHBondContact O-N 3.06Å; V61-G64 PolarHBondContact O-N 3.41Å; G64-R68 VanDerWaalsContact O-CB 3.24Å; G64-R68 WeakPolarHBondContact O-CB 3.42Å; G64-R68 WeakPolarHBondContact O-CG 3.42Å; G64-R68 PolarHBondContact O-N 3.4Å
65	Y	67.6	Low	68.8	Low	137 Å²	137	106.8 Å²	106.8	54%	0.537	56%	0.557	S	S	.	*	H	α-helix	trans	-65.7	-46.8	173.1	-172.1	-101.8	0	0	0	111.4	V61 L62 S63 E67 R68 D69	V61-Y65 WeakPolarHBondContact O-CB 3.21Å; V61-Y65 PolarHBondContact O-N 3.36Å; L62-Y65 PolarHBondContact O-N 3.08Å; S63-Y65 VanDerWaalsContact C-N 3.29Å; S63-Y65 PolarHBondContact O-N 3.26Å; Y65-E67 VanDerWaalsContact C-N 3.3Å; Y65-E67 PolarHBondContact O-N 3.18Å; Y65-R68 PolarHBondContact O-N 3.21Å; Y65-D69 HydrophobicContact CE1-CB 4.37Å; Y65-D69 HydrophobicContact CE2-CB 4.22Å; Y65-D69 WeakPolarHBondContact CE2-OD2 3.46Å; Y65-D69 WeakPolarHBondContact O-CB 3.39Å; Y65-D69 PolarHBondContact O-N 2.99Å; Y65-D69 PolarHBondContact OH-OD2 3.37Å
66	L	57.1	Low	67.6	Low	91 Å²	91	109 Å²	109	48%	0.476	56%	0.564	S	S	.	*	H	α-helix	trans	-66.3	-31.5	177.6	-67.3	171.8	0	0	0	112.7	L62 S63 I70	L62-L66 HydrophobicContact CD1-CD1 4.35Å; L62-L66 HydrophobicContact CD1-CG 4.39Å; L62-L66 HydrophobicContact CG-CD1 4.13Å; L62-L66 VanDerWaalsContact O-CG 3.26Å; L62-L66 WeakPolarHBondContact O-CG 3.38Å; L62-L66 PolarHBondContact O-N 3.46Å; S63-L66 PolarHBondContact O-N 3.05Å; S63-L66 VanDerWaalsContact O-N 3.15Å; L66-I70 HydrophobicContact CD2-CD1 4.31Å; L66-I70 WeakPolarHBondContact O-CB 3.37Å; L66-I70 WeakPolarHBondContact O-CD1 3.2Å; L66-I70 VanDerWaalsContact O-CG1 3.25Å; L66-I70 WeakPolarHBondContact O-CG1 3.4Å
67	E	66.5	Low	66.5	Low	142 Å²	142	108.2 Å²	108.2	66%	0.664	56%	0.563	S	S	*	*	H	α-helix	trans	-79.5	-28.5	177.7	-72.7	170.4	-151.7	0	0	113.1	S63 Y65	S63-E67 WeakPolarHBondContact O-CB 3.42Å; S63-E67 VanDerWaalsContact O-CG 3.27Å; S63-E67 WeakPolarHBondContact O-CG 3.46Å; S63-E67 PolarHBondContact O-N 3.01Å; S63-E67 PolarHBondContact OG-OE1 3.1Å; Y65-E67 VanDerWaalsContact C-N 3.3Å; Y65-E67 PolarHBondContact O-N 3.18Å
68	R	60.5	Low	65.6	Low	203 Å²	203	106.8 Å²	106.8	77%	0.766	56%	0.555	S	S	*	*	H	α-helix	trans	-98.9	-35.8	-176.8	-66.4	175.9	-171.7	175.1	5.9	114.2	G64 Y65	G64-R68 VanDerWaalsContact O-CB 3.24Å; G64-R68 WeakPolarHBondContact O-CB 3.42Å; G64-R68 WeakPolarHBondContact O-CG 3.42Å; G64-R68 PolarHBondContact O-N 3.4Å; Y65-R68 PolarHBondContact O-N 3.21Å
69	D	50.1	Low	65	Low	97 Å²	97	110.5 Å²	110.5	52%	0.519	56%	0.56	S	S	.	*	S	Bend	trans	-88.9	-0.1	-179.5	-80.7	16.4	0	0	0	113.1	Y65	Y65-D69 HydrophobicContact CE1-CB 4.37Å; Y65-D69 HydrophobicContact CE2-CB 4.22Å; Y65-D69 WeakPolarHBondContact CE2-OD2 3.46Å; Y65-D69 WeakPolarHBondContact O-CB 3.39Å; Y65-D69 PolarHBondContact O-N 2.99Å; Y65-D69 PolarHBondContact OH-OD2 3.37Å
70	I	49.8	Very low	64.5	Low	85 Å²	85	110.7 Å²	110.7	44%	0.436	56%	0.555	S	S	.	*			trans	-101.3	58.7	170.8	-59	178.4	0	0	0	110.4	L66	L66-I70 HydrophobicContact CD2-CD1 4.31Å; L66-I70 WeakPolarHBondContact O-CB 3.37Å; L66-I70 WeakPolarHBondContact O-CD1 3.2Å; L66-I70 VanDerWaalsContact O-CG1 3.25Å; L66-I70 WeakPolarHBondContact O-CG1 3.4Å
71	S	53.1	Low	63.7	Low	93 Å²	93	110.9 Å²	110.9	65%	0.65	55%	0.554	S	S	*	*			trans	-123.9	122.5	152.8	72.4	0	0	0	0	106.6
72	Q	52.3	Low	63.1	Low	183 Å²	183	110.7 Å²	110.7	86%	0.855	55%	0.553	S	S	*	*	S	Bend	cis	-152.4	9.6	45	-79.5	-175.7	-80.8	0	0	117
73	D	53.1	Low	62.8	Low	158 Å²	158	109.2 Å²	109.2	85%	0.845	54%	0.543	S	S	*	.	S	Bend	trans	-129.8	-8.7	-168.5	-87.9	-32.7	0	0	0	120.3
74	S	60.4	Low	62.7	Low	45 Å²	45	110.6 Å²	110.6	32%	0.315	55%	0.547	S	S	.	.			trans	-126.4	0.3	-149	72.3	0	0	0	0	120.7	Q76 D77 I78	S74-Q76 VanDerWaalsContact C-N 3.31Å; S74-Q76 PolarHBondContact O-N 3.14Å; S74-D77 PolarHBondContact O-N 3.48Å; S74-D77 VanDerWaalsContact O-N 3.13Å; S74-I78 WeakPolarHBondContact O-CB 3.3Å; S74-I78 VanDerWaalsContact O-CG1 3.31Å; S74-I78 WeakPolarHBondContact O-CG1 3.01Å; S74-I78 PolarHBondContact O-N 3.43Å; S74-I78 WeakPolarHBondContact OG-CD1 3.46Å
75	L	61.8	Low	62.3	Low	140 Å²	140	117 Å²	117	73%	0.733	57%	0.571	S	S	*	*	H	α-helix	trans	-60.9	-39.1	-172.8	-164.3	80.1	0	0	0	113	K79	L75-K79 WeakPolarHBondContact O-CB 3.16Å; L75-K79 PolarHBondContact O-N 3.3Å
76	Q	61.8	Low	62.5	Low	164 Å²	164	118 Å²	118	77%	0.766	58%	0.575	S	S	*	*	H	α-helix	trans	-68.3	-41	176.9	-174.8	172	-12.9	0	0	111.8	S74 K79 Q80	S74-Q76 VanDerWaalsContact C-N 3.31Å; S74-Q76 PolarHBondContact O-N 3.14Å; Q76-K79 PolarHBondContact O-N 2.96Å; Q76-Q80 VanDerWaalsContact O-CB 3.32Å; Q76-Q80 WeakPolarHBondContact O-CB 3.5Å; Q76-Q80 PolarHBondContact O-N 3.41Å
77	D	65.5	Low	63.4	Low	96 Å²	96	119.8 Å²	119.8	51%	0.513	58%	0.575	S	S	.	*	H	α-helix	trans	-70.4	-37	178.6	-75	-14.1	0	0	0	112.7	S74 Q80 K81	S74-D77 PolarHBondContact O-N 3.48Å; S74-D77 VanDerWaalsContact O-N 3.13Å; D77-Q80 PolarHBondContact O-N 2.91Å; D77-K81 VanDerWaalsContact O-CB 3.31Å; D77-K81 WeakPolarHBondContact O-CB 3.41Å; D77-K81 VanDerWaalsContact O-CG 3.25Å; D77-K81 WeakPolarHBondContact O-CG 3.03Å; D77-K81 PolarHBondContact O-N 3.03Å
78	I	69.4	Low	63.4	Low	75 Å²	75	119.5 Å²	119.5	39%	0.385	57%	0.569	S	S	.	*	H	α-helix	trans	-67.6	-46.5	173.7	-67.4	171.1	0	0	0	109.3	S74 Q80 K81 V82	S74-I78 WeakPolarHBondContact O-CB 3.3Å; S74-I78 VanDerWaalsContact O-CG1 3.31Å; S74-I78 WeakPolarHBondContact O-CG1 3.01Å; S74-I78 PolarHBondContact O-N 3.43Å; S74-I78 WeakPolarHBondContact OG-CD1 3.46Å; I78-Q80 VanDerWaalsContact C-N 3.28Å; I78-Q80 PolarHBondContact O-N 3.06Å; I78-K81 PolarHBondContact O-N 2.92Å; I78-V82 HydrophobicContact CG2-CG2 4.18Å; I78-V82 WeakPolarHBondContact O-CB 3.41Å; I78-V82 VanDerWaalsContact O-CG2 3.25Å; I78-V82 WeakPolarHBondContact O-CG2 3.44Å; I78-V82 PolarHBondContact O-N 3.1Å
79	K	70.3	Confident	63.3	Low	138 Å²	138	113.7 Å²	113.7	60%	0.6	56%	0.559	S	S	*	*	H	α-helix	trans	-58	-43	176	-172.6	179.2	-178	179.6	0	111.1	L75 Q76 Q83	L75-K79 WeakPolarHBondContact O-CB 3.16Å; L75-K79 PolarHBondContact O-N 3.3Å; Q76-K79 PolarHBondContact O-N 2.96Å; K79-Q83 WeakPolarHBondContact O-CB 3.46Å; K79-Q83 VanDerWaalsContact O-CG 3.26Å; K79-Q83 WeakPolarHBondContact O-CG 3.35Å; K79-Q83 PolarHBondContact O-N 2.91Å
80	Q	71.3	Confident	64.1	Low	87 Å²	87	111.4 Å²	111.4	41%	0.407	55%	0.545	S	S	.	.	H	α-helix	trans	-65.2	-49	177.1	-172.6	61.6	50.5	0	0	111.6	Q76 D77 I78 V82 Q83 D84	Q76-Q80 VanDerWaalsContact O-CB 3.32Å; Q76-Q80 WeakPolarHBondContact O-CB 3.5Å; Q76-Q80 PolarHBondContact O-N 3.41Å; D77-Q80 PolarHBondContact O-N 2.91Å; I78-Q80 VanDerWaalsContact C-N 3.28Å; I78-Q80 PolarHBondContact O-N 3.06Å; Q80-V82 VanDerWaalsContact C-N 3.34Å; Q80-V82 PolarHBondContact O-N 3.41Å; Q80-Q83 PolarHBondContact O-N 3.39Å; Q80-D84 VanDerWaalsContact NE2-CG 3.29Å; Q80-D84 PolarHBondContact NE2-OD1 3.22Å; Q80-D84 PolarHBondContact NE2-OD2 3.03Å; Q80-D84 WeakPolarHBondContact O-CB 3.38Å; Q80-D84 VanDerWaalsContact O-CG 3.23Å; Q80-D84 PolarHBondContact O-N 3.25Å
81	K	68.6	Low	65.2	Low	140 Å²	140	110.5 Å²	110.5	61%	0.609	55%	0.546	S	S	*	.	H	α-helix	trans	-60.8	-40	177.9	-77.5	172.1	178.7	172.2	0	112.7	D77 I78 K85	D77-K81 VanDerWaalsContact O-CB 3.31Å; D77-K81 WeakPolarHBondContact O-CB 3.41Å; D77-K81 VanDerWaalsContact O-CG 3.25Å; D77-K81 WeakPolarHBondContact O-CG 3.03Å; D77-K81 PolarHBondContact O-N 3.03Å; I78-K81 PolarHBondContact O-N 2.92Å; K81-K85 WeakPolarHBondContact O-CB 3.35Å; K81-K85 VanDerWaalsContact O-CG 3.3Å; K81-K85 WeakPolarHBondContact O-CG 3.43Å; K81-K85 PolarHBondContact O-N 3.17Å
82	V	65.9	Low	66.2	Low	92 Å²	92	112.8 Å²	112.8	56%	0.558	54%	0.541	S	S	*	.	H	α-helix	trans	-68	-44.9	176.6	170.4	0	0	0	0	110.5	I78 Q80 D84 K85 Y86	I78-V82 HydrophobicContact CG2-CG2 4.18Å; I78-V82 WeakPolarHBondContact O-CB 3.41Å; I78-V82 VanDerWaalsContact O-CG2 3.25Å; I78-V82 WeakPolarHBondContact O-CG2 3.44Å; I78-V82 PolarHBondContact O-N 3.1Å; Q80-V82 VanDerWaalsContact C-N 3.34Å; Q80-V82 PolarHBondContact O-N 3.41Å; V82-D84 VanDerWaalsContact C-N 3.33Å; V82-D84 PolarHBondContact O-N 3.33Å; V82-K85 PolarHBondContact O-N 3.47Å; V82-Y86 VanDerWaalsContact O-CB 3.32Å; V82-Y86 WeakPolarHBondContact O-CB 3.37Å; V82-Y86 PolarHBondContact O-N 2.93Å
83	Q	67.5	Low	66.8	Low	70 Å²	70	110 Å²	110	33%	0.327	52%	0.522	S	S	.	.	H	α-helix	trans	-61.3	-41.6	176	-78.7	-172.8	-1.5	0	0	112.1	K79 Q80 Y86 R87	K79-Q83 WeakPolarHBondContact O-CB 3.46Å; K79-Q83 VanDerWaalsContact O-CG 3.26Å; K79-Q83 WeakPolarHBondContact O-CG 3.35Å; K79-Q83 PolarHBondContact O-N 2.91Å; Q80-Q83 PolarHBondContact O-N 3.39Å; Q83-Y86 PolarHBondContact O-N 3.02Å; Q83-R87 WeakPolarHBondContact O-CB 3.43Å; Q83-R87 WeakPolarHBondContact O-CG 3.49Å; Q83-R87 PolarHBondContact O-N 3.38Å
84	D	72.9	Confident	67.8	Low	72 Å²	72	110.4 Å²	110.4	39%	0.385	51%	0.512	S	S	.	.	H	α-helix	trans	-69.2	-40.2	-180	-67.9	-24.1	0	0	0	112	Q80 V82 R87 Y88	Q80-D84 VanDerWaalsContact NE2-CG 3.29Å; Q80-D84 PolarHBondContact NE2-OD1 3.22Å; Q80-D84 PolarHBondContact NE2-OD2 3.03Å; Q80-D84 WeakPolarHBondContact O-CB 3.38Å; Q80-D84 VanDerWaalsContact O-CG 3.23Å; Q80-D84 PolarHBondContact O-N 3.25Å; V82-D84 VanDerWaalsContact C-N 3.33Å; V82-D84 PolarHBondContact O-N 3.33Å; D84-R87 PolarHBondContact O-N 3.11Å; D84-R87 IonicContact OD1-CZ 3.99Å; D84-R87 IonicContact OD1-NH1 2.8Å; D84-R87 PolarHBondContact OD1-NH1 3.25Å; D84-Y88 WeakPolarHBondContact O-CB 3.42Å; D84-Y88 PolarHBondContact O-N 3.27Å
85	K	62.5	Low	68.2	Low	150 Å²	150	112.4 Å²	112.4	65%	0.652	52%	0.522	S	S	*	.	H	α-helix	trans	-64.1	-42.8	172.8	-74.9	-178.9	-177	-64.4	0	112.1	K81 V82 Y88 C89	K81-K85 WeakPolarHBondContact O-CB 3.35Å; K81-K85 VanDerWaalsContact O-CG 3.3Å; K81-K85 WeakPolarHBondContact O-CG 3.43Å; K81-K85 PolarHBondContact O-N 3.17Å; V82-K85 PolarHBondContact O-N 3.47Å; K85-Y88 PolarHBondContact O-N 2.89Å; K85-C89 PolarHBondContact O-N 3.24Å; K85-C89 PolarHBondContact O-SG 3.3Å; K85-C89 VanDerWaalsContact O-SG 3.34Å
86	Y	72	Confident	68.1	Low	158 Å²	158	111 Å²	111	62%	0.62	52%	0.515	S	S	*	.	H	α-helix	trans	-61.4	-49.2	175.7	170.3	-99.4	0	0	0	111.7	V82 Q83 Y88 C89 E90	V82-Y86 VanDerWaalsContact O-CB 3.32Å; V82-Y86 WeakPolarHBondContact O-CB 3.37Å; V82-Y86 PolarHBondContact O-N 2.93Å; Q83-Y86 PolarHBondContact O-N 3.02Å; Y86-Y88 VanDerWaalsContact C-N 3.26Å; Y86-Y88 PolarHBondContact O-N 3.02Å; Y86-C89 PolarHBondContact O-N 3.45Å; Y86-E90 WeakPolarHBondContact O-CB 3.28Å; Y86-E90 PolarHBondContact O-N 3.31Å
87	R	76.6	Confident	68.4	Low	127 Å²	127	107.3 Å²	107.3	48%	0.479	50%	0.5	S	S	.	.	H	α-helix	trans	-56.8	-40.9	176.9	-74.5	172.7	-170.7	130	5.8	111.6	Q83 D84 S91	Q83-R87 WeakPolarHBondContact O-CB 3.43Å; Q83-R87 WeakPolarHBondContact O-CG 3.49Å; Q83-R87 PolarHBondContact O-N 3.38Å; D84-R87 PolarHBondContact O-N 3.11Å; D84-R87 IonicContact OD1-CZ 3.99Å; D84-R87 IonicContact OD1-NH1 2.8Å; D84-R87 PolarHBondContact OD1-NH1 3.25Å; R87-S91 WeakPolarHBondContact O-CB 3.32Å; R87-S91 PolarHBondContact O-N 2.94Å
88	Y	66.9	Low	68.7	Low	137 Å²	137	108.2 Å²	108.2	54%	0.537	50%	0.501	S	S	.	.	H	α-helix	trans	-65.4	-48.4	177.1	179.3	-104.3	0	0	0	112.2	D84 K85 Y86 E90 S91 R92	D84-Y88 WeakPolarHBondContact O-CB 3.42Å; D84-Y88 PolarHBondContact O-N 3.27Å; K85-Y88 PolarHBondContact O-N 2.89Å; Y86-Y88 VanDerWaalsContact C-N 3.26Å; Y86-Y88 PolarHBondContact O-N 3.02Å; Y88-E90 VanDerWaalsContact C-N 3.31Å; Y88-E90 PolarHBondContact O-N 3.19Å; Y88-S91 PolarHBondContact O-N 3.37Å; Y88-R92 HydrophobicContact CD1-CG 4.39Å; Y88-R92 HydrophobicContact CD2-CG 4.46Å; Y88-R92 HydrophobicContact CE1-CG 3.95Å; Y88-R92 HydrophobicContact CE2-CG 4.01Å; Y88-R92 WeakPolarHBondContact O-CG 3.45Å; Y88-R92 PolarHBondContact O-N 3.46Å; Y88-R92 PolarHBondContact OH-NH1 3.16Å
89	C	57.1	Low	68.7	Low	81 Å²	81	109.6 Å²	109.6	55%	0.547	51%	0.505	S	S	.	.	H	α-helix	trans	-59.1	-42.7	177.2	-70.5	0	0	0	0	112	K85 Y86 R92 R93	K85-C89 PolarHBondContact O-N 3.24Å; K85-C89 PolarHBondContact O-SG 3.3Å; K85-C89 VanDerWaalsContact O-SG 3.34Å; Y86-C89 PolarHBondContact O-N 3.45Å; C89-R92 PolarHBondContact O-N 3.17Å; C89-R93 WeakPolarHBondContact O-CB 3.45Å; C89-R93 PolarHBondContact O-N 3.41Å
90	E	68.3	Low	68.3	Low	49 Å²	49	105.4 Å²	105.4	23%	0.229	49%	0.491	C	S	.	.	H	α-helix	trans	-66	-40.3	178.3	-179.9	56	-161.7	0	0	112.2	Y86 Y88 R93 R94	Y86-E90 WeakPolarHBondContact O-CB 3.28Å; Y86-E90 PolarHBondContact O-N 3.31Å; Y88-E90 VanDerWaalsContact C-N 3.31Å; Y88-E90 PolarHBondContact O-N 3.19Å; E90-R93 PolarHBondContact O-N 2.85Å; E90-R93 IonicContact OE1-CZ 3.99Å; E90-R93 IonicContact OE1-NE 3.59Å; E90-R93 IonicContact OE1-NH2 3.64Å; E90-R93 PolarHBondContact OE1-NH2 3.39Å; E90-R93 IonicContact OE2-CZ 2.71Å; E90-R93 IonicContact OE2-NE 3.52Å; E90-R93 PolarHBondContact OE2-NE 2.89Å; E90-R93 IonicContact OE2-NH2 2.82Å; E90-R93 PolarHBondContact OE2-NH2 3.37Å; E90-R94 WeakPolarHBondContact O-CG 3.39Å; E90-R94 PolarHBondContact O-N 2.97Å; E90-R94 IonicContact OE1-NE 3.53Å; E90-R94 PolarHBondContact OE1-NE 2.94Å
91	S	72.8	Confident	68.1	Low	65 Å²	65	106.5 Å²	106.5	46%	0.455	50%	0.496	S	S	.	.	H	α-helix	trans	-60.3	-46.5	173.5	-179.8	0	0	0	0	111.8	R87 Y88 R93 R94 V95	R87-S91 WeakPolarHBondContact O-CB 3.32Å; R87-S91 PolarHBondContact O-N 2.94Å; Y88-S91 PolarHBondContact O-N 3.37Å; S91-R93 PolarHBondContact O-N 3.12Å; S91-R94 PolarHBondContact O-N 3.31Å; S91-V95 WeakPolarHBondContact O-CG2 3.49Å; S91-V95 PolarHBondContact O-N 3.39Å; S91-V95 VanDerWaalsContact O-N 3.09Å
92	R	73.7	Confident	67.9	Low	142 Å²	142	103 Å²	103	54%	0.536	48%	0.482	S	S	.	.	H	α-helix	trans	-65.2	-39.4	178.5	-67	-56.5	-58.5	-104.3	1.1	112.6	Y88 C89 R94 V95 L96	Y88-R92 HydrophobicContact CD1-CG 4.39Å; Y88-R92 HydrophobicContact CD2-CG 4.46Å; Y88-R92 HydrophobicContact CE1-CG 3.95Å; Y88-R92 HydrophobicContact CE2-CG 4.01Å; Y88-R92 WeakPolarHBondContact O-CG 3.45Å; Y88-R92 PolarHBondContact O-N 3.46Å; Y88-R92 PolarHBondContact OH-NH1 3.16Å; C89-R92 PolarHBondContact O-N 3.17Å; R92-R94 VanDerWaalsContact C-N 3.34Å; R92-V95 PolarHBondContact O-N 2.96Å; R92-L96 WeakPolarHBondContact O-CB 3.15Å; R92-L96 PolarHBondContact O-N 3.28Å
93	R	65.3	Low	67.9	Low	124 Å²	124	98.7 Å²	98.7	47%	0.468	46%	0.456	S	S	.	.	H	α-helix	trans	-60.2	-44.8	175	-171.3	-170	71	81.9	3	111.2	C89 E90 S91 L96 L97	C89-R93 WeakPolarHBondContact O-CB 3.45Å; C89-R93 PolarHBondContact O-N 3.41Å; E90-R93 PolarHBondContact O-N 2.85Å; E90-R93 IonicContact OE1-CZ 3.99Å; E90-R93 IonicContact OE1-NE 3.59Å; E90-R93 IonicContact OE1-NH2 3.64Å; E90-R93 PolarHBondContact OE1-NH2 3.39Å; E90-R93 IonicContact OE2-CZ 2.71Å; E90-R93 IonicContact OE2-NE 3.52Å; E90-R93 PolarHBondContact OE2-NE 2.89Å; E90-R93 IonicContact OE2-NH2 2.82Å; E90-R93 PolarHBondContact OE2-NH2 3.37Å; S91-R93 PolarHBondContact O-N 3.12Å; R93-L96 PolarHBondContact O-N 2.91Å; R93-L97 HydrophobicContact CG-CD1 4.08Å; R93-L97 WeakPolarHBondContact O-CB 3.38Å; R93-L97 WeakPolarHBondContact O-CG 3.39Å; R93-L97 PolarHBondContact O-N 3.43Å
94	R	72.9	Confident	67.5	Low	167 Å²	167	101.3 Å²	101.3	63%	0.63	46%	0.464	S	S	*	.	H	α-helix	trans	-60.6	-48.1	177	-76.5	176.8	167	-139.4	-5.1	112.3	E90 S91 R92 L96 L97 Q98	E90-R94 WeakPolarHBondContact O-CG 3.39Å; E90-R94 PolarHBondContact O-N 2.97Å; E90-R94 IonicContact OE1-NE 3.53Å; E90-R94 PolarHBondContact OE1-NE 2.94Å; S91-R94 PolarHBondContact O-N 3.31Å; R92-R94 VanDerWaalsContact C-N 3.34Å; R94-L96 VanDerWaalsContact C-N 3.34Å; R94-L96 PolarHBondContact O-N 3.46Å; R94-L97 PolarHBondContact O-N 3.37Å; R94-Q98 WeakPolarHBondContact O-CB 3.14Å; R94-Q98 PolarHBondContact O-N 3.4Å
95	V	70.2	Confident	67.3	Low	86 Å²	86	104.2 Å²	104.2	52%	0.521	48%	0.475	S	S	.	.	H	α-helix	trans	-61.4	-42.9	178.4	173.6	0	0	0	0	111.4	S91 R92 Q98 H99	S91-V95 WeakPolarHBondContact O-CG2 3.49Å; S91-V95 PolarHBondContact O-N 3.39Å; S91-V95 VanDerWaalsContact O-N 3.09Å; R92-V95 PolarHBondContact O-N 2.96Å; V95-Q98 PolarHBondContact O-N 3.42Å; V95-H99 WeakPolarHBondContact O-CB 3.46Å; V95-H99 PolarHBondContact O-N 3.46Å
96	L	59.3	Low	67.8	Low	111 Å²	111	103.1 Å²	103.1	58%	0.581	47%	0.47	S	S	*	.	H	α-helix	trans	-62.6	-47.9	177.7	179.1	63.4	0	0	0	111.7	R92 R93 R94 Q98 H99 V100	R92-L96 WeakPolarHBondContact O-CB 3.15Å; R92-L96 PolarHBondContact O-N 3.28Å; R93-L96 PolarHBondContact O-N 2.91Å; R94-L96 VanDerWaalsContact C-N 3.34Å; R94-L96 PolarHBondContact O-N 3.46Å; L96-Q98 VanDerWaalsContact C-N 3.32Å; L96-Q98 PolarHBondContact O-N 3.32Å; L96-H99 PolarHBondContact O-N 2.97Å; L96-V100 HydrophobicContact CD1-CG2 4.41Å; L96-V100 WeakPolarHBondContact O-CG2 3.49Å; L96-V100 PolarHBondContact O-N 3.25Å
97	L	66.4	Low	67.8	Low	87 Å²	87	102.3 Å²	102.3	46%	0.455	48%	0.477	S	S	.	.	H	α-helix	trans	-64.7	-38	179.3	-73	172.5	0	0	0	112.2	R93 R94 V100 H101	R93-L97 HydrophobicContact CG-CD1 4.08Å; R93-L97 WeakPolarHBondContact O-CB 3.38Å; R93-L97 WeakPolarHBondContact O-CG 3.39Å; R93-L97 PolarHBondContact O-N 3.43Å; R94-L97 PolarHBondContact O-N 3.37Å; L97-V100 PolarHBondContact O-N 2.91Å; L97-H101 VanDerWaalsContact O-CB 3.28Å; L97-H101 WeakPolarHBondContact O-CB 3.21Å; L97-H101 PolarHBondContact O-N 3Å
98	Q	73.1	Confident	67.1	Low	114 Å²	114	102 Å²	102	53%	0.533	48%	0.484	S	S	.	.	H	α-helix	trans	-61.2	-46.1	173.5	179.9	172	-3.7	0	0	111.1	R94 V95 L96 V100 H101 E102	R94-Q98 WeakPolarHBondContact O-CB 3.14Å; R94-Q98 PolarHBondContact O-N 3.4Å; V95-Q98 PolarHBondContact O-N 3.42Å; L96-Q98 VanDerWaalsContact C-N 3.32Å; L96-Q98 PolarHBondContact O-N 3.32Å; Q98-V100 PolarHBondContact O-N 2.89Å; Q98-H101 PolarHBondContact O-N 2.87Å; Q98-E102 HydrophobicContact CG-CG 4.42Å; Q98-E102 WeakPolarHBondContact CG-OE1 3.3Å; Q98-E102 PolarHBondContact NE2-OE1 3.08Å; Q98-E102 WeakPolarHBondContact O-CB 3.42Å; Q98-E102 WeakPolarHBondContact O-CG 3.49Å; Q98-E102 PolarHBondContact O-N 3.37Å
99	H	68.6	Low	67	Low	104 Å²	104	101 Å²	101	48%	0.481	48%	0.479	S	S	.	.	H	α-helix	trans	-64.4	-41.1	178.2	-175.2	-125.4	0	0	0	112.8	V95 L96 E102 G103 W109	V95-H99 WeakPolarHBondContact O-CB 3.46Å; V95-H99 PolarHBondContact O-N 3.46Å; L96-H99 PolarHBondContact O-N 2.97Å; H99-E102 PolarHBondContact O-N 3.41Å; H99-G103 PolarHBondContact O-N 3.34Å; H99-W109 AromaticContact CE1-CH2 3.71Å; H99-W109 AromaticContact CE1-CZ2 3.9Å
100	V	61.4	Low	67	Low	50 Å²	50	105.8 Å²	105.8	30%	0.303	49%	0.494	S	S	.	.	H	α-helix	trans	-61.2	-46.8	174.4	169.3	0	0	0	0	110.3	L96 L97 Q98 G103 Y104 W109	L96-V100 HydrophobicContact CD1-CG2 4.41Å; L96-V100 WeakPolarHBondContact O-CG2 3.49Å; L96-V100 PolarHBondContact O-N 3.25Å; L97-V100 PolarHBondContact O-N 2.91Å; Q98-V100 PolarHBondContact O-N 2.89Å; V100-G103 PolarHBondContact O-N 2.92Å; V100-Y104 HydrophobicContact CG1-CD2 3.75Å; V100-Y104 HydrophobicContact CG1-CE2 3.44Å; V100-Y104 VanDerWaalsContact CG1-CE2 3.44Å; V100-Y104 VanDerWaalsContact O-CD2 3.23Å; V100-Y104 WeakPolarHBondContact O-CD2 3.31Å; V100-Y104 PolarHBondContact O-N 2.99Å; V100-W109 PolarHBondContact O-NE1 3.39Å
101	H	67.5	Low	66.4	Low	111 Å²	111	112.7 Å²	112.7	51%	0.514	52%	0.519	S	S	.	.	H	α-helix	trans	-62	-47.2	178.3	-170.6	58.4	0	0	0	112.2	L97 Q98 G103 Y104 E105	L97-H101 VanDerWaalsContact O-CB 3.28Å; L97-H101 WeakPolarHBondContact O-CB 3.21Å; L97-H101 PolarHBondContact O-N 3Å; Q98-H101 PolarHBondContact O-N 2.87Å; H101-G103 VanDerWaalsContact C-N 3.27Å; H101-G103 PolarHBondContact O-N 3.34Å; H101-Y104 PolarHBondContact O-N 3.18Å; H101-E105 IonicContact NE2-OE1 3.38Å; H101-E105 PolarHBondContact O-N 3.46Å
102	E	65.6	Low	65.5	Low	65 Å²	65	117.1 Å²	117.1	30%	0.304	54%	0.536	S	S	.	.	H	α-helix	trans	-59.6	-37.9	176.2	-75.9	178.2	-158.5	0	0	112.2	Q98 H99 E105 K106	Q98-E102 HydrophobicContact CG-CG 4.42Å; Q98-E102 WeakPolarHBondContact CG-OE1 3.3Å; Q98-E102 PolarHBondContact NE2-OE1 3.08Å; Q98-E102 WeakPolarHBondContact O-CB 3.42Å; Q98-E102 WeakPolarHBondContact O-CG 3.49Å; Q98-E102 PolarHBondContact O-N 3.37Å; H99-E102 PolarHBondContact O-N 3.41Å; E102-E105 PolarHBondContact O-N 2.88Å; E102-K106 WeakPolarHBondContact O-CB 3.49Å; E102-K106 VanDerWaalsContact O-CG 3.31Å; E102-K106 WeakPolarHBondContact O-CG 3.46Å; E102-K106 PolarHBondContact O-N 3.35Å
103	G	65.3	Low	64.1	Low	2 Å²	2	119.1 Å²	119.1	2%	0.021	55%	0.551	C	S	.	*	H	α-helix	trans	-73.4	-26.4	175.8	0	0	0	0	0	113.5	H99 V100 H101 D107 L108 W109	H99-G103 PolarHBondContact O-N 3.34Å; V100-G103 PolarHBondContact O-N 2.92Å; H101-G103 VanDerWaalsContact C-N 3.27Å; H101-G103 PolarHBondContact O-N 3.34Å; G103-D107 PolarHBondContact O-N 3.1Å; G103-L108 PolarHBondContact O-N 3.21Å; G103-W109 VanDerWaalsContact C-NE1 3.34Å
104	Y	60.1	Low	63.4	Low	125 Å²	125	124.3 Å²	124.3	49%	0.49	59%	0.588	S	S	.	*	H	α-helix	trans	-71.9	-40.7	168.1	-78.7	-62.2	0	0	0	111.9	V100 H101 K106 D107	V100-Y104 HydrophobicContact CG1-CD2 3.75Å; V100-Y104 HydrophobicContact CG1-CE2 3.44Å; V100-Y104 VanDerWaalsContact CG1-CE2 3.44Å; V100-Y104 VanDerWaalsContact O-CD2 3.23Å; V100-Y104 WeakPolarHBondContact O-CD2 3.31Å; V100-Y104 PolarHBondContact O-N 2.99Å; H101-Y104 PolarHBondContact O-N 3.18Å; Y104-K106 PolarHBondContact O-N 3.47Å; Y104-D107 PolarHBondContact O-N 3.44Å
105	E	68.6	Low	62.9	Low	134 Å²	134	122.2 Å²	122.2	63%	0.626	59%	0.586	S	S	*	*	H	α-helix	trans	-66.4	-27.9	177.5	-71.9	-169	144	0	0	113.1	H101 E102	H101-E105 IonicContact NE2-OE1 3.38Å; H101-E105 PolarHBondContact O-N 3.46Å; E102-E105 PolarHBondContact O-N 2.88Å
106	K	72.6	Confident	62.5	Low	126 Å²	126	124.1 Å²	124.1	55%	0.548	59%	0.59	S	S	.	*	T	Hydrogen-bonded Turn	trans	-101.5	9.2	-178.7	-64.9	173.5	-175.8	167.6	0	113.1	E102 Y104 L108	E102-K106 WeakPolarHBondContact O-CB 3.49Å; E102-K106 VanDerWaalsContact O-CG 3.31Å; E102-K106 WeakPolarHBondContact O-CG 3.46Å; E102-K106 PolarHBondContact O-N 3.35Å; Y104-K106 PolarHBondContact O-N 3.47Å; K106-L108 HydrophobicContact CB-CD1 3.81Å; K106-L108 HydrophobicContact CB-CG 3.71Å; K106-L108 HydrophobicContact CD-CD1 4.13Å; K106-L108 PolarHBondContact O-N 3.46Å; K106-L108 VanDerWaalsContact O-N 3.16Å
107	D	71.4	Confident	62.7	Low	142 Å²	142	124.8 Å²	124.8	76%	0.759	59%	0.59	S	S	*	*	T	Hydrogen-bonded Turn	trans	49	37.1	-176.6	-63.6	-45.9	0	0	0	113.5	G103 Y104	G103-D107 PolarHBondContact O-N 3.1Å; Y104-D107 PolarHBondContact O-N 3.44Å
108	L	63	Low	62.5	Low	119 Å²	119	127 Å²	127	62%	0.623	60%	0.598	S	S	*	*			trans	-85.7	-9.1	-177.4	-64.3	173.9	0	0	0	113.5	G103 K106	G103-L108 PolarHBondContact O-N 3.21Å; K106-L108 HydrophobicContact CB-CD1 3.81Å; K106-L108 HydrophobicContact CB-CG 3.71Å; K106-L108 HydrophobicContact CD-CD1 4.13Å; K106-L108 PolarHBondContact O-N 3.46Å; K106-L108 VanDerWaalsContact O-N 3.16Å
109	W	64.6	Low	61.8	Low	116 Å²	116	127.8 Å²	127.8	44%	0.439	60%	0.602	S	S	.	*			trans	-107.2	118.7	-178.9	-53.9	122.5	0	0	0	110.8	H99 V100 G103	H99-W109 AromaticContact CE1-CH2 3.71Å; H99-W109 AromaticContact CE1-CZ2 3.9Å; V100-W109 PolarHBondContact O-NE1 3.39Å; G103-W109 VanDerWaalsContact C-NE1 3.34Å
110	E	55.5	Low	61.4	Low	182 Å²	182	129.4 Å²	129.4	85%	0.85	61%	0.61	S	S	*	*			trans	-106.1	139.9	171.5	-66.9	-178.6	176	0	0	110	I112	E110-I112 PolarHBondContact O-N 3.04Å
111	Y	57.3	Low	61.4	Low	195 Å²	195	135.1 Å²	135.1	77%	0.765	63%	0.632	S	S	*	*			trans	-74.2	125.5	175.7	-74.9	-87.2	0	0	0	109.9	E113	Y111-E113 PolarHBondContact O-N 3.47Å
112	I	52.4	Low	60.9	Low	158 Å²	158	136.9 Å²	136.9	81%	0.81	64%	0.641	S	S	*	*			trans	-85.9	103.4	167	-56	175.9	0	0	0	106.3	E110	E110-I112 PolarHBondContact O-N 3.04Å
113	E	44.8	Very low	60.5	Low	183 Å²	183	142.9 Å²	142.9	86%	0.855	67%	0.669	S	S	*	*			trans	-75.7	122.1	165.3	-69.2	-177	168.6	0	0	108.1	Y111	Y111-E113 PolarHBondContact O-N 3.47Å
114	D	50.5	Low	60.1	Low	233 Å²	233	155.7 Å²	155.7	100%	1.246	73%	0.728	S	S	*	*			trans	-76.3	0	163.6	-83.9	-29.9	0	0	0	110.5

Retrieved 114 of 114 residues in 57.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).