A0A087WTJ7_HUMAN Loading...

Tropomyosin 1

AlphaFold DB , UniProt , Accession A0A087WTJ7, Species HUMAN (Homo sapiens, Human), Gene TPM1, Length 106 aa.

						>A0A087WTJ7_HUMAN|A0A087WTJ7|TPM1
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDVSARSHCFPHLLPAWPLRGHHRAGEQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	73.6	Confident	90.5	Very high	197 Å²	197	127.5 Å²	127.5	97%	0.97	64%	0.637	S	S	*	*				0	-45.3	0	-164	-151	-160.4	0	0	111.4	A3 I4 K5	M1-A3 PolarHBondContact O-N 3.45Å; M1-I4 PolarHBondContact O-N 3.24Å; M1-K5 PolarHBondContact O-N 3.27Å
2	D	88.3	Confident	90.9	Very high	120 Å²	120	127.2 Å²	127.2	64%	0.642	63%	0.629	S	S	*	*	H	α-helix	trans	-64.9	-36.1	-172.5	-61.7	-56.2	0	0	0	116.2	I4 K5 K6	D2-I4 VanDerWaalsContact C-N 3.33Å; D2-I4 PolarHBondContact O-N 3.19Å; D2-K5 PolarHBondContact O-N 3.07Å; D2-K6 PolarHBondContact O-N 2.87Å
3	A	89.2	Confident	91.3	Very high	81 Å²	81	123.9 Å²	123.9	67%	0.669	62%	0.615	S	S	*	*	H	α-helix	trans	-62.7	-38.8	179.7	0	0	0	0	0	112.8	M1 K7	M1-A3 PolarHBondContact O-N 3.45Å; A3-K7 PolarHBondContact O-N 2.77Å
4	I	91.4	Very high	91.6	Very high	130 Å²	130	121.6 Å²	121.6	67%	0.667	61%	0.606	S	S	*	*	H	α-helix	trans	-69	-42.7	177.9	-63.6	174.8	0	0	0	110	M1 D2 K6 K7 M8	M1-I4 PolarHBondContact O-N 3.24Å; D2-I4 VanDerWaalsContact C-N 3.33Å; D2-I4 PolarHBondContact O-N 3.19Å; I4-K6 PolarHBondContact O-N 3.19Å; I4-K7 PolarHBondContact O-N 3.3Å; I4-M8 WeakPolarHBondContact O-CB 3.48Å; I4-M8 PolarHBondContact O-N 2.81Å
5	K	92.8	Very high	91.9	Very high	122 Å²	122	122.8 Å²	122.8	53%	0.53	61%	0.606	S	S	.	*	H	α-helix	trans	-61.3	-43	176.9	-171	176.3	-179.8	-177.8	0	111.7	M1 D2 M8 Q9	M1-K5 PolarHBondContact O-N 3.27Å; D2-K5 PolarHBondContact O-N 3.07Å; K5-M8 PolarHBondContact O-N 3.33Å; K5-Q9 WeakPolarHBondContact O-CG 3.5Å; K5-Q9 PolarHBondContact O-N 2.86Å
6	K	93.9	Very high	92.2	Very high	153 Å²	153	121.9 Å²	121.9	67%	0.665	60%	0.6	S	S	*	*	H	α-helix	trans	-61.1	-49.1	174.3	-112.3	-178.4	177.5	178.9	0	111.9	D2 I4 M8 Q9 M10	D2-K6 PolarHBondContact O-N 2.87Å; I4-K6 PolarHBondContact O-N 3.19Å; K6-M8 PolarHBondContact O-N 3.32Å; K6-Q9 PolarHBondContact O-N 3.37Å; K6-Q9 VanDerWaalsContact O-N 3.13Å; K6-M10 WeakPolarHBondContact O-CG 3.4Å; K6-M10 PolarHBondContact O-N 2.81Å
7	K	93.1	Very high	92.4	Very high	153 Å²	153	119.7 Å²	119.7	67%	0.665	59%	0.591	S	S	*	*	H	α-helix	trans	-59.2	-38.8	178.5	-165.7	173.7	-176.7	177.8	0	111.4	A3 I4 M10 L11	A3-K7 PolarHBondContact O-N 2.77Å; I4-K7 PolarHBondContact O-N 3.3Å; K7-M10 PolarHBondContact O-N 3.37Å; K7-L11 WeakPolarHBondContact O-CG 3.48Å; K7-L11 PolarHBondContact O-N 3.4Å; K7-L11 VanDerWaalsContact O-N 3.09Å
8	M	93.8	Very high	92.7	Very high	109 Å²	109	116.5 Å²	116.5	54%	0.537	59%	0.587	S	S	.	*	H	α-helix	trans	-68.5	-37.3	176.5	-175.1	147.9	61.4	0	0	113.3	I4 K5 K6 L11 K12	I4-M8 WeakPolarHBondContact O-CB 3.48Å; I4-M8 PolarHBondContact O-N 2.81Å; K5-M8 PolarHBondContact O-N 3.33Å; K6-M8 PolarHBondContact O-N 3.32Å; M8-L11 PolarHBondContact O-N 2.96Å; M8-K12 WeakPolarHBondContact O-CG 3.24Å; M8-K12 PolarHBondContact O-N 2.79Å; M8-K12 VanDerWaalsContact O-N 3.16Å
9	Q	93.4	Very high	92.9	Very high	115 Å²	115	114.8 Å²	114.8	54%	0.537	58%	0.579	S	S	.	*	H	α-helix	trans	-65.3	-41.2	174	-75.1	176.5	-39.4	0	0	111.9	K5 K6 L11 K12 L13	K5-Q9 WeakPolarHBondContact O-CG 3.5Å; K5-Q9 PolarHBondContact O-N 2.86Å; K6-Q9 PolarHBondContact O-N 3.37Å; K6-Q9 VanDerWaalsContact O-N 3.13Å; Q9-L11 PolarHBondContact O-N 2.97Å; Q9-K12 PolarHBondContact O-N 3.46Å; Q9-L13 PolarHBondContact O-N 3.43Å
10	M	92.3	Very high	93.1	Very high	114 Å²	114	114.1 Å²	114.1	56%	0.562	58%	0.577	S	S	*	*	H	α-helix	trans	-60.8	-46	176.4	-63.5	-61.2	-90.7	0	0	111.1	K6 K7 K12 L13 D14	K6-M10 WeakPolarHBondContact O-CG 3.4Å; K6-M10 PolarHBondContact O-N 2.81Å; K7-M10 PolarHBondContact O-N 3.37Å; M10-K12 VanDerWaalsContact C-N 3.27Å; M10-K12 PolarHBondContact O-N 3.37Å; M10-L13 PolarHBondContact O-N 3.46Å; M10-D14 WeakPolarHBondContact O-CB 3.44Å; M10-D14 PolarHBondContact O-N 2.88Å
11	L	93.8	Very high	93.3	Very high	108 Å²	108	118.2 Å²	118.2	57%	0.565	59%	0.585	S	S	*	*	H	α-helix	trans	-63.2	-31.5	178.4	-69.4	172.8	0	0	0	113.6	K7 M8 Q9 K15	K7-L11 WeakPolarHBondContact O-CG 3.48Å; K7-L11 PolarHBondContact O-N 3.4Å; K7-L11 VanDerWaalsContact O-N 3.09Å; M8-L11 PolarHBondContact O-N 2.96Å; Q9-L11 PolarHBondContact O-N 2.97Å; L11-K15 WeakPolarHBondContact O-CB 3.36Å; L11-K15 PolarHBondContact O-N 3Å; L11-K15 VanDerWaalsContact O-N 3.11Å
12	K	95.1	Very high	94.4	Very high	124 Å²	124	111.1 Å²	111.1	54%	0.539	56%	0.558	S	S	.	*	H	α-helix	trans	-69.6	-46.1	174.2	-73.8	-179.1	178.9	-169.4	0	111.3	M8 Q9 M10 D14 K15 E16	M8-K12 WeakPolarHBondContact O-CG 3.24Å; M8-K12 PolarHBondContact O-N 2.79Å; M8-K12 VanDerWaalsContact O-N 3.16Å; Q9-K12 PolarHBondContact O-N 3.46Å; M10-K12 VanDerWaalsContact C-N 3.27Å; M10-K12 PolarHBondContact O-N 3.37Å; K12-D14 VanDerWaalsContact C-N 3.34Å; K12-D14 PolarHBondContact O-N 3.05Å; K12-K15 WeakPolarHBondContact O-CB 3.32Å; K12-K15 PolarHBondContact O-N 2.91Å; K12-E16 WeakPolarHBondContact O-CG 3.44Å; K12-E16 PolarHBondContact O-N 3.49Å
13	L	96.4	Very high	94.8	Very high	85 Å²	85	111.4 Å²	111.4	45%	0.445	56%	0.556	S	S	.	*	H	α-helix	trans	-61.7	-43.6	177.3	-174.7	68.3	0	0	0	111.3	Q9 M10 K15 E16 N17	Q9-L13 PolarHBondContact O-N 3.43Å; M10-L13 PolarHBondContact O-N 3.46Å; L13-K15 VanDerWaalsContact C-N 3.3Å; L13-K15 PolarHBondContact O-N 2.88Å; L13-E16 PolarHBondContact O-N 2.94Å; L13-N17 WeakPolarHBondContact O-CB 3.38Å; L13-N17 PolarHBondContact O-N 3.32Å; L13-N17 PolarHBondContact O-ND2 2.89Å
14	D	95.9	Very high	95.2	Very high	91 Å²	91	112.7 Å²	112.7	49%	0.487	55%	0.548	S	S	.	.	H	α-helix	trans	-62.8	-38.7	177.6	-66.9	-26.5	0	0	0	111.5	M10 K12 A18	M10-D14 WeakPolarHBondContact O-CB 3.44Å; M10-D14 PolarHBondContact O-N 2.88Å; K12-D14 VanDerWaalsContact C-N 3.34Å; K12-D14 PolarHBondContact O-N 3.05Å; D14-A18 WeakPolarHBondContact O-CB 3.19Å; D14-A18 PolarHBondContact O-N 3.29Å
15	K	95.4	Very high	95.4	Very high	140 Å²	140	109.2 Å²	109.2	61%	0.609	54%	0.539	S	S	*	.	H	α-helix	trans	-65.9	-47.2	175	-178.3	-173.1	173.2	-172.6	0	111.6	L11 K12 L13 A18 L19	L11-K15 WeakPolarHBondContact O-CB 3.36Å; L11-K15 PolarHBondContact O-N 3Å; L11-K15 VanDerWaalsContact O-N 3.11Å; K12-K15 WeakPolarHBondContact O-CB 3.32Å; K12-K15 PolarHBondContact O-N 2.91Å; L13-K15 VanDerWaalsContact C-N 3.3Å; L13-K15 PolarHBondContact O-N 2.88Å; K15-A18 PolarHBondContact O-N 3.04Å; K15-L19 HydrophobicContact CG-CD1 4.16Å; K15-L19 WeakPolarHBondContact O-CG 3.34Å; K15-L19 PolarHBondContact O-N 3.08Å
16	E	96.5	Very high	95.6	Very high	108 Å²	108	110 Å²	110	51%	0.505	55%	0.545	S	S	.	.	H	α-helix	trans	-60.4	-47.6	178.7	-73.7	170.2	176.5	0	0	110.4	K12 L13 A18 L19 D20	K12-E16 WeakPolarHBondContact O-CG 3.44Å; K12-E16 PolarHBondContact O-N 3.49Å; L13-E16 PolarHBondContact O-N 2.94Å; E16-A18 VanDerWaalsContact C-N 3.29Å; E16-A18 PolarHBondContact O-N 3.45Å; E16-L19 PolarHBondContact O-N 2.86Å; E16-L19 VanDerWaalsContact O-N 3.1Å; E16-D20 PolarHBondContact O-N 2.91Å
17	N	96.1	Very high	95.8	Very high	85 Å²	85	105.3 Å²	105.3	46%	0.455	53%	0.534	S	S	.	.	H	α-helix	trans	-59.9	-37.1	176.1	-69.4	-23.9	0	0	0	113.2	L13 R21	L13-N17 WeakPolarHBondContact O-CB 3.38Å; L13-N17 PolarHBondContact O-N 3.32Å; L13-N17 PolarHBondContact O-ND2 2.89Å; N17-R21 WeakPolarHBondContact O-CB 3.28Å; N17-R21 PolarHBondContact O-N 3.4Å; N17-R21 VanDerWaalsContact O-N 3.16Å
18	A	97.1	Very high	95.9	Very high	62 Å²	62	102.4 Å²	102.4	51%	0.512	53%	0.526	S	S	.	.	H	α-helix	trans	-69.4	-38.1	177.2	0	0	0	0	0	111.9	D14 K15 E16 A22	D14-A18 WeakPolarHBondContact O-CB 3.19Å; D14-A18 PolarHBondContact O-N 3.29Å; K15-A18 PolarHBondContact O-N 3.04Å; E16-A18 VanDerWaalsContact C-N 3.29Å; E16-A18 PolarHBondContact O-N 3.45Å; A18-A22 WeakPolarHBondContact O-CB 3.31Å; A18-A22 PolarHBondContact O-N 2.89Å
19	L	96.9	Very high	96.1	Very high	85 Å²	85	103.4 Å²	103.4	45%	0.445	53%	0.527	S	S	.	.	H	α-helix	trans	-67.5	-49.5	176.4	-70.9	172.4	0	0	0	111	K15 E16 R21 A22 E23	K15-L19 HydrophobicContact CG-CD1 4.16Å; K15-L19 WeakPolarHBondContact O-CG 3.34Å; K15-L19 PolarHBondContact O-N 3.08Å; E16-L19 PolarHBondContact O-N 2.86Å; E16-L19 VanDerWaalsContact O-N 3.1Å; L19-R21 PolarHBondContact O-N 2.99Å; L19-A22 WeakPolarHBondContact O-CB 3.42Å; L19-A22 PolarHBondContact O-N 3.19Å; L19-E23 WeakPolarHBondContact O-CG 3.44Å; L19-E23 PolarHBondContact O-N 3.3Å
20	D	97.1	Very high	96.3	Very high	99 Å²	99	104.3 Å²	104.3	53%	0.529	53%	0.529	S	S	.	.	H	α-helix	trans	-57.6	-40.4	178.7	-67.6	-8.5	0	0	0	111.3	E16 Q24	E16-D20 PolarHBondContact O-N 2.91Å; D20-Q24 WeakPolarHBondContact O-CB 3.26Å; D20-Q24 PolarHBondContact O-N 3.01Å
21	R	96.4	Very high	96.5	Very high	201 Å²	201	100.9 Å²	100.9	76%	0.758	52%	0.519	S	S	*	.	H	α-helix	trans	-67.2	-38.5	176.4	-173.2	175	-178.8	177.4	0.9	112.5	N17 L19 A25	N17-R21 WeakPolarHBondContact O-CB 3.28Å; N17-R21 PolarHBondContact O-N 3.4Å; N17-R21 VanDerWaalsContact O-N 3.16Å; L19-R21 PolarHBondContact O-N 2.99Å; R21-A25 WeakPolarHBondContact O-CB 3.39Å; R21-A25 PolarHBondContact O-N 3Å; R21-A25 VanDerWaalsContact O-N 3.09Å
22	A	96.9	Very high	96.7	Very high	48 Å²	48	98.6 Å²	98.6	40%	0.397	52%	0.515	S	S	.	.	H	α-helix	trans	-66.7	-45.1	176.9	0	0	0	0	0	110.9	A18 L19 Q24 A25 E26	A18-A22 WeakPolarHBondContact O-CB 3.31Å; A18-A22 PolarHBondContact O-N 2.89Å; L19-A22 WeakPolarHBondContact O-CB 3.42Å; L19-A22 PolarHBondContact O-N 3.19Å; A22-Q24 PolarHBondContact O-N 2.93Å; A22-A25 PolarHBondContact O-N 3.39Å; A22-E26 WeakPolarHBondContact O-CG 3.46Å; A22-E26 PolarHBondContact O-N 3.4Å
23	E	97.3	Very high	96.8	Very high	127 Å²	127	96.7 Å²	96.7	59%	0.593	51%	0.509	S	S	*	.	H	α-helix	trans	-61.3	-44.2	177.8	-71	-178.8	-176.2	0	0	111.9	L19 A25 E26 A27	L19-E23 WeakPolarHBondContact O-CG 3.44Å; L19-E23 PolarHBondContact O-N 3.3Å; E23-A25 PolarHBondContact O-N 2.99Å; E23-E26 PolarHBondContact O-N 3.14Å; E23-A27 PolarHBondContact O-N 3.42Å
24	Q	96.5	Very high	96.8	Very high	107 Å²	107	96 Å²	96	50%	0.5	51%	0.506	S	S	.	.	H	α-helix	trans	-61.5	-44.1	175.5	-176.5	59	49.2	0	0	111.7	D20 A22 E26 A27 D28	D20-Q24 WeakPolarHBondContact O-CB 3.26Å; D20-Q24 PolarHBondContact O-N 3.01Å; A22-Q24 PolarHBondContact O-N 2.93Å; Q24-E26 VanDerWaalsContact C-N 3.31Å; Q24-E26 PolarHBondContact O-N 3.16Å; Q24-A27 PolarHBondContact O-N 3.45Å; Q24-D28 VanDerWaalsContact NE2-CG 3.29Å; Q24-D28 PolarHBondContact NE2-OD1 3.1Å; Q24-D28 PolarHBondContact NE2-OD2 3.19Å; Q24-D28 VanDerWaalsContact NE2-OD2 3.07Å; Q24-D28 PolarHBondContact O-N 2.95Å
25	A	96.7	Very high	96.9	Very high	58 Å²	58	99.9 Å²	99.9	48%	0.479	51%	0.513	S	S	.	.	H	α-helix	trans	-64.2	-36.4	178.4	0	0	0	0	0	112.3	R21 A22 E23 K29	R21-A25 WeakPolarHBondContact O-CB 3.39Å; R21-A25 PolarHBondContact O-N 3Å; R21-A25 VanDerWaalsContact O-N 3.09Å; A22-A25 PolarHBondContact O-N 3.39Å; E23-A25 PolarHBondContact O-N 2.99Å; A25-K29 VanDerWaalsContact O-CB 3.25Å; A25-K29 WeakPolarHBondContact O-CB 3.44Å; A25-K29 PolarHBondContact O-N 3.47Å
26	E	96.9	Very high	96.9	Very high	139 Å²	139	95.8 Å²	95.8	65%	0.65	50%	0.502	S	S	*	.	H	α-helix	trans	-67.4	-41.8	174.3	-74.6	-173.6	177.6	0	0	112.2	A22 E23 Q24 K29 K30	A22-E26 WeakPolarHBondContact O-CG 3.46Å; A22-E26 PolarHBondContact O-N 3.4Å; E23-E26 PolarHBondContact O-N 3.14Å; Q24-E26 VanDerWaalsContact C-N 3.31Å; Q24-E26 PolarHBondContact O-N 3.16Å; E26-K29 PolarHBondContact O-N 3.29Å; E26-K30 WeakPolarHBondContact O-CB 3.5Å; E26-K30 PolarHBondContact O-N 3.25Å
27	A	97.5	Very high	96.9	Very high	54 Å²	54	95.9 Å²	95.9	45%	0.446	50%	0.501	S	S	.	.	H	α-helix	trans	-61.9	-46.3	175.9	0	0	0	0	0	111.7	E23 Q24 K30 A31	E23-A27 PolarHBondContact O-N 3.42Å; Q24-A27 PolarHBondContact O-N 3.45Å; A27-K30 PolarHBondContact O-N 2.91Å; A27-A31 PolarHBondContact O-N 3.05Å
28	D	96.5	Very high	97	Very high	91 Å²	91	97.8 Å²	97.8	49%	0.487	51%	0.507	S	S	.	.	H	α-helix	trans	-65	-41	178.3	-70.8	-27.9	0	0	0	111.6	Q24 A31 A32	Q24-D28 VanDerWaalsContact NE2-CG 3.29Å; Q24-D28 PolarHBondContact NE2-OD1 3.1Å; Q24-D28 PolarHBondContact NE2-OD2 3.19Å; Q24-D28 VanDerWaalsContact NE2-OD2 3.07Å; Q24-D28 PolarHBondContact O-N 2.95Å; D28-A31 PolarHBondContact O-N 3.01Å; D28-A32 WeakPolarHBondContact O-CB 3.49Å; D28-A32 PolarHBondContact O-N 3.49Å
29	K	97.3	Very high	97	Very high	130 Å²	130	99.7 Å²	99.7	57%	0.565	51%	0.508	S	S	*	.	H	α-helix	trans	-59.5	-48.2	174.7	177.9	-178.1	166.6	-175.8	0	110.9	A25 E26 A31 A32 E33	A25-K29 VanDerWaalsContact O-CB 3.25Å; A25-K29 WeakPolarHBondContact O-CB 3.44Å; A25-K29 PolarHBondContact O-N 3.47Å; E26-K29 PolarHBondContact O-N 3.29Å; K29-A31 VanDerWaalsContact C-N 3.34Å; K29-A31 PolarHBondContact O-N 2.99Å; K29-A32 PolarHBondContact O-N 3.33Å; K29-E33 WeakPolarHBondContact CE-OE1 3.47Å; K29-E33 HydrophobicContact CG-CG 4.46Å; K29-E33 IonicContact NZ-OE1 3.91Å; K29-E33 WeakPolarHBondContact O-CG 3.26Å; K29-E33 PolarHBondContact O-N 2.76Å
30	K	97.6	Very high	96.9	Very high	135 Å²	135	100.9 Å²	100.9	59%	0.587	51%	0.511	S	S	*	.	H	α-helix	trans	-61.2	-43.6	179	-173.4	179.2	177.8	-176.2	0	111.5	E26 A27 A32 E33 D34	E26-K30 WeakPolarHBondContact O-CB 3.5Å; E26-K30 PolarHBondContact O-N 3.25Å; A27-K30 PolarHBondContact O-N 2.91Å; K30-A32 VanDerWaalsContact C-N 3.31Å; K30-A32 PolarHBondContact O-N 3Å; K30-E33 PolarHBondContact O-N 3.18Å; K30-D34 PolarHBondContact O-N 2.9Å
31	A	97.4	Very high	96.9	Very high	41 Å²	41	101.9 Å²	101.9	34%	0.339	52%	0.517	S	S	.	.	H	α-helix	trans	-62.3	-38.1	176.1	0	0	0	0	0	112.5	A27 D28 K29 R35	A27-A31 PolarHBondContact O-N 3.05Å; D28-A31 PolarHBondContact O-N 3.01Å; K29-A31 VanDerWaalsContact C-N 3.34Å; K29-A31 PolarHBondContact O-N 2.99Å; A31-R35 VanDerWaalsContact O-CG 3.28Å; A31-R35 WeakPolarHBondContact O-CG 3.28Å; A31-R35 PolarHBondContact O-N 3.28Å; A31-R35 VanDerWaalsContact O-N 3.13Å
32	A	96.6	Very high	96.9	Very high	60 Å²	60	97.9 Å²	97.9	50%	0.496	51%	0.507	S	S	.	.	H	α-helix	trans	-68.4	-42	175.3	0	0	0	0	0	112.2	D28 K29 K30 R35 S36	D28-A32 WeakPolarHBondContact O-CB 3.49Å; D28-A32 PolarHBondContact O-N 3.49Å; K29-A32 PolarHBondContact O-N 3.33Å; K30-A32 VanDerWaalsContact C-N 3.31Å; K30-A32 PolarHBondContact O-N 3Å; A32-R35 PolarHBondContact O-N 3.42Å; A32-S36 PolarHBondContact O-N 3.12Å
33	E	96.9	Very high	96.9	Very high	85 Å²	85	100.5 Å²	100.5	40%	0.397	51%	0.513	S	S	.	.	H	α-helix	trans	-62.3	-43.3	176.1	-74.5	178.9	176.1	0	0	111.9	K29 K30 R35 S36 K37	K29-E33 WeakPolarHBondContact CE-OE1 3.47Å; K29-E33 HydrophobicContact CG-CG 4.46Å; K29-E33 IonicContact NZ-OE1 3.91Å; K29-E33 WeakPolarHBondContact O-CG 3.26Å; K29-E33 PolarHBondContact O-N 2.76Å; K30-E33 PolarHBondContact O-N 3.18Å; E33-R35 VanDerWaalsContact C-N 3.34Å; E33-R35 PolarHBondContact O-N 2.94Å; E33-S36 WeakPolarHBondContact O-CB 3.42Å; E33-S36 PolarHBondContact O-N 3.44Å; E33-K37 WeakPolarHBondContact O-CG 3.46Å; E33-K37 PolarHBondContact O-N 3.48Å
34	D	97.6	Very high	96.9	Very high	71 Å²	71	97.7 Å²	97.7	38%	0.38	51%	0.505	S	S	.	.	H	α-helix	trans	-64.9	-39.2	177.8	-71.4	-20.1	0	0	0	111.5	K30 K37 Q38	K30-D34 PolarHBondContact O-N 2.9Å; D34-K37 PolarHBondContact O-N 3.21Å; D34-Q38 WeakPolarHBondContact O-CG 3.5Å; D34-Q38 PolarHBondContact O-N 3Å; D34-Q38 VanDerWaalsContact O-N 3.13Å
35	R	96.8	Very high	97	Very high	171 Å²	171	95.3 Å²	95.3	65%	0.645	50%	0.5	S	S	*	.	H	α-helix	trans	-64.8	-40.2	172.2	-72.7	174.4	-172.4	175.5	4.9	112.4	A31 A32 E33 Q38 L39	A31-R35 VanDerWaalsContact O-CG 3.28Å; A31-R35 WeakPolarHBondContact O-CG 3.28Å; A31-R35 PolarHBondContact O-N 3.28Å; A31-R35 VanDerWaalsContact O-N 3.13Å; A32-R35 PolarHBondContact O-N 3.42Å; E33-R35 VanDerWaalsContact C-N 3.34Å; E33-R35 PolarHBondContact O-N 2.94Å; R35-Q38 PolarHBondContact O-N 2.86Å; R35-L39 WeakPolarHBondContact O-CG 3.39Å; R35-L39 PolarHBondContact O-N 2.96Å
36	S	95.9	Very high	96.9	Very high	54 Å²	54	97.4 Å²	97.4	38%	0.378	50%	0.502	S	S	.	.	H	α-helix	trans	-59.9	-47.2	176.9	-165	0	0	0	0	110.9	A32 E33 Q38 L39 E40	A32-S36 PolarHBondContact O-N 3.12Å; E33-S36 WeakPolarHBondContact O-CB 3.42Å; E33-S36 PolarHBondContact O-N 3.44Å; S36-Q38 PolarHBondContact O-N 3.23Å; S36-L39 PolarHBondContact O-N 2.69Å; S36-E40 WeakPolarHBondContact O-CG 3.48Å; S36-E40 PolarHBondContact O-N 3.1Å; S36-E40 PolarHBondContact OG-OE1 3.39Å
37	K	97.3	Very high	96.9	Very high	111 Å²	111	96.4 Å²	96.4	48%	0.483	50%	0.498	S	S	.	.	H	α-helix	trans	-59.9	-44.1	178.2	-69.9	170.6	-172.7	163.9	0	112.2	E33 D34 L39 E40 D41	E33-K37 WeakPolarHBondContact O-CG 3.46Å; E33-K37 PolarHBondContact O-N 3.48Å; D34-K37 PolarHBondContact O-N 3.21Å; K37-L39 VanDerWaalsContact C-N 3.33Å; K37-L39 PolarHBondContact O-N 3.33Å; K37-E40 PolarHBondContact O-N 3.37Å; K37-D41 PolarHBondContact O-N 2.9Å
38	Q	97.1	Very high	96.8	Very high	124 Å²	124	101 Å²	101	58%	0.579	51%	0.508	S	S	*	.	H	α-helix	trans	-58.8	-45.4	176.1	-73.5	175.1	-11.9	0	0	111.8	D34 R35 S36 D41 E42	D34-Q38 WeakPolarHBondContact O-CG 3.5Å; D34-Q38 PolarHBondContact O-N 3Å; D34-Q38 VanDerWaalsContact O-N 3.13Å; R35-Q38 PolarHBondContact O-N 2.86Å; S36-Q38 PolarHBondContact O-N 3.23Å; Q38-D41 PolarHBondContact O-N 3.31Å; Q38-E42 WeakPolarHBondContact O-CG 3.41Å; Q38-E42 PolarHBondContact O-N 3.41Å
39	L	96.8	Very high	96.8	Very high	103 Å²	103	103.1 Å²	103.1	54%	0.539	51%	0.513	S	S	.	.	H	α-helix	trans	-66.6	-37.5	178.2	-69.4	172.5	0	0	0	112.3	R35 S36 K37 E42 L43	R35-L39 WeakPolarHBondContact O-CG 3.39Å; R35-L39 PolarHBondContact O-N 2.96Å; S36-L39 PolarHBondContact O-N 2.69Å; K37-L39 VanDerWaalsContact C-N 3.33Å; K37-L39 PolarHBondContact O-N 3.33Å; L39-E42 PolarHBondContact O-N 2.86Å; L39-L43 WeakPolarHBondContact O-CB 3.49Å; L39-L43 VanDerWaalsContact O-CG 3.25Å; L39-L43 WeakPolarHBondContact O-CG 3.35Å; L39-L43 PolarHBondContact O-N 3.42Å
40	E	96.6	Very high	96.7	Very high	109 Å²	109	101.5 Å²	101.5	51%	0.509	51%	0.51	S	S	.	.	H	α-helix	trans	-62.5	-44.6	174.7	-74.1	165.9	-146.7	0	0	111.6	S36 K37 L43 V44	S36-E40 WeakPolarHBondContact O-CG 3.48Å; S36-E40 PolarHBondContact O-N 3.1Å; S36-E40 PolarHBondContact OG-OE1 3.39Å; K37-E40 PolarHBondContact O-N 3.37Å; E40-L43 PolarHBondContact O-N 3.19Å; E40-V44 WeakPolarHBondContact O-CG2 3.06Å; E40-V44 PolarHBondContact O-N 3.1Å
41	D	97.3	Very high	96.7	Very high	121 Å²	121	101.4 Å²	101.4	65%	0.647	51%	0.509	S	S	*	.	H	α-helix	trans	-63.9	-42.4	176	-75.2	-24.9	0	0	0	112	K37 Q38 V44 S45	K37-D41 PolarHBondContact O-N 2.9Å; Q38-D41 PolarHBondContact O-N 3.31Å; D41-V44 PolarHBondContact O-N 3.5Å; D41-S45 WeakPolarHBondContact O-CB 3.28Å; D41-S45 PolarHBondContact O-N 3.49Å
42	E	96.4	Very high	96.5	Very high	117 Å²	117	100.9 Å²	100.9	55%	0.547	51%	0.507	S	S	.	.	H	α-helix	trans	-62.4	-42.6	174.9	-76.7	-179	-170.5	0	0	111.9	Q38 L39 V44 S45 L46	Q38-E42 WeakPolarHBondContact O-CG 3.41Å; Q38-E42 PolarHBondContact O-N 3.41Å; L39-E42 PolarHBondContact O-N 2.86Å; E42-V44 PolarHBondContact O-N 2.92Å; E42-S45 WeakPolarHBondContact O-CB 3.32Å; E42-S45 PolarHBondContact O-N 3.05Å; E42-L46 WeakPolarHBondContact O-CB 3.41Å; E42-L46 WeakPolarHBondContact O-CG 3.42Å; E42-L46 PolarHBondContact O-N 2.86Å
43	L	96.6	Very high	96.4	Very high	102 Å²	102	101.8 Å²	101.8	53%	0.534	51%	0.507	S	S	.	.	H	α-helix	trans	-60.3	-45.2	176.1	-78.8	173	0	0	0	111.6	L39 E40 S45 L46 Q47	L39-L43 WeakPolarHBondContact O-CB 3.49Å; L39-L43 VanDerWaalsContact O-CG 3.25Å; L39-L43 WeakPolarHBondContact O-CG 3.35Å; L39-L43 PolarHBondContact O-N 3.42Å; E40-L43 PolarHBondContact O-N 3.19Å; L43-S45 VanDerWaalsContact C-N 3.33Å; L43-S45 PolarHBondContact O-N 3.34Å; L43-L46 PolarHBondContact O-N 3.48Å; L43-Q47 WeakPolarHBondContact O-CB 3.44Å; L43-Q47 WeakPolarHBondContact O-CG 3.5Å; L43-Q47 PolarHBondContact O-N 3.04Å
44	V	97.5	Very high	96.3	Very high	69 Å²	69	102.1 Å²	102.1	42%	0.418	51%	0.509	S	S	.	.	H	α-helix	trans	-63	-42	176.8	171.7	0	0	0	0	111	E40 D41 E42 Q47 K48	E40-V44 WeakPolarHBondContact O-CG2 3.06Å; E40-V44 PolarHBondContact O-N 3.1Å; D41-V44 PolarHBondContact O-N 3.5Å; E42-V44 PolarHBondContact O-N 2.92Å; V44-Q47 PolarHBondContact O-N 3.25Å; V44-K48 HydrophobicContact CG1-CD 4.44Å; V44-K48 WeakPolarHBondContact O-CG 3.31Å; V44-K48 PolarHBondContact O-N 2.97Å
45	S	96.8	Very high	96.2	Very high	56 Å²	56	103 Å²	103	39%	0.392	51%	0.514	S	S	.	.	H	α-helix	trans	-60.9	-46.2	176.2	-177.3	0	0	0	0	111.9	D41 E42 L43 K48 K49	D41-S45 WeakPolarHBondContact O-CB 3.28Å; D41-S45 PolarHBondContact O-N 3.49Å; E42-S45 WeakPolarHBondContact O-CB 3.32Å; E42-S45 PolarHBondContact O-N 3.05Å; L43-S45 VanDerWaalsContact C-N 3.33Å; L43-S45 PolarHBondContact O-N 3.34Å; S45-K48 PolarHBondContact O-N 2.89Å; S45-K49 WeakPolarHBondContact O-CG 3.47Å; S45-K49 PolarHBondContact O-N 2.88Å; S45-K49 VanDerWaalsContact O-N 3.07Å
46	L	95.9	Very high	96.2	Very high	102 Å²	102	100 Å²	100	53%	0.534	51%	0.507	S	S	.	.	H	α-helix	trans	-64.5	-41.9	177.5	-72.4	173.9	0	0	0	112	E42 L43 K48 K49 L50	E42-L46 WeakPolarHBondContact O-CB 3.41Å; E42-L46 WeakPolarHBondContact O-CG 3.42Å; E42-L46 PolarHBondContact O-N 2.86Å; L43-L46 PolarHBondContact O-N 3.48Å; L46-K48 VanDerWaalsContact C-N 3.31Å; L46-K48 PolarHBondContact O-N 3.33Å; L46-K49 PolarHBondContact O-N 3.48Å; L46-L50 WeakPolarHBondContact O-CB 3.49Å; L46-L50 PolarHBondContact O-N 3.2Å
47	Q	95.8	Very high	96.1	Very high	119 Å²	119	102.7 Å²	102.7	56%	0.556	52%	0.516	S	S	*	.	H	α-helix	trans	-61.7	-38.6	175.7	-77.2	-178.5	0.5	0	0	112.4	L43 V44 L50 K51	L43-Q47 WeakPolarHBondContact O-CB 3.44Å; L43-Q47 WeakPolarHBondContact O-CG 3.5Å; L43-Q47 PolarHBondContact O-N 3.04Å; V44-Q47 PolarHBondContact O-N 3.25Å; Q47-L50 PolarHBondContact O-N 3.07Å; Q47-K51 WeakPolarHBondContact O-CG 3.38Å; Q47-K51 PolarHBondContact O-N 3.05Å
48	K	97.1	Very high	96.1	Very high	150 Å²	150	102 Å²	102	65%	0.652	52%	0.518	S	S	*	.	H	α-helix	trans	-64.6	-42.1	174.7	-73.6	174.6	-178.9	175.9	0	111.8	V44 S45 L46 K51 G52	V44-K48 HydrophobicContact CG1-CD 4.44Å; V44-K48 WeakPolarHBondContact O-CG 3.31Å; V44-K48 PolarHBondContact O-N 2.97Å; S45-K48 PolarHBondContact O-N 2.89Å; L46-K48 VanDerWaalsContact C-N 3.31Å; L46-K48 PolarHBondContact O-N 3.33Å; K48-K51 PolarHBondContact O-N 3.43Å; K48-G52 PolarHBondContact O-N 3.13Å
49	K	96.1	Very high	96	Very high	136 Å²	136	102.5 Å²	102.5	59%	0.591	52%	0.518	S	S	*	.	H	α-helix	trans	-62.7	-43.9	175.1	-70.9	177	-178.4	177	0	111.4	S45 L46 K51 G52 T53	S45-K49 WeakPolarHBondContact O-CG 3.47Å; S45-K49 PolarHBondContact O-N 2.88Å; S45-K49 VanDerWaalsContact O-N 3.07Å; L46-K49 PolarHBondContact O-N 3.48Å; K49-K51 PolarHBondContact O-N 3.35Å; K49-G52 PolarHBondContact O-N 3.49Å; K49-T53 WeakPolarHBondContact O-CG2 3.29Å; K49-T53 PolarHBondContact O-N 3.37Å; K49-T53 PolarHBondContact O-OG1 3.42Å
50	L	95.2	Very high	95.9	Very high	95 Å²	95	105.7 Å²	105.7	50%	0.497	52%	0.524	S	S	.	.	H	α-helix	trans	-57.8	-50.1	177.9	-176	68.7	0	0	0	111.1	L46 Q47 G52 T53 E54	L46-L50 WeakPolarHBondContact O-CB 3.49Å; L46-L50 PolarHBondContact O-N 3.2Å; Q47-L50 PolarHBondContact O-N 3.07Å; L50-G52 VanDerWaalsContact C-N 3.31Å; L50-G52 PolarHBondContact O-N 3.41Å; L50-T53 WeakPolarHBondContact CA-OG1 3.48Å; L50-T53 PolarHBondContact O-N 3.31Å; L50-T53 VanDerWaalsContact O-N 3.1Å; L50-T53 PolarHBondContact O-OG1 3.05Å; L50-E54 WeakPolarHBondContact O-CG 3.34Å; L50-E54 PolarHBondContact O-N 3.47Å
51	K	96.3	Very high	95.7	Very high	134 Å²	134	102.7 Å²	102.7	58%	0.583	52%	0.515	S	S	*	.	H	α-helix	trans	-59.2	-41.9	175.8	-72.2	-176.2	178.8	-174.7	0	112.6	Q47 K48 K49 T53 E54 D55	Q47-K51 WeakPolarHBondContact O-CG 3.38Å; Q47-K51 PolarHBondContact O-N 3.05Å; K48-K51 PolarHBondContact O-N 3.43Å; K49-K51 PolarHBondContact O-N 3.35Å; K51-T53 VanDerWaalsContact C-N 3.32Å; K51-T53 PolarHBondContact O-N 3.13Å; K51-E54 PolarHBondContact O-N 3.42Å; K51-D55 VanDerWaalsContact O-CG 3.29Å; K51-D55 PolarHBondContact O-N 3.38Å
52	G	94.9	Very high	95.6	Very high	29 Å²	29	103 Å²	103	30%	0.299	51%	0.513	S	S	.	.	H	α-helix	trans	-59.1	-42.5	174.6	0	0	0	0	0	112.7	K48 K49 L50 E56	K48-G52 PolarHBondContact O-N 3.13Å; K49-G52 PolarHBondContact O-N 3.49Å; L50-G52 VanDerWaalsContact C-N 3.31Å; L50-G52 PolarHBondContact O-N 3.41Å; G52-E56 WeakPolarHBondContact O-CG 3.43Å; G52-E56 PolarHBondContact O-N 2.97Å; G52-E56 VanDerWaalsContact O-N 3.1Å
53	T	94.3	Very high	95.5	Very high	80 Å²	80	100 Å²	100	49%	0.491	51%	0.508	S	S	.	.	H	α-helix	trans	-70.3	-33	176.2	54.9	0	0	0	0	113.2	K49 L50 K51 L57	K49-T53 WeakPolarHBondContact O-CG2 3.29Å; K49-T53 PolarHBondContact O-N 3.37Å; K49-T53 PolarHBondContact O-OG1 3.42Å; L50-T53 WeakPolarHBondContact CA-OG1 3.48Å; L50-T53 PolarHBondContact O-N 3.31Å; L50-T53 VanDerWaalsContact O-N 3.1Å; L50-T53 PolarHBondContact O-OG1 3.05Å; K51-T53 VanDerWaalsContact C-N 3.32Å; K51-T53 PolarHBondContact O-N 3.13Å; T53-L57 WeakPolarHBondContact O-CB 3.49Å; T53-L57 PolarHBondContact O-N 2.88Å
54	E	94.4	Very high	95.4	Very high	91 Å²	91	100 Å²	100	43%	0.425	51%	0.508	S	S	.	.	H	α-helix	trans	-65.1	-48.3	173.6	-71.8	168.8	165.6	0	0	110.5	L50 K51 E56 L57 D58	L50-E54 WeakPolarHBondContact O-CG 3.34Å; L50-E54 PolarHBondContact O-N 3.47Å; K51-E54 PolarHBondContact O-N 3.42Å; E54-E56 VanDerWaalsContact C-N 3.28Å; E54-E56 PolarHBondContact O-N 2.97Å; E54-L57 WeakPolarHBondContact O-CB 3.36Å; E54-L57 PolarHBondContact O-N 3.44Å; E54-L57 VanDerWaalsContact O-N 3.12Å; E54-D58 PolarHBondContact O-N 3.38Å
55	D	96.3	Very high	95.2	Very high	91 Å²	91	102.9 Å²	102.9	49%	0.487	52%	0.515	S	S	.	.	H	α-helix	trans	-60.6	-36.6	177.2	-69	-20	0	0	0	112.3	K51 K59	K51-D55 VanDerWaalsContact O-CG 3.29Å; K51-D55 PolarHBondContact O-N 3.38Å; D55-K59 VanDerWaalsContact O-CG 3.29Å; D55-K59 WeakPolarHBondContact O-CG 3.49Å; D55-K59 PolarHBondContact O-N 3.02Å
56	E	95	Very high	95.1	Very high	107 Å²	107	104.4 Å²	104.4	50%	0.5	52%	0.519	S	S	.	.	H	α-helix	trans	-67.8	-43.5	174.5	-76.5	176.3	-172.6	0	0	111.8	G52 E54 D58 K59 Y60	G52-E56 WeakPolarHBondContact O-CG 3.43Å; G52-E56 PolarHBondContact O-N 2.97Å; G52-E56 VanDerWaalsContact O-N 3.1Å; E54-E56 VanDerWaalsContact C-N 3.28Å; E54-E56 PolarHBondContact O-N 2.97Å; E56-D58 VanDerWaalsContact C-N 3.31Å; E56-D58 PolarHBondContact O-N 3.03Å; E56-K59 PolarHBondContact O-N 3.35Å; E56-Y60 HydrophobicContact CB-CE2 4.39Å; E56-Y60 WeakPolarHBondContact O-CD2 3.33Å; E56-Y60 PolarHBondContact O-N 3.27Å
57	L	94.6	Very high	95	Very high	110 Å²	110	102.1 Å²	102.1	58%	0.576	52%	0.515	S	S	*	.	H	α-helix	trans	-60.6	-41.8	177	-179.8	63.1	0	0	0	111.6	T53 E54 Y60 S61	T53-L57 WeakPolarHBondContact O-CB 3.49Å; T53-L57 PolarHBondContact O-N 2.88Å; E54-L57 WeakPolarHBondContact O-CB 3.36Å; E54-L57 PolarHBondContact O-N 3.44Å; E54-L57 VanDerWaalsContact O-N 3.12Å; L57-Y60 PolarHBondContact O-N 3.19Å; L57-S61 VanDerWaalsContact O-CB 3.31Å; L57-S61 WeakPolarHBondContact O-CB 3.46Å; L57-S61 PolarHBondContact O-N 2.91Å; L57-S61 PolarHBondContact O-OG 3.32Å
58	D	96.4	Very high	94.6	Very high	96 Å²	96	101.4 Å²	101.4	51%	0.513	51%	0.511	S	S	.	.	H	α-helix	trans	-61.9	-46	176.7	-76.6	-19.1	0	0	0	111.1	E54 E56 Y60 S61 E62	E54-D58 PolarHBondContact O-N 3.38Å; E56-D58 VanDerWaalsContact C-N 3.31Å; E56-D58 PolarHBondContact O-N 3.03Å; D58-Y60 PolarHBondContact O-N 3.07Å; D58-S61 WeakPolarHBondContact O-CB 3.44Å; D58-S61 PolarHBondContact O-N 2.93Å; D58-E62 WeakPolarHBondContact O-CG 3.48Å; D58-E62 PolarHBondContact O-N 2.96Å
59	K	96.6	Very high	94.4	Very high	135 Å²	135	100.1 Å²	100.1	59%	0.587	51%	0.508	S	S	*	.	H	α-helix	trans	-58.6	-46	175.7	-71.7	167.1	-171	163.2	0	112.6	D55 E56 S61 E62 A63	D55-K59 VanDerWaalsContact O-CG 3.29Å; D55-K59 WeakPolarHBondContact O-CG 3.49Å; D55-K59 PolarHBondContact O-N 3.02Å; E56-K59 PolarHBondContact O-N 3.35Å; K59-S61 VanDerWaalsContact C-N 3.31Å; K59-E62 PolarHBondContact O-N 2.94Å; K59-A63 WeakPolarHBondContact O-CB 3.4Å; K59-A63 PolarHBondContact O-N 2.88Å
60	Y	93.3	Very high	94.2	Very high	170 Å²	170	100.6 Å²	100.6	67%	0.667	51%	0.51	S	S	*	.	H	α-helix	trans	-67.3	-35	178.7	-73.1	-58.9	0	0	0	112	E56 L57 D58 A63 L64	E56-Y60 HydrophobicContact CB-CE2 4.39Å; E56-Y60 WeakPolarHBondContact O-CD2 3.33Å; E56-Y60 PolarHBondContact O-N 3.27Å; L57-Y60 PolarHBondContact O-N 3.19Å; D58-Y60 PolarHBondContact O-N 3.07Å; Y60-A63 PolarHBondContact O-N 2.97Å; Y60-L64 WeakPolarHBondContact O-CB 3.4Å; Y60-L64 PolarHBondContact O-N 3.45Å
61	S	92.4	Very high	93.8	Very high	46 Å²	46	101 Å²	101	32%	0.322	51%	0.512	S	S	.	.	H	α-helix	trans	-67.1	-40.7	177.5	-62	0	0	0	0	112.1	L57 D58 K59 K65	L57-S61 VanDerWaalsContact O-CB 3.31Å; L57-S61 WeakPolarHBondContact O-CB 3.46Å; L57-S61 PolarHBondContact O-N 2.91Å; L57-S61 PolarHBondContact O-OG 3.32Å; D58-S61 WeakPolarHBondContact O-CB 3.44Å; D58-S61 PolarHBondContact O-N 2.93Å; K59-S61 VanDerWaalsContact C-N 3.31Å; S61-K65 WeakPolarHBondContact O-CG 3.36Å; S61-K65 PolarHBondContact O-N 3.01Å
62	E	95.5	Very high	93.4	Very high	128 Å²	128	99.3 Å²	99.3	60%	0.598	51%	0.506	S	S	*	.	H	α-helix	trans	-65.5	-47.9	173.3	-70.9	-179.1	171.9	0	0	111.6	D58 K59 L64 K65 D66	D58-E62 WeakPolarHBondContact O-CG 3.48Å; D58-E62 PolarHBondContact O-N 2.96Å; K59-E62 PolarHBondContact O-N 2.94Å; E62-L64 PolarHBondContact O-N 3.42Å; E62-K65 PolarHBondContact O-N 3.23Å; E62-K65 VanDerWaalsContact O-N 3.1Å; E62-D66 PolarHBondContact O-N 3.29Å
63	A	94.5	Very high	93.1	Very high	55 Å²	55	102.5 Å²	102.5	46%	0.455	52%	0.516	S	S	.	.	H	α-helix	trans	-59.3	-36.1	178	0	0	0	0	0	112.6	K59 Y60 A67	K59-A63 WeakPolarHBondContact O-CB 3.4Å; K59-A63 PolarHBondContact O-N 2.88Å; Y60-A63 PolarHBondContact O-N 2.97Å; A63-A67 WeakPolarHBondContact O-CB 3.25Å; A63-A67 PolarHBondContact O-N 2.88Å
64	L	93.6	Very high	92.7	Very high	102 Å²	102	101.4 Å²	101.4	53%	0.534	52%	0.515	S	S	.	.	H	α-helix	trans	-65.2	-45.4	175.3	-179.5	63.5	0	0	0	111.6	Y60 E62 A67 Q68	Y60-L64 WeakPolarHBondContact O-CB 3.4Å; Y60-L64 PolarHBondContact O-N 3.45Å; E62-L64 PolarHBondContact O-N 3.42Å; L64-A67 PolarHBondContact O-N 3.19Å; L64-Q68 HydrophobicContact CD1-CG 4.38Å; L64-Q68 WeakPolarHBondContact O-CB 3.39Å; L64-Q68 VanDerWaalsContact O-CG 3.28Å; L64-Q68 WeakPolarHBondContact O-CG 3.35Å; L64-Q68 PolarHBondContact O-N 3.22Å
65	K	95.1	Very high	92.2	Very high	129 Å²	129	102.3 Å²	102.3	56%	0.561	52%	0.519	S	S	*	.	H	α-helix	trans	-60.2	-47.4	177	-71.7	172.8	-176.2	172.4	0	111.1	S61 E62 A67 Q68 E69	S61-K65 WeakPolarHBondContact O-CG 3.36Å; S61-K65 PolarHBondContact O-N 3.01Å; E62-K65 PolarHBondContact O-N 3.23Å; E62-K65 VanDerWaalsContact O-N 3.1Å; K65-A67 VanDerWaalsContact C-N 3.3Å; K65-A67 PolarHBondContact O-N 3.09Å; K65-Q68 WeakPolarHBondContact O-CB 3.28Å; K65-Q68 PolarHBondContact O-N 3.47Å; K65-Q68 VanDerWaalsContact O-N 3.16Å; K65-E69 WeakPolarHBondContact O-CG 3.4Å; K65-E69 PolarHBondContact O-N 3.29Å
66	D	93.8	Very high	91.5	Very high	88 Å²	88	103.6 Å²	103.6	47%	0.471	52%	0.52	S	S	.	.	H	α-helix	trans	-59	-40.4	177.2	-78.2	-1.1	0	0	0	112.6	E62 K70	E62-D66 PolarHBondContact O-N 3.29Å; D66-K70 VanDerWaalsContact O-CG 3.32Å; D66-K70 WeakPolarHBondContact O-CG 3.45Å; D66-K70 PolarHBondContact O-N 2.93Å; D66-K70 VanDerWaalsContact O-N 3.14Å
67	A	93	Very high	90.9	Very high	54 Å²	54	105.3 Å²	105.3	45%	0.446	53%	0.526	S	S	.	.	H	α-helix	trans	-67.8	-41.3	177.1	0	0	0	0	0	111.7	A63 L64 K65 K70 L71	A63-A67 WeakPolarHBondContact O-CB 3.25Å; A63-A67 PolarHBondContact O-N 2.88Å; L64-A67 PolarHBondContact O-N 3.19Å; K65-A67 VanDerWaalsContact C-N 3.3Å; K65-A67 PolarHBondContact O-N 3.09Å; A67-K70 PolarHBondContact O-N 3.27Å; A67-L71 WeakPolarHBondContact O-CB 3.43Å; A67-L71 PolarHBondContact O-N 3.47Å
68	Q	88	Confident	90	Very high	104 Å²	104	103.1 Å²	103.1	49%	0.486	52%	0.523	S	S	.	.	H	α-helix	trans	-62.7	-44.7	175.6	-74.4	174.2	-24.1	0	0	111.5	L64 K65 K70 L71 E72	L64-Q68 HydrophobicContact CD1-CG 4.38Å; L64-Q68 WeakPolarHBondContact O-CB 3.39Å; L64-Q68 VanDerWaalsContact O-CG 3.28Å; L64-Q68 WeakPolarHBondContact O-CG 3.35Å; L64-Q68 PolarHBondContact O-N 3.22Å; K65-Q68 WeakPolarHBondContact O-CB 3.28Å; K65-Q68 PolarHBondContact O-N 3.47Å; K65-Q68 VanDerWaalsContact O-N 3.16Å; Q68-K70 VanDerWaalsContact C-N 3.34Å; Q68-K70 PolarHBondContact O-N 2.95Å; Q68-L71 WeakPolarHBondContact O-CB 3.38Å; Q68-L71 PolarHBondContact O-N 2.99Å; Q68-E72 PolarHBondContact O-N 3.43Å
69	E	92.8	Very high	88.8	Confident	122 Å²	122	102.7 Å²	102.7	57%	0.57	53%	0.525	S	S	*	.	H	α-helix	trans	-61.2	-42.4	176.6	-73.4	-174.8	-177.3	0	0	112.2	K65 L71 E72 L73	K65-E69 WeakPolarHBondContact O-CG 3.4Å; K65-E69 PolarHBondContact O-N 3.29Å; E69-L71 VanDerWaalsContact C-N 3.33Å; E69-L71 PolarHBondContact O-N 2.96Å; E69-E72 PolarHBondContact O-N 3.25Å; E69-L73 VanDerWaalsContact O-CG 3.28Å; E69-L73 WeakPolarHBondContact O-CG 3.25Å; E69-L73 PolarHBondContact O-N 3.41Å
70	K	91.6	Very high	87.7	Confident	146 Å²	146	100.1 Å²	100.1	64%	0.635	52%	0.517	S	S	*	.	H	α-helix	trans	-63.2	-39.8	175.7	-74.2	170.1	-173.6	164.9	0	112.1	D66 A67 Q68 L73 A74	D66-K70 VanDerWaalsContact O-CG 3.32Å; D66-K70 WeakPolarHBondContact O-CG 3.45Å; D66-K70 PolarHBondContact O-N 2.93Å; D66-K70 VanDerWaalsContact O-N 3.14Å; A67-K70 PolarHBondContact O-N 3.27Å; Q68-K70 VanDerWaalsContact C-N 3.34Å; Q68-K70 PolarHBondContact O-N 2.95Å; K70-L73 PolarHBondContact O-N 3.3Å; K70-A74 WeakPolarHBondContact O-CB 3.42Å; K70-A74 PolarHBondContact O-N 2.9Å
71	L	87.3	Confident	86.6	Confident	103 Å²	103	96.3 Å²	96.3	54%	0.539	51%	0.511	S	S	.	.	H	α-helix	trans	-62.4	-50.4	175.7	-175.1	110.6	0	0	0	110.6	A67 Q68 E69 L73 A74 E75	A67-L71 WeakPolarHBondContact O-CB 3.43Å; A67-L71 PolarHBondContact O-N 3.47Å; Q68-L71 WeakPolarHBondContact O-CB 3.38Å; Q68-L71 PolarHBondContact O-N 2.99Å; E69-L71 VanDerWaalsContact C-N 3.33Å; E69-L71 PolarHBondContact O-N 2.96Å; L71-L73 VanDerWaalsContact C-N 3.28Å; L71-L73 PolarHBondContact O-N 2.95Å; L71-A74 WeakPolarHBondContact O-CB 3.47Å; L71-A74 PolarHBondContact O-N 3.42Å; L71-E75 WeakPolarHBondContact O-CG 3.46Å; L71-E75 PolarHBondContact O-N 3.04Å
72	E	88.6	Confident	85	Confident	100 Å²	100	96.9 Å²	96.9	47%	0.467	52%	0.515	S	S	.	.	H	α-helix	trans	-57.6	-41.2	177.5	-75.6	-166.5	-166.3	0	0	112.4	Q68 E69 A74 E75 K76	Q68-E72 PolarHBondContact O-N 3.43Å; E69-E72 PolarHBondContact O-N 3.25Å; E72-A74 VanDerWaalsContact C-N 3.33Å; E72-E75 PolarHBondContact O-N 3.26Å; E72-K76 WeakPolarHBondContact O-CB 3.41Å; E72-K76 VanDerWaalsContact O-CG 3.26Å; E72-K76 WeakPolarHBondContact O-CG 3.39Å; E72-K76 PolarHBondContact O-N 3.27Å; E72-K76 IonicContact OE2-NZ 3.79Å; E72-K76 PolarHBondContact OE2-NZ 3.16Å
73	L	88.3	Confident	83.4	Confident	96 Å²	96	93.5 Å²	93.5	50%	0.503	51%	0.51	S	S	.	.	H	α-helix	trans	-64.4	-38.8	176.5	-72.7	171.3	0	0	0	111.8	E69 K70 L71 K77	E69-L73 VanDerWaalsContact O-CG 3.28Å; E69-L73 WeakPolarHBondContact O-CG 3.25Å; E69-L73 PolarHBondContact O-N 3.41Å; K70-L73 PolarHBondContact O-N 3.3Å; L71-L73 VanDerWaalsContact C-N 3.28Å; L71-L73 PolarHBondContact O-N 2.95Å; L73-K77 WeakPolarHBondContact O-CB 3.4Å; L73-K77 VanDerWaalsContact O-CG 3.26Å; L73-K77 WeakPolarHBondContact O-CG 3.44Å; L73-K77 PolarHBondContact O-N 3.06Å; L73-K77 VanDerWaalsContact O-N 3.08Å
74	A	85.6	Confident	81.4	Confident	57 Å²	57	99 Å²	99	47%	0.471	52%	0.518	S	S	.	.	H	α-helix	trans	-67.1	-42.1	176.1	0	0	0	0	0	111.5	K70 L71 E72 K77 A78	K70-A74 WeakPolarHBondContact O-CB 3.42Å; K70-A74 PolarHBondContact O-N 2.9Å; L71-A74 WeakPolarHBondContact O-CB 3.47Å; L71-A74 PolarHBondContact O-N 3.42Å; E72-A74 VanDerWaalsContact C-N 3.33Å; A74-K77 PolarHBondContact O-N 3Å; A74-A78 WeakPolarHBondContact O-CB 2.83Å; A74-A78 PolarHBondContact O-N 3.1Å
75	E	83.3	Confident	79.5	Confident	109 Å²	109	97.7 Å²	97.7	51%	0.509	52%	0.518	S	S	.	.	H	α-helix	trans	-65	-42.8	176.9	-70.9	179.2	164	0	0	112.2	L71 E72 K77 A78 T79	L71-E75 WeakPolarHBondContact O-CG 3.46Å; L71-E75 PolarHBondContact O-N 3.04Å; E72-E75 PolarHBondContact O-N 3.26Å; E75-K77 VanDerWaalsContact C-N 3.32Å; E75-K77 PolarHBondContact O-N 3.24Å; E75-A78 PolarHBondContact O-N 2.87Å; E75-T79 WeakPolarHBondContact O-CB 3.4Å; E75-T79 WeakPolarHBondContact O-CG2 3.45Å; E75-T79 PolarHBondContact O-N 3Å; E75-T79 PolarHBondContact O-OG1 3.48Å
76	K	83.3	Confident	77.4	Confident	118 Å²	118	98.7 Å²	98.7	51%	0.513	52%	0.524	S	S	.	.	H	α-helix	trans	-60.7	-40.9	173.6	-74.1	167.8	-171.5	156	0	111.7	E72 T79 D80	E72-K76 WeakPolarHBondContact O-CB 3.41Å; E72-K76 VanDerWaalsContact O-CG 3.26Å; E72-K76 WeakPolarHBondContact O-CG 3.39Å; E72-K76 PolarHBondContact O-N 3.27Å; E72-K76 IonicContact OE2-NZ 3.79Å; E72-K76 PolarHBondContact OE2-NZ 3.16Å; K76-T79 WeakPolarHBondContact CA-OG1 3.45Å; K76-T79 PolarHBondContact O-OG1 3.13Å; K76-D80 WeakPolarHBondContact O-CB 3.4Å; K76-D80 PolarHBondContact O-N 3.3Å
77	K	82.3	Confident	75	Confident	144 Å²	144	99.7 Å²	99.7	63%	0.626	54%	0.537	S	S	*	.	H	α-helix	trans	-66.6	-44.9	175.5	-74.2	172.4	-176.9	179.2	0	111.9	L73 A74 E75 T79 D80 V81	L73-K77 WeakPolarHBondContact O-CB 3.4Å; L73-K77 VanDerWaalsContact O-CG 3.26Å; L73-K77 WeakPolarHBondContact O-CG 3.44Å; L73-K77 PolarHBondContact O-N 3.06Å; L73-K77 VanDerWaalsContact O-N 3.08Å; A74-K77 PolarHBondContact O-N 3Å; E75-K77 VanDerWaalsContact C-N 3.32Å; E75-K77 PolarHBondContact O-N 3.24Å; K77-T79 VanDerWaalsContact C-N 3.32Å; K77-T79 PolarHBondContact O-N 3.44Å; K77-D80 PolarHBondContact O-N 2.84Å; K77-V81 VanDerWaalsContact O-CG2 3.28Å; K77-V81 WeakPolarHBondContact O-CG2 3.35Å; K77-V81 PolarHBondContact O-N 2.9Å
78	A	74.6	Confident	72.4	Confident	63 Å²	63	102.4 Å²	102.4	52%	0.521	54%	0.539	S	S	.	.	H	α-helix	trans	-63.6	-39	178.8	0	0	0	0	0	111.9	A74 E75 S82	A74-A78 WeakPolarHBondContact O-CB 2.83Å; A74-A78 PolarHBondContact O-N 3.1Å; E75-A78 PolarHBondContact O-N 2.87Å; A78-S82 WeakPolarHBondContact O-CB 3.47Å; A78-S82 PolarHBondContact O-N 2.99Å
79	T	72.5	Confident	70.7	Confident	88 Å²	88	102.4 Å²	102.4	54%	0.54	55%	0.548	S	S	.	.	H	α-helix	trans	-71	-39.6	176.2	49.3	0	0	0	0	112.7	E75 K76 K77 V81 S82 A83	E75-T79 WeakPolarHBondContact O-CB 3.4Å; E75-T79 WeakPolarHBondContact O-CG2 3.45Å; E75-T79 PolarHBondContact O-N 3Å; E75-T79 PolarHBondContact O-OG1 3.48Å; K76-T79 WeakPolarHBondContact CA-OG1 3.45Å; K76-T79 PolarHBondContact O-OG1 3.13Å; K77-T79 VanDerWaalsContact C-N 3.32Å; K77-T79 PolarHBondContact O-N 3.44Å; T79-V81 PolarHBondContact O-N 3.02Å; T79-S82 PolarHBondContact O-N 3.24Å; T79-A83 WeakPolarHBondContact O-CB 3.36Å; T79-A83 PolarHBondContact O-N 3.18Å
80	D	72.7	Confident	68.3	Low	81 Å²	81	103.7 Å²	103.7	43%	0.433	55%	0.554	S	S	.	*	H	α-helix	trans	-60.9	-43.4	173.1	-177.4	-98	0	0	0	111.7	K76 K77 A83 R84	K76-D80 WeakPolarHBondContact O-CB 3.4Å; K76-D80 PolarHBondContact O-N 3.3Å; K77-D80 PolarHBondContact O-N 2.84Å; D80-A83 PolarHBondContact O-N 3.28Å; D80-R84 WeakPolarHBondContact O-CB 3.48Å; D80-R84 VanDerWaalsContact O-CG 3.31Å; D80-R84 WeakPolarHBondContact O-CG 3.38Å; D80-R84 PolarHBondContact O-N 3.49Å; D80-R84 WeakPolarHBondContact OD1-CD 3.49Å; D80-R84 IonicContact OD1-CZ 2.99Å; D80-R84 IonicContact OD1-NE 2.86Å; D80-R84 PolarHBondContact OD1-NE 3.09Å; D80-R84 IonicContact OD1-NH2 3.73Å; D80-R84 IonicContact OD2-NE 3.66Å
81	V	70.2	Confident	66	Low	89 Å²	89	102 Å²	102	54%	0.539	55%	0.551	S	S	.	*	H	α-helix	trans	-64.7	-46.4	176.3	174.7	0	0	0	0	111.1	K77 T79 A83 R84 S85	K77-V81 VanDerWaalsContact O-CG2 3.28Å; K77-V81 WeakPolarHBondContact O-CG2 3.35Å; K77-V81 PolarHBondContact O-N 2.9Å; T79-V81 PolarHBondContact O-N 3.02Å; V81-A83 VanDerWaalsContact C-N 3.35Å; V81-A83 PolarHBondContact O-N 3.16Å; V81-R84 PolarHBondContact O-N 3.49Å; V81-S85 PolarHBondContact O-N 3.24Å; V81-S85 PolarHBondContact O-OG 3.43Å
82	S	59.7	Low	63.8	Low	58 Å²	58	102.9 Å²	102.9	41%	0.406	56%	0.556	S	S	.	*	H	α-helix	trans	-62.3	-40.4	176.8	179.8	0	0	0	0	112.5	A78 T79 S85 H86	A78-S82 WeakPolarHBondContact O-CB 3.47Å; A78-S82 PolarHBondContact O-N 2.99Å; T79-S82 PolarHBondContact O-N 3.24Å; S82-S85 PolarHBondContact O-N 2.91Å; S82-H86 WeakPolarHBondContact O-CB 3.34Å; S82-H86 PolarHBondContact O-N 3.47Å; S82-H86 PolarHBondContact O-ND1 3Å
83	A	60.4	Low	61.7	Low	58 Å²	58	103.4 Å²	103.4	48%	0.479	57%	0.568	S	S	.	*	H	α-helix	trans	-68.1	-41	178	0	0	0	0	0	111.6	T79 D80 V81 S85 H86 C87	T79-A83 WeakPolarHBondContact O-CB 3.36Å; T79-A83 PolarHBondContact O-N 3.18Å; D80-A83 PolarHBondContact O-N 3.28Å; V81-A83 VanDerWaalsContact C-N 3.35Å; V81-A83 PolarHBondContact O-N 3.16Å; A83-S85 VanDerWaalsContact C-N 3.35Å; A83-H86 PolarHBondContact O-N 2.93Å; A83-C87 WeakPolarHBondContact O-CB 3.35Å; A83-C87 PolarHBondContact O-N 3.11Å
84	R	53.9	Low	59.7	Low	169 Å²	169	103.5 Å²	103.5	64%	0.638	58%	0.582	S	S	*	*	H	α-helix	trans	-62.6	-40.6	172.8	-75.5	174.3	-174.7	-103	-3.4	112	D80 V81 F88	D80-R84 WeakPolarHBondContact O-CB 3.48Å; D80-R84 VanDerWaalsContact O-CG 3.31Å; D80-R84 WeakPolarHBondContact O-CG 3.38Å; D80-R84 PolarHBondContact O-N 3.49Å; D80-R84 WeakPolarHBondContact OD1-CD 3.49Å; D80-R84 IonicContact OD1-CZ 2.99Å; D80-R84 IonicContact OD1-NE 2.86Å; D80-R84 PolarHBondContact OD1-NE 3.09Å; D80-R84 IonicContact OD1-NH2 3.73Å; D80-R84 IonicContact OD2-NE 3.66Å; V81-R84 PolarHBondContact O-N 3.49Å; R84-F88 PolarHBondContact O-N 3.35Å
85	S	53.7	Low	57.4	Low	75 Å²	75	111.7 Å²	111.7	52%	0.524	60%	0.601	S	S	.	*	H	α-helix	trans	-68	-36.9	174.9	-70.2	0	0	0	0	113	V81 S82 A83	V81-S85 PolarHBondContact O-N 3.24Å; V81-S85 PolarHBondContact O-OG 3.43Å; S82-S85 PolarHBondContact O-N 2.91Å; A83-S85 VanDerWaalsContact C-N 3.35Å
86	H	50.4	Low	55.6	Low	150 Å²	150	111.1 Å²	111.1	69%	0.694	61%	0.607	S	S	*	*	H	α-helix	trans	-74.6	-31.3	176.5	-86.3	91.4	0	0	0	113.5	S82 A83 P89	S82-H86 WeakPolarHBondContact O-CB 3.34Å; S82-H86 PolarHBondContact O-N 3.47Å; S82-H86 PolarHBondContact O-ND1 3Å; A83-H86 PolarHBondContact O-N 2.93Å; H86-P89 WeakPolarHBondContact O-CD 3.48Å
87	C	43.7	Very low	53.9	Low	109 Å²	109	114.3 Å²	114.3	74%	0.736	63%	0.628	S	S	*	*	H	α-helix	trans	-83	-15.5	178	-116.8	0	0	0	0	113.9	A83 P89	A83-C87 WeakPolarHBondContact O-CB 3.35Å; A83-C87 PolarHBondContact O-N 3.11Å; C87-P89 VanDerWaalsContact C-CD 3.41Å; C87-P89 WeakPolarHBondContact O-CD 3.48Å
88	F	38.4	Very low	52	Low	111 Å²	111	118 Å²	118	49%	0.487	64%	0.638	S	S	.	*			trans	-119.1	67.2	171.6	-89	-78.3	0	0	0	113	R84 H90 L91	R84-F88 PolarHBondContact O-N 3.35Å; F88-H90 AromaticContact CD1-ND1 3.83Å; F88-H90 AromaticContact CE1-CE1 3.91Å; F88-H90 PolarHBondContact O-N 3.28Å; F88-L91 HydrophobicContact CD1-CB 3.84Å; F88-L91 HydrophobicContact CD1-CD1 3.28Å; F88-L91 HydrophobicContact CD1-CG 4.18Å; F88-L91 HydrophobicContact CE1-CD1 3.1Å; F88-L91 HydrophobicContact CE1-CG 4.39Å; F88-L91 HydrophobicContact CG-CD1 4.49Å; F88-L91 HydrophobicContact CZ-CD1 4.23Å
89	P	51.6	Low	50.5	Low	104 Å²	104	118.4 Å²	118.4	68%	0.675	65%	0.648	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.8	-19.4	169.1	-8.5	22.3	0	0	0	112.4	H86 C87	H86-P89 WeakPolarHBondContact O-CD 3.48Å; C87-P89 VanDerWaalsContact C-CD 3.41Å; C87-P89 WeakPolarHBondContact O-CD 3.48Å
90	H	41.9	Very low	49.5	Very low	150 Å²	150	123.3 Å²	123.3	69%	0.694	67%	0.665	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.7	-2.4	-167.9	100.9	-83.2	0	0	0	115.5	F88	F88-H90 AromaticContact CD1-ND1 3.83Å; F88-H90 AromaticContact CE1-CE1 3.91Å; F88-H90 PolarHBondContact O-N 3.28Å
91	L	43.4	Very low	48.4	Very low	109 Å²	109	127.7 Å²	127.7	57%	0.571	68%	0.683	S	S	*	*			trans	-117.1	9.1	-175.3	-105	138.7	0	0	0	114.9	F88 P93	F88-L91 HydrophobicContact CD1-CB 3.84Å; F88-L91 HydrophobicContact CD1-CD1 3.28Å; F88-L91 HydrophobicContact CD1-CG 4.18Å; F88-L91 HydrophobicContact CE1-CD1 3.1Å; F88-L91 HydrophobicContact CE1-CG 4.39Å; F88-L91 HydrophobicContact CG-CD1 4.49Å; F88-L91 HydrophobicContact CZ-CD1 4.23Å; L91-P93 VanDerWaalsContact O-CD 3.24Å; L91-P93 WeakPolarHBondContact O-CD 3.43Å
92	L	40.6	Very low	47.2	Very low	123 Å²	123	134.9 Å²	134.9	64%	0.644	70%	0.7	S	S	*	*			trans	-73.8	111.4	162.5	-84	133.1	0	0	0	108.3	A94	L92-A94 PolarHBondContact O-N 2.96Å
93	P	44.3	Very low	46.7	Very low	111 Å²	111	137 Å²	137	72%	0.721	72%	0.721	S	S	*	*			trans	-65.3	127.4	165.5	7.6	7	0	0	0	106.1	L91 W95	L91-P93 VanDerWaalsContact O-CD 3.24Å; L91-P93 WeakPolarHBondContact O-CD 3.43Å; P93-W95 PolarHBondContact O-N 3.39Å
94	A	48.2	Very low	46.1	Very low	97 Å²	97	137 Å²	137	80%	0.802	73%	0.727	S	S	*	*			trans	-45.5	104.1	175.1	0	0	0	0	0	110.1	L92 P96	L92-A94 PolarHBondContact O-N 2.96Å; A94-P96 WeakPolarHBondContact O-CD 3.34Å
95	W	36.3	Very low	45.8	Very low	230 Å²	230	137.6 Å²	137.6	87%	0.871	74%	0.737	S	S	*	*			trans	-61.8	124.5	167.5	-96.8	-33.5	0	0	0	106.8	P93 L97	P93-W95 PolarHBondContact O-N 3.39Å; W95-L97 PolarHBondContact O-N 3.32Å
96	P	44.4	Very low	45.3	Very low	97 Å²	97	146.8 Å²	146.8	63%	0.63	77%	0.772	S	S	*	*			trans	-72.5	118.8	-179.9	23.1	-20.8	0	0	0	108	A94 R98	A94-P96 WeakPolarHBondContact O-CD 3.34Å; P96-R98 PolarHBondContact O-N 3.03Å
97	L	48	Very low	45	Very low	184 Å²	184	146.7 Å²	146.7	96%	0.963	78%	0.776	S	S	*	*			trans	-59.6	78.5	152.4	-82.4	119.1	0	0	0	108.2	W95	W95-L97 PolarHBondContact O-N 3.32Å
98	R	42.3	Very low	45.1	Very low	222 Å²	222	148.6 Å²	148.6	84%	0.838	78%	0.778	S	S	*	*			trans	-97.6	93.4	168.3	-165	178.8	-72.1	-99.4	3.2	106.9	P96 H100	P96-R98 PolarHBondContact O-N 3.03Å; R98-H100 PolarHBondContact O-N 3.39Å
99	G	43.5	Very low	45.5	Very low	71 Å²	71	150.7 Å²	150.7	73%	0.732	79%	0.794	S	S	*	*			trans	-55.7	130.8	176	0	0	0	0	0	112	H101	G99-H101 PolarHBondContact O-N 3.41Å
100	H	51	Low	45.1	Very low	191 Å²	191	153.5 Å²	153.5	88%	0.884	80%	0.801	S	S	*	*	S	Bend	trans	-61.2	106.3	154.6	-101.6	-95.9	0	0	0	108.9	R98	R98-H100 PolarHBondContact O-N 3.39Å
101	H	50.2	Low	45.3	Very low	174 Å²	174	153.7 Å²	153.7	81%	0.806	81%	0.807	S	S	*	*			trans	160.9	101.8	134	-111.2	-79.6	0	0	0	111	G99	G99-H101 PolarHBondContact O-N 3.41Å
102	R	45.3	Very low	45.4	Very low	239 Å²	239	156.7 Å²	156.7	90%	0.902	82%	0.823	S	S	*	*			trans	-160.1	81.7	139.7	-143.7	179.4	-135.1	-131.6	3.4	109.4
103	A	48.4	Very low	45.8	Very low	102 Å²	102	159.1 Å²	159.1	84%	0.843	84%	0.836	S	S	*	*			trans	-100.3	113	157.9	0	0	0	0	0	106.5
104	G	49.5	Very low	45.9	Very low	59 Å²	59	162.8 Å²	162.8	61%	0.608	85%	0.845	S	S	*	*			trans	160.3	123.4	176.8	0	0	0	0	0	111.7
105	E	45.9	Very low	45.7	Very low	181 Å²	181	168.3 Å²	168.3	85%	0.846	85%	0.848	S	S	*	*			trans	84.2	83.3	176.1	-58.5	-170	105.7	0	0	117.8
106	Q	43.4	Very low	46.5	Very low	269 Å²	269	162.6 Å²	162.6	100%	1.257	85%	0.846	S	S	*	*				-176.6	0	93.3	-97.3	170.2	70.9	0	0	110.4

Retrieved 106 of 106 residues in 52.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).