A0A087WTR0_HUMAN Loading...

Zinc finger HIT-type containing 3

AlphaFold DB , UniProt , Accession A0A087WTR0, Species HUMAN (Homo sapiens, Human), Gene ZNHIT3, Length 40 aa.

						>A0A087WTR0_HUMAN|A0A087WTR0|ZNHIT3
MASLKCSTVVCVICLEKPKYRCPACRVPYATLKLVLLRKK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	33.9	Very low	42.5	Very low	210 Å²	210	111 Å²	111	100%	1.034	66%	0.659	S	S	*	*				0	104.6	0	-171.1	106.8	88.5	0	0	107.2	S3 K33	M1-S3 PolarHBondContact O-N 3.21Å; M1-K33 PolarHBondContact SD-NZ 2.98Å
2	A	29.8	Very low	43.2	Very low	86 Å²	86	113.3 Å²	113.3	71%	0.711	67%	0.674	S	S	*	*			trans	-59.2	132.9	-176.1	0	0	0	0	0	110.7	L4	A2-L4 PolarHBondContact O-N 2.96Å
3	S	37.5	Very low	43.5	Very low	121 Å²	121	115.8 Å²	115.8	85%	0.846	68%	0.68	S	S	*	*			trans	-58	99.3	176.7	-169.4	0	0	0	0	109.3	M1 K5	M1-S3 PolarHBondContact O-N 3.21Å; S3-K5 PolarHBondContact O-N 3.42Å
4	L	43.1	Very low	43.8	Very low	118 Å²	118	110.9 Å²	110.9	62%	0.618	65%	0.654	S	S	*	*			trans	-81.5	101.7	175.4	-70.7	172	0	0	0	107	A2 C6 K33	A2-L4 PolarHBondContact O-N 2.96Å; L4-C6 PolarHBondContact O-N 2.73Å; L4-C6 VanDerWaalsContact O-N 3.08Å; L4-K33 VanDerWaalsContact CD1-CE 3.49Å
5	K	37.8	Very low	44.4	Very low	187 Å²	187	113.1 Å²	113.1	81%	0.813	66%	0.661	S	S	*	*			trans	-20.4	109.2	162.9	-62.8	166.3	-178.6	-179	0	110.1	S3 S7	S3-K5 PolarHBondContact O-N 3.42Å; K5-S7 PolarHBondContact O-N 3.08Å
6	C	42.4	Very low	44.7	Very low	131 Å²	131	115.8 Å²	115.8	89%	0.885	67%	0.665	S	S	*	*			trans	-68.6	60.2	175.2	-66	0	0	0	0	110.4	L4 T8	L4-C6 PolarHBondContact O-N 2.73Å; L4-C6 VanDerWaalsContact O-N 3.08Å; C6-T8 PolarHBondContact O-N 3.29Å
7	S	46.9	Very low	45	Very low	92 Å²	92	118.8 Å²	118.8	64%	0.643	67%	0.668	S	S	*	*			trans	-68.1	117.4	161.1	-64.7	0	0	0	0	105.7	K5 V9	K5-S7 PolarHBondContact O-N 3.08Å; S7-V9 PolarHBondContact O-N 2.86Å
8	T	45.9	Very low	45.3	Very low	94 Å²	94	113.9 Å²	113.9	58%	0.577	64%	0.643	S	S	*	*			trans	-53.8	103.5	178.1	-23.3	0	0	0	0	107.5	C6 V10	C6-T8 PolarHBondContact O-N 3.29Å; T8-V10 VanDerWaalsContact C-N 3.27Å; T8-V10 PolarHBondContact O-N 3.33Å
9	V	52.2	Low	45.6	Very low	87 Å²	87	117.7 Å²	117.7	53%	0.527	65%	0.651	S	S	.	*			trans	-71.6	90.4	-179.5	-179.6	0	0	0	0	106.9	S7	S7-V9 PolarHBondContact O-N 2.86Å
10	V	50.4	Low	45.9	Very low	64 Å²	64	122.3 Å²	122.3	39%	0.388	66%	0.66	S	S	.	*			trans	-73.8	130.6	170.9	-176.8	0	0	0	0	106.9	T8 V12	T8-V10 VanDerWaalsContact C-N 3.27Å; T8-V10 PolarHBondContact O-N 3.33Å; V10-V12 PolarHBondContact O-N 2.85Å
11	C	47.9	Very low	46	Very low	31 Å²	31	125.5 Å²	125.5	21%	0.209	66%	0.663	C	S	.	*			trans	-64.4	118.6	171	-69.9	0	0	0	0	108	I13 C14 L15	C11-I13 PolarHBondContact O-N 3.4Å; C11-C14 HydrophobicContact CB-CB 4.05Å; C11-C14 PolarHBondContact O-N 3.26Å; C11-L15 PolarHBondContact O-N 3.32Å
12	V	50.9	Low	46.6	Very low	138 Å²	138	116.5 Å²	116.5	84%	0.836	62%	0.62	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.5	-14.8	177.9	-65.4	0	0	0	0	113.6	V10	V10-V12 PolarHBondContact O-N 2.85Å
13	I	46.6	Very low	47.5	Very low	146 Å²	146	118 Å²	118	75%	0.749	62%	0.623	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88	-37.6	176.2	-57.6	178.2	0	0	0	111.7	C11	C11-I13 PolarHBondContact O-N 3.4Å
14	C	48.3	Very low	47.8	Very low	47 Å²	47	116.1 Å²	116.1	32%	0.318	61%	0.614	S	S	.	*	T	Hydrogen-bonded Turn	trans	-98.2	-22.7	-170	-54.2	0	0	0	0	112.9	C11 E16	C11-C14 HydrophobicContact CB-CB 4.05Å; C11-C14 PolarHBondContact O-N 3.26Å; C14-E16 PolarHBondContact O-N 3.17Å
15	L	51.9	Low	48.2	Very low	144 Å²	144	113.2 Å²	113.2	75%	0.754	60%	0.603	S	S	*	*			trans	49.8	-8.4	-173.4	-89	99.2	0	0	0	116.9	C11	C11-L15 PolarHBondContact O-N 3.32Å
16	E	50.2	Low	48.8	Very low	157 Å²	157	115.3 Å²	115.3	73%	0.734	61%	0.606	S	S	*	*	S	Bend	trans	-87.2	144.5	179	-71.8	-170.9	96.7	0	0	111.4	C14 P18	C14-E16 PolarHBondContact O-N 3.17Å; E16-P18 WeakPolarHBondContact O-CD 3.33Å
17	K	49.2	Very low	49	Very low	166 Å²	166	111.4 Å²	111.4	72%	0.722	58%	0.578	S	S	*	*			trans	-65.3	114.6	-177.3	-163.7	152.6	-179.4	179	0	109.2	K19	K17-K19 PolarHBondContact O-N 3.48Å
18	P	51.6	Low	48.9	Very low	31 Å²	31	109.8 Å²	109.8	20%	0.201	57%	0.565	C	S	.	*			trans	-72.5	102.1	-171	27.8	-32.9	0	0	0	109.1	E16	E16-P18 WeakPolarHBondContact O-CD 3.33Å
19	K	50.5	Low	49.1	Very low	187 Å²	187	111.2 Å²	111.2	81%	0.813	56%	0.561	S	S	*	*	S	Bend	trans	-72.4	-30.6	-174.6	-127.5	162.2	-175.5	175.2	0	112.6	K17	K17-K19 PolarHBondContact O-N 3.48Å
20	Y	51	Low	48.8	Very low	209 Å²	209	111.3 Å²	111.3	82%	0.82	57%	0.571	S	S	*	*	S	Bend	trans	-153.9	-22.9	168.4	-88	-73.4	0	0	0	117.7
21	R	49	Very low	48.6	Very low	190 Å²	190	111.6 Å²	111.6	72%	0.717	57%	0.573	S	S	*	*			trans	-167.2	140.5	175.5	-99.8	151.6	-168.6	-179.4	3.4	107.9	P23	R21-P23 VanDerWaalsContact O-CD 3.31Å; R21-P23 WeakPolarHBondContact O-CD 3.31Å
22	C	45.1	Very low	48.7	Very low	21 Å²	21	112.7 Å²	112.7	14%	0.142	58%	0.576	C	S	.	*			trans	-78.8	115.5	174	-177.9	0	0	0	0	109.2	A24 C25 R26	C22-A24 PolarHBondContact O-N 3.24Å; C22-C25 HydrophobicContact CB-CB 3.98Å; C22-C25 PolarHBondContact O-N 3.43Å; C22-R26 PolarHBondContact O-N 3.49Å; C22-R26 VanDerWaalsContact O-N 3.15Å
23	P	48.3	Very low	48.4	Very low	118 Å²	118	111.7 Å²	111.7	77%	0.766	56%	0.561	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.6	-22.3	-177.3	26.8	-33.6	0	0	0	112.9	R21	R21-P23 VanDerWaalsContact O-CD 3.31Å; R21-P23 WeakPolarHBondContact O-CD 3.31Å
24	A	44.4	Very low	48.1	Very low	80 Å²	80	110.5 Å²	110.5	66%	0.661	56%	0.555	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.4	-34.6	174.7	0	0	0	0	0	112.7	C22	C22-A24 PolarHBondContact O-N 3.24Å
25	C	52.4	Low	47.7	Very low	58 Å²	58	112.8 Å²	112.8	39%	0.392	57%	0.567	S	S	.	*	T	Hydrogen-bonded Turn	trans	-86.3	-22.6	-176.7	-60.5	0	0	0	0	112.6	C22 V27	C22-C25 HydrophobicContact CB-CB 3.98Å; C22-C25 PolarHBondContact O-N 3.43Å; C25-V27 WeakPolarHBondContact O-CG2 3.05Å; C25-V27 PolarHBondContact O-N 3.02Å
26	R	50.3	Low	47.4	Very low	231 Å²	231	111.9 Å²	111.9	87%	0.872	56%	0.563	S	S	*	*			trans	45	21	-175.7	-65.5	-169.7	-174.2	-171.5	3.1	114.7	C22	C22-R26 PolarHBondContact O-N 3.49Å; C22-R26 VanDerWaalsContact O-N 3.15Å
27	V	45.4	Very low	46.8	Very low	48 Å²	48	111.6 Å²	111.6	29%	0.291	57%	0.566	S	S	.	*			trans	-101	122.1	-178.3	-176.1	0	0	0	0	109.1	C25 L32	C25-V27 WeakPolarHBondContact O-CG2 3.05Å; C25-V27 PolarHBondContact O-N 3.02Å; V27-L32 HydrophobicContact CB-CD2 4.15Å; V27-L32 HydrophobicContact CG1-CD2 3.8Å; V27-L32 HydrophobicContact CG1-CG 3.95Å
28	P	46.6	Very low	46.4	Very low	58 Å²	58	113.7 Å²	113.7	38%	0.377	57%	0.569	S	S	.	*			trans	-67.4	137.9	166.9	26.5	-29.6	0	0	0	109.2	A30 T31	P28-A30 PolarHBondContact O-N 2.93Å; P28-T31 PolarHBondContact O-N 3.2Å; P28-T31 PolarHBondContact O-OG1 2.79Å
29	Y	50.1	Low	45.9	Very low	124 Å²	124	121.6 Å²	121.6	49%	0.486	60%	0.6	S	S	.	*	T	Hydrogen-bonded Turn	trans	-45	-24.7	-178.2	-81.8	-89	0	0	0	115.3	T31 L32	Y29-T31 VanDerWaalsContact C-N 3.33Å; Y29-T31 PolarHBondContact O-N 3.48Å; Y29-L32 HydrophobicContact CD1-CD1 4.16Å
30	A	45.4	Very low	45.5	Very low	90 Å²	90	125 Å²	125	74%	0.744	62%	0.615	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.7	-32.2	176.6	0	0	0	0	0	114.1	P28	P28-A30 PolarHBondContact O-N 2.93Å
31	T	45.3	Very low	45.2	Very low	69 Å²	69	120.9 Å²	120.9	42%	0.423	61%	0.605	S	S	.	*	T	Hydrogen-bonded Turn	trans	-91.2	-18.1	-175	-26.3	0	0	0	0	113	P28 Y29 K33 L34 V35	P28-T31 PolarHBondContact O-N 3.2Å; P28-T31 PolarHBondContact O-OG1 2.79Å; Y29-T31 VanDerWaalsContact C-N 3.33Å; Y29-T31 PolarHBondContact O-N 3.48Å; T31-K33 PolarHBondContact O-N 2.92Å; T31-K33 VanDerWaalsContact O-N 3.17Å; T31-L34 PolarHBondContact O-N 2.98Å; T31-V35 PolarHBondContact O-N 3.23Å
32	L	51.3	Low	45	Very low	55 Å²	55	117.2 Å²	117.2	29%	0.288	60%	0.599	S	S	.	*	H	α-helix	trans	-61.7	-25.2	179	-67.1	176.3	0	0	0	112.6	V27 Y29 L34 V35 L36	V27-L32 HydrophobicContact CB-CD2 4.15Å; V27-L32 HydrophobicContact CG1-CD2 3.8Å; V27-L32 HydrophobicContact CG1-CG 3.95Å; Y29-L32 HydrophobicContact CD1-CD1 4.16Å; L32-L34 PolarHBondContact O-N 2.68Å; L32-V35 PolarHBondContact O-N 3.03Å; L32-L36 PolarHBondContact O-N 3.15Å
33	K	44.3	Very low	45	Very low	116 Å²	116	122.6 Å²	122.6	50%	0.504	62%	0.624	S	S	.	*	H	α-helix	trans	-62.7	-22.4	174.7	-121.7	-180	-175.2	173.5	0	113.6	M1 L4 T31	M1-K33 PolarHBondContact SD-NZ 2.98Å; L4-K33 VanDerWaalsContact CD1-CE 3.49Å; T31-K33 PolarHBondContact O-N 2.92Å; T31-K33 VanDerWaalsContact O-N 3.17Å
34	L	39.9	Very low	44.8	Very low	122 Å²	122	122.8 Å²	122.8	64%	0.639	62%	0.616	S	S	*	*	H	α-helix	trans	-101.1	-26.6	-176.3	-139.4	147.6	0	0	0	112.3	T31 L32	T31-L34 PolarHBondContact O-N 2.98Å; L32-L34 PolarHBondContact O-N 2.68Å
35	V	39.3	Very low	44.9	Very low	94 Å²	94	125.5 Å²	125.5	57%	0.57	61%	0.613	S	S	*	*	H	α-helix	trans	-84.4	-35.2	-179.3	178.5	0	0	0	0	112.5	T31 L32 L37 R38	T31-V35 PolarHBondContact O-N 3.23Å; L32-V35 PolarHBondContact O-N 3.03Å; V35-L37 VanDerWaalsContact C-N 3.3Å; V35-L37 PolarHBondContact O-N 2.8Å; V35-R38 PolarHBondContact O-N 3.3Å
36	L	46.3	Very low	44.4	Very low	126 Å²	126	130 Å²	130	66%	0.66	63%	0.628	S	S	*	*	G	3₁₀ helix	trans	-73.8	-17.4	178.1	-95.4	142.2	0	0	0	114.1	L32 R38	L32-L36 PolarHBondContact O-N 3.15Å; L36-R38 VanDerWaalsContact C-N 3.3Å
37	L	37.1	Very low	43.9	Very low	151 Å²	151	122.8 Å²	122.8	79%	0.791	61%	0.611	S	S	*	*	G	3₁₀ helix	trans	-84.2	-3.2	175.2	-141.3	99.1	0	0	0	113.4	V35	V35-L37 VanDerWaalsContact C-N 3.3Å; V35-L37 PolarHBondContact O-N 2.8Å
38	R	41.2	Very low	43.8	Very low	209 Å²	209	128.5 Å²	128.5	79%	0.789	64%	0.635	S	S	*	*	G	3₁₀ helix	trans	-110.6	10.6	-179	-69.8	-72.3	-176.4	138.3	-0.6	113.4	V35 L36 K40	V35-R38 PolarHBondContact O-N 3.3Å; L36-R38 VanDerWaalsContact C-N 3.3Å; R38-K40 VanDerWaalsContact C-N 3.29Å
39	K	39.8	Very low	43.6	Very low	197 Å²	197	134.4 Å²	134.4	86%	0.857	66%	0.657	S	S	*	*			trans	-97.8	47.5	170.1	-105	-95.8	-178.8	169	0	110.3
40	K	43.1	Very low	43	Very low	260 Å²	260	135.4 Å²	135.4	100%	1.13	67%	0.672	S	S	*	*			trans	-124.9	0	158.9	-172.6	164.9	-174.9	171.7	0	107.9	R38	R38-K40 VanDerWaalsContact C-N 3.29Å

Retrieved 40 of 40 residues in 79.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).