A0A087WTS1_HUMAN Loading...

ADAM metallopeptidase with thrombospondin type 1 motif 9

AlphaFold DB , UniProt , Accession A0A087WTS1, Species HUMAN (Homo sapiens, Human), Gene ADAMTS9, Length 69 aa.

						>A0A087WTS1_HUMAN|A0A087WTS1|ADAMTS9
AKCPQGRFSINLYGTGLSLTESARWISQGNYAVSDIKKSPDGTRVVGKCGGYCGKCTPSSGTGLEVRVL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	A	59.1	Low	87.3	Confident	120 Å²	120	102 Å²	102	99%	0.992	56%	0.564	S	S	*	*				0	134.3	0	0	0	0	0	0	110	C3 Y52	A1-C3 VanDerWaalsContact CB-SG 3.57Å; A1-C3 PolarHBondContact O-N 3.44Å; A1-C3 VanDerWaalsContact O-N 3.11Å; A1-C3 PolarHBondContact O-SG 3.19Å; A1-C3 VanDerWaalsContact O-SG 3.36Å; A1-Y52 HydrophobicContact CB-CD2 4.21Å
2	K	67.9	Low	88.2	Confident	223 Å²	223	96 Å²	96	97%	0.97	53%	0.53	S	S	*	.			trans	-77	91.5	168.9	-75.4	-174.3	-179	178.8	0	107.9
3	C	81.6	Confident	88.9	Confident	25 Å²	25	99.9 Å²	99.9	17%	0.169	53%	0.534	C	S	.	.			trans	-87.8	143.7	-175.9	-52.9	0	0	0	0	110.1	A1 Q5 G51 Y52	A1-C3 VanDerWaalsContact CB-SG 3.57Å; A1-C3 PolarHBondContact O-N 3.44Å; A1-C3 VanDerWaalsContact O-N 3.11Å; A1-C3 PolarHBondContact O-SG 3.19Å; A1-C3 VanDerWaalsContact O-SG 3.36Å; C3-Q5 PolarHBondContact O-N 2.75Å; C3-G51 VanDerWaalsContact CB-O 3.25Å; C3-G51 WeakPolarHBondContact CB-O 3.29Å; C3-Y52 WeakPolarHBondContact SG-CA 3.19Å; C3-Y52 WeakPolarHBondContact SG-CB 3.44Å; C3-Y52 WeakPolarHBondContact SG-CD2 3.41Å
4	P	84.4	Confident	89.5	Confident	115 Å²	115	98.1 Å²	98.1	75%	0.747	55%	0.551	S	S	*	*			trans	-60.6	139.5	-179.7	25	-32.6	0	0	0	110.6	G51	P4-G51 PolarHBondContact O-N 3.29Å
5	Q	91.8	Very high	90.1	Very high	66 Å²	66	96.8 Å²	96.8	31%	0.308	55%	0.546	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.9	125.4	176.7	-65	168.2	10.9	0	0	107.2	C3 V33 K48 C49	C3-Q5 PolarHBondContact O-N 2.75Å; Q5-V33 HydrophobicContact CG-CB 4.45Å; Q5-K48 HydrophobicContact CB-CD 4.42Å; Q5-K48 HydrophobicContact CB-CG 3.99Å; Q5-C49 CarbonylContact C-O 3.52Å; Q5-C49 WeakPolarHBondContact CA-O 3.01Å
6	G	92.6	Very high	90.6	Very high	46 Å²	46	92.9 Å²	92.9	47%	0.474	53%	0.534	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.7	152.1	173.2	0	0	0	0	0	111.2	K48 C49	G6-K48 WeakPolarHBondContact O-CA 3.33Å; G6-C49 PolarHBondContact N-O 3.48Å; G6-C49 PolarHBondContact O-N 3.1Å
7	R	95.2	Very high	91	Very high	225 Å²	225	91.1 Å²	91.1	85%	0.849	52%	0.522	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-109.1	140.7	169.4	-62.6	179.3	76.1	154.4	2	108.5	G47 K48	R7-G47 CarbonylContact C-O 3.21Å; R7-G47 VanDerWaalsContact CA-O 3.29Å; R7-G47 WeakPolarHBondContact CA-O 3.44Å; R7-K48 HydrophobicContact CG-CG 4.46Å
8	F	95.9	Very high	91.3	Very high	66 Å²	66	86.1 Å²	86.1	29%	0.289	49%	0.493	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-141	160.1	173.8	76.1	-87.2	0	0	0	110.3	W25 I36 V45 G47 C49	F8-W25 HydrophobicContact CE2-CZ2 4.12Å; F8-W25 AromaticContact CZ-CE2 3.95Å; F8-W25 HydrophobicContact CZ-CZ2 4.32Å; F8-W25 AromaticContact CZ-NE1 3.71Å; F8-I36 HydrophobicContact CE1-CD1 3.83Å; F8-I36 HydrophobicContact CE1-CG1 3.91Å; F8-I36 HydrophobicContact CZ-CD1 3.8Å; F8-I36 HydrophobicContact CZ-CG1 3.94Å; F8-I36 HydrophobicContact CZ-CG2 3.89Å; F8-V45 HydrophobicContact CE2-CG1 3.86Å; F8-V45 HydrophobicContact CZ-CG1 4.27Å; F8-G47 PolarHBondContact N-O 2.85Å; F8-G47 PolarHBondContact O-N 3.31Å; F8-C49 HydrophobicContact CE1-CB 4.31Å
9	S	97.4	Very high	91.6	Very high	92 Å²	92	81.7 Å²	81.7	64%	0.643	47%	0.468	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-144.2	148.6	173	57.2	0	0	0	0	111.4	V45	S9-V45 CarbonylContact C-O 3.46Å; S9-V45 WeakPolarHBondContact CA-O 3.4Å; S9-V45 WeakPolarHBondContact CB-O 3.19Å
10	I	97.3	Very high	91.8	Very high	40 Å²	40	78.3 Å²	78.3	21%	0.205	45%	0.449	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.9	131.2	169.9	-54.8	172.6	0	0	0	106.5	L12 L19 W25 R44 V45 L64	I10-L12 HydrophobicContact CG2-CD2 4.24Å; I10-L12 HydrophobicContact CG2-CG 4.06Å; I10-L19 HydrophobicContact CD1-CD1 4.4Å; I10-W25 HydrophobicContact CD1-CH2 4.33Å; I10-W25 HydrophobicContact CD1-CZ2 3.9Å; I10-R44 CarbonylContact O-C 3.58Å; I10-R44 WeakPolarHBondContact O-CA 3.41Å; I10-V45 HydrophobicContact CB-CB 4.01Å; I10-V45 HydrophobicContact CB-CG2 4.34Å; I10-V45 HydrophobicContact CD1-CB 4.32Å; I10-V45 HydrophobicContact CD1-CG2 4.37Å; I10-V45 HydrophobicContact CG1-CB 4.28Å; I10-V45 PolarHBondContact N-O 2.87Å; I10-V45 PolarHBondContact O-N 3.5Å; I10-L64 HydrophobicContact CD1-CD1 4.18Å; I10-L64 HydrophobicContact CD1-CD2 3.95Å
11	N	97.6	Very high	91.7	Very high	104 Å²	104	82.5 Å²	82.5	56%	0.556	46%	0.464	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-132.7	109.6	176.6	-175.1	13.6	0	0	0	109.4	Y13	N11-Y13 WeakPolarHBondContact OD1-CB 3.35Å; N11-Y13 PolarHBondContact OD1-N 2.91Å; N11-Y13 VanDerWaalsContact OD1-N 3.1Å
12	L	98.1	Very high	93.3	Very high	30 Å²	30	79 Å²	79	16%	0.157	43%	0.433	C	S	.	.			trans	-108.8	8.4	176.4	-54.3	177	0	0	0	111.3	I10 G14 T15 L17 L19 T43 V66	I10-L12 HydrophobicContact CG2-CD2 4.24Å; I10-L12 HydrophobicContact CG2-CG 4.06Å; L12-G14 PolarHBondContact O-N 3.04Å; L12-T15 PolarHBondContact O-N 3.11Å; L12-T15 PolarHBondContact O-OG1 3.29Å; L12-L17 HydrophobicContact CB-CB 4.5Å; L12-L17 WeakPolarHBondContact CB-O 3.43Å; L12-L17 HydrophobicContact CD1-CB 4.4Å; L12-L19 HydrophobicContact CD1-CG 4.2Å; L12-T43 PolarHBondContact N-O 3.05Å; L12-V66 HydrophobicContact CD1-CG1 4.39Å
13	Y	97.4	Very high	94.5	Very high	147 Å²	147	68.5 Å²	68.5	58%	0.576	39%	0.388	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.4	130.9	-178.5	-177.5	-100.2	0	0	0	111.1	N11 T15 R44	N11-Y13 WeakPolarHBondContact OD1-CB 3.35Å; N11-Y13 PolarHBondContact OD1-N 2.91Å; N11-Y13 VanDerWaalsContact OD1-N 3.1Å; Y13-T15 VanDerWaalsContact C-N 3.29Å; Y13-T15 PolarHBondContact O-N 2.72Å; Y13-R44 VanDerWaalsContact CD1-NH2 3.31Å
14	G	97.3	Very high	95	Very high	75 Å²	75	74 Å²	74	77%	0.773	41%	0.405	S	S	*	.	T	Hydrogen-bonded Turn	trans	79.1	1.8	179	0	0	0	0	0	115.3	L12	L12-G14 PolarHBondContact O-N 3.04Å
15	T	97.9	Very high	95.5	Very high	78 Å²	78	70.6 Å²	70.6	48%	0.479	38%	0.377	S	S	.	.	T	Hydrogen-bonded Turn	trans	-92.6	-7.3	179.7	69.1	0	0	0	0	113.9	L12 Y13 L17	L12-T15 PolarHBondContact O-N 3.11Å; L12-T15 PolarHBondContact O-OG1 3.29Å; Y13-T15 VanDerWaalsContact C-N 3.29Å; Y13-T15 PolarHBondContact O-N 2.72Å; T15-L17 PolarHBondContact O-N 2.51Å; T15-L17 WeakPolarHBondContact OG1-CB 3.3Å; T15-L17 PolarHBondContact OG1-N 3.18Å
16	G	97.5	Very high	95.6	Very high	35 Å²	35	69.5 Å²	69.5	36%	0.361	37%	0.373	S	S	.	.	T	Hydrogen-bonded Turn	trans	73.5	14.4	-170.2	0	0	0	0	0	113.6	V68 L69	G16-V68 WeakPolarHBondContact O-CA 3.47Å; G16-L69 PolarHBondContact O-N 3.23Å
17	L	97.7	Very high	95.7	Very high	62 Å²	62	70.4 Å²	70.4	33%	0.325	37%	0.372	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117	146.5	178.6	-57.8	174.6	0	0	0	111.1	L12 T15 V66 R67 V68	L12-L17 HydrophobicContact CB-CB 4.5Å; L12-L17 WeakPolarHBondContact CB-O 3.43Å; L12-L17 HydrophobicContact CD1-CB 4.4Å; T15-L17 PolarHBondContact O-N 2.51Å; T15-L17 WeakPolarHBondContact OG1-CB 3.3Å; T15-L17 PolarHBondContact OG1-N 3.18Å; L17-V66 HydrophobicContact CB-CG1 3.8Å; L17-V66 HydrophobicContact CD1-CG1 4.34Å; L17-V66 HydrophobicContact CD2-CG1 4.22Å; L17-V66 HydrophobicContact CG-CG1 4.34Å; L17-R67 CarbonylContact C-O 3.52Å; L17-R67 WeakPolarHBondContact CA-O 3.15Å; L17-V68 HydrophobicContact CD2-CG2 3.99Å
18	S	97.5	Very high	95.6	Very high	0 Å²	0	63.1 Å²	63.1	0%	0	35%	0.348	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.6	150.5	169.4	80.5	0	0	0	0	111.2	D41 V66 R67	S18-D41 WeakPolarHBondContact CB-O 3.29Å; S18-V66 CarbonylContact O-C 3.53Å; S18-V66 WeakPolarHBondContact O-CA 3.31Å; S18-R67 PolarHBondContact N-O 3.24Å; S18-R67 PolarHBondContact O-N 3.18Å; S18-R67 VanDerWaalsContact OG-CG 3.28Å; S18-R67 WeakPolarHBondContact OG-CG 3.23Å; S18-R67 PolarHBondContact OG-NE 3.39Å
19	L	96.3	Very high	95.3	Very high	4 Å²	4	62.8 Å²	62.8	2%	0.021	36%	0.363	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.1	145.2	163.9	-68.6	173.2	0	0	0	109.9	I10 L12 A23 W25 K38 G42 V45 L64 E65 V66	I10-L19 HydrophobicContact CD1-CD1 4.4Å; L12-L19 HydrophobicContact CD1-CG 4.2Å; L19-A23 HydrophobicContact CB-CB 4.23Å; L19-A23 HydrophobicContact CD2-CB 4.38Å; L19-W25 HydrophobicContact CD1-CH2 4.03Å; L19-K38 HydrophobicContact CB-CD 4.18Å; L19-K38 HydrophobicContact CD1-CD 4.36Å; L19-G42 WeakPolarHBondContact CB-O 3.41Å; L19-G42 PolarHBondContact N-O 3.14Å; L19-V45 HydrophobicContact CD1-CG2 3.38Å; L19-L64 HydrophobicContact CD1-CD1 4.19Å; L19-L64 HydrophobicContact CD2-CD1 3.63Å; L19-L64 HydrophobicContact CD2-CG 3.74Å; L19-E65 WeakPolarHBondContact CD2-O 3.37Å; L19-V66 HydrophobicContact CD2-CG2 3.9Å
20	T	94.7	Very high	94.8	Very high	13 Å²	13	63.7 Å²	63.7	8%	0.08	36%	0.36	C	S	.	.			trans	-71.6	162.6	172.8	61.8	0	0	0	0	110.8	S22 A23 K38 E65 R67	T20-S22 PolarHBondContact O-N 3.23Å; T20-S22 PolarHBondContact OG1-OG 2.9Å; T20-A23 WeakPolarHBondContact O-CB 3.48Å; T20-A23 PolarHBondContact O-N 2.86Å; T20-A23 PolarHBondContact OG1-N 2.91Å; T20-K38 PolarHBondContact O-NZ 2.83Å; T20-E65 HydrophobicContact CG2-CB 4.1Å; T20-E65 HydrophobicContact CG2-CG 3.68Å; T20-E65 PolarHBondContact N-O 3.03Å; T20-E65 VanDerWaalsContact N-O 3.14Å; T20-E65 PolarHBondContact OG1-OE2 3.3Å; T20-R67 HydrophobicContact CG2-CB 4.18Å; T20-R67 HydrophobicContact CG2-CG 4.3Å
21	E	91.1	Very high	94.3	Very high	166 Å²	166	71 Å²	71	78%	0.776	39%	0.387	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.4	-34.4	174.7	-72.6	-177	-172.8	0	0	111.9	A23 K38	E21-A23 VanDerWaalsContact C-N 3.27Å; E21-A23 PolarHBondContact O-N 2.89Å; E21-K38 PolarHBondContact O-NZ 2.89Å
22	S	92	Very high	94	Very high	48 Å²	48	67.5 Å²	67.5	34%	0.336	37%	0.372	S	S	.	.	T	Hydrogen-bonded Turn	trans	-67.8	-20.6	178.2	60.3	0	0	0	0	113.8	T20 R24 T62 E65	T20-S22 PolarHBondContact O-N 3.23Å; T20-S22 PolarHBondContact OG1-OG 2.9Å; S22-R24 PolarHBondContact O-N 2.86Å; S22-R24 VanDerWaalsContact O-N 3.16Å; S22-T62 PolarHBondContact O-OG1 2.81Å; S22-E65 PolarHBondContact OG-OE2 3.18Å; S22-E65 VanDerWaalsContact OG-OE2 3.12Å
23	A	93.9	Very high	93.6	Very high	2 Å²	2	68.5 Å²	68.5	2%	0.017	38%	0.379	C	S	.	.			trans	-66.8	110.5	173.3	0	0	0	0	0	110.4	L19 T20 E21 K38	L19-A23 HydrophobicContact CB-CB 4.23Å; L19-A23 HydrophobicContact CD2-CB 4.38Å; T20-A23 WeakPolarHBondContact O-CB 3.48Å; T20-A23 PolarHBondContact O-N 2.86Å; T20-A23 PolarHBondContact OG1-N 2.91Å; E21-A23 VanDerWaalsContact C-N 3.27Å; E21-A23 PolarHBondContact O-N 2.89Å; A23-K38 PolarHBondContact O-NZ 2.82Å
24	R	92.3	Very high	93.5	Very high	141 Å²	141	63.9 Å²	63.9	53%	0.532	37%	0.368	S	S	.	.			trans	-144	158.1	-178.1	68	-174.8	177.2	93.2	-0.7	110.9	S22 P58 S59	S22-R24 PolarHBondContact O-N 2.86Å; S22-R24 VanDerWaalsContact O-N 3.16Å; R24-P58 WeakPolarHBondContact O-CA 3.35Å; R24-S59 PolarHBondContact NH2-OG 3.11Å; R24-S59 PolarHBondContact O-N 3.3Å
25	W	94.1	Very high	93.4	Very high	43 Å²	43	64.3 Å²	64.3	16%	0.163	35%	0.353	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.9	146	176.7	-69.5	-105.1	0	0	0	110.5	F8 I10 L19 I36 V45 T57 L64	F8-W25 HydrophobicContact CE2-CZ2 4.12Å; F8-W25 AromaticContact CZ-CE2 3.95Å; F8-W25 HydrophobicContact CZ-CZ2 4.32Å; F8-W25 AromaticContact CZ-NE1 3.71Å; I10-W25 HydrophobicContact CD1-CH2 4.33Å; I10-W25 HydrophobicContact CD1-CZ2 3.9Å; L19-W25 HydrophobicContact CD1-CH2 4.03Å; W25-I36 HydrophobicContact CB-CD1 3.44Å; W25-I36 VanDerWaalsContact CB-CD1 3.44Å; W25-I36 HydrophobicContact CD2-CD1 4Å; W25-I36 HydrophobicContact CD2-CG2 3.94Å; W25-I36 HydrophobicContact CE3-CG2 3.68Å; W25-I36 HydrophobicContact CG-CD1 3.43Å; W25-I36 VanDerWaalsContact CG-CD1 3.43Å; W25-I36 HydrophobicContact CZ3-CG2 4.07Å; W25-V45 HydrophobicContact CH2-CB 4.43Å; W25-V45 HydrophobicContact CH2-CG1 3.88Å; W25-V45 HydrophobicContact CH2-CG2 3.85Å; W25-V45 HydrophobicContact CZ2-CG1 4.21Å; W25-V45 HydrophobicContact CZ3-CG1 4.28Å; W25-V45 HydrophobicContact CZ3-CG2 4.43Å; W25-T57 CarbonylContact C-O 3.58Å; W25-T57 VanDerWaalsContact CA-O 3.29Å; W25-T57 WeakPolarHBondContact CA-O 3.39Å; W25-L64 HydrophobicContact CH2-CD1 3.66Å; W25-L64 HydrophobicContact CZ2-CD1 3.48Å; W25-L64 VanDerWaalsContact CZ2-CD1 3.48Å
26	I	94.5	Very high	93.3	Very high	42 Å²	42	62.3 Å²	62.3	22%	0.215	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.3	138.8	175.6	57.3	171.9	0	0	0	109.7	C56 T57	I26-C56 VanDerWaalsContact O-CA 3.23Å; I26-C56 WeakPolarHBondContact O-CA 3.46Å; I26-T57 WeakPolarHBondContact CG1-O 3.46Å; I26-T57 PolarHBondContact N-O 2.74Å; I26-T57 PolarHBondContact O-N 3.16Å
27	S	94.1	Very high	93.2	Very high	66 Å²	66	67 Å²	67	46%	0.462	35%	0.35	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.3	137.1	172.7	-67	0	0	0	0	110.5	S34	S27-S34 VanDerWaalsContact OG-CB 3.29Å; S27-S34 WeakPolarHBondContact OG-CB 3.28Å
28	Q	92.5	Very high	93.1	Very high	72 Å²	72	67.4 Å²	67.4	34%	0.336	35%	0.349	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.7	142.4	176.3	-62.9	-175.3	-6.3	0	0	110.3	G54 K55 T57	Q28-G54 CarbonylContact O-C 3.56Å; Q28-G54 VanDerWaalsContact O-CA 3.31Å; Q28-G54 WeakPolarHBondContact O-CA 3.49Å; Q28-K55 HydrophobicContact CB-CG 4Å; Q28-K55 PolarHBondContact N-O 3.49Å; Q28-K55 PolarHBondContact O-N 2.94Å; Q28-T57 PolarHBondContact NE2-OG1 2.95Å
29	G	90.4	Very high	93.1	Very high	59 Å²	59	68.7 Å²	68.7	61%	0.608	36%	0.358	S	S	*	.	S	Bend	trans	88.6	-172.5	-179.6	0	0	0	0	0	113.8
30	N	86.5	Confident	93	Very high	110 Å²	110	75.5 Å²	75.5	59%	0.588	40%	0.402	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.6	138.1	-172.6	-70.6	-32.4	0	0	0	111.7	A32 Y52	N30-A32 PolarHBondContact O-N 2.99Å; N30-A32 VanDerWaalsContact O-N 3.07Å; N30-Y52 CarbonylContact O-C 3.49Å
31	Y	86.3	Confident	93	Very high	195 Å²	195	78.3 Å²	78.3	77%	0.765	42%	0.416	S	S	*	.	T	Hydrogen-bonded Turn	trans	45.9	43.2	176.9	-54.2	-80.5	0	0	0	113.7	Y52	Y31-Y52 HydrophobicContact CD2-CD1 4.3Å
32	A	91.6	Very high	93.3	Very high	29 Å²	29	70.6 Å²	70.6	24%	0.24	38%	0.381	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.9	135.5	177.3	0	0	0	0	0	110.6	N30 G50	N30-A32 PolarHBondContact O-N 2.99Å; N30-A32 VanDerWaalsContact O-N 3.07Å; A32-G50 CarbonylContact C-O 3.58Å; A32-G50 WeakPolarHBondContact CA-O 3.33Å
33	V	90.3	Very high	93.5	Very high	52 Å²	52	68.6 Å²	68.6	32%	0.315	37%	0.367	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.5	128.3	173	175.7	0	0	0	0	107.8	Q5 C49 G50 C56	Q5-V33 HydrophobicContact CG-CB 4.45Å; V33-C49 WeakPolarHBondContact O-CA 3.37Å; V33-G50 PolarHBondContact N-O 3.32Å; V33-G50 PolarHBondContact O-N 2.02Å; V33-G50 VanDerWaalsContact O-N 3.11Å; V33-C56 PolarHBondContact O-SG 2.83Å; V33-C56 VanDerWaalsContact O-SG 3.32Å
34	S	94.1	Very high	93.7	Very high	49 Å²	49	73.4 Å²	73.4	34%	0.343	39%	0.385	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.1	97	177.5	174.6	0	0	0	0	109.3	S27	S27-S34 VanDerWaalsContact OG-CB 3.29Å; S27-S34 WeakPolarHBondContact OG-CB 3.28Å
35	D	95.1	Very high	94	Very high	85 Å²	85	66.7 Å²	66.7	46%	0.455	36%	0.36	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.2	94.8	169.1	178.2	14.7	0	0	0	107.6	G47 K48	D35-G47 CarbonylContact O-C 3.57Å; D35-G47 WeakPolarHBondContact O-CA 3.39Å; D35-K48 HydrophobicContact CB-CB 4.43Å; D35-K48 PolarHBondContact N-O 2.75Å; D35-K48 PolarHBondContact O-N 2.81Å
36	I	96.4	Very high	94.2	Very high	35 Å²	35	68.8 Å²	68.8	18%	0.179	38%	0.377	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.9	120.7	-173.7	-58.9	169.3	0	0	0	108.1	F8 W25 V45 C56	F8-I36 HydrophobicContact CE1-CD1 3.83Å; F8-I36 HydrophobicContact CE1-CG1 3.91Å; F8-I36 HydrophobicContact CZ-CD1 3.8Å; F8-I36 HydrophobicContact CZ-CG1 3.94Å; F8-I36 HydrophobicContact CZ-CG2 3.89Å; W25-I36 HydrophobicContact CB-CD1 3.44Å; W25-I36 VanDerWaalsContact CB-CD1 3.44Å; W25-I36 HydrophobicContact CD2-CD1 4Å; W25-I36 HydrophobicContact CD2-CG2 3.94Å; W25-I36 HydrophobicContact CE3-CG2 3.68Å; W25-I36 HydrophobicContact CG-CD1 3.43Å; W25-I36 VanDerWaalsContact CG-CD1 3.43Å; W25-I36 HydrophobicContact CZ3-CG2 4.07Å; I36-V45 HydrophobicContact CG2-CG1 3.6Å; I36-C56 HydrophobicContact CD1-CB 4.33Å
37	K	96.4	Very high	94.2	Very high	135 Å²	135	67.2 Å²	67.2	59%	0.587	37%	0.371	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-114.2	122.5	-178.3	-62.4	-179.5	-176.8	179.7	0	109.1	V45 V46	K37-V45 VanDerWaalsContact O-CA 3.3Å; K37-V45 WeakPolarHBondContact O-CA 3.42Å; K37-V46 HydrophobicContact CB-CG2 4.12Å; K37-V46 PolarHBondContact N-O 3.27Å; K37-V46 PolarHBondContact O-N 3.12Å
38	K	95.8	Very high	94.3	Very high	70 Å²	70	68.3 Å²	68.3	30%	0.304	37%	0.368	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.9	134.7	171	-175.3	170.2	67.9	-172.5	0	108.1	L19 T20 E21 A23 R44 V45	L19-K38 HydrophobicContact CB-CD 4.18Å; L19-K38 HydrophobicContact CD1-CD 4.36Å; T20-K38 PolarHBondContact O-NZ 2.83Å; E21-K38 PolarHBondContact O-NZ 2.89Å; A23-K38 PolarHBondContact O-NZ 2.82Å; K38-R44 CarbonylContact C-O 3.57Å; K38-R44 WeakPolarHBondContact CA-O 3.34Å; K38-V45 HydrophobicContact CB-CG2 4.31Å; K38-V45 HydrophobicContact CG-CG2 4.17Å
39	S	96.1	Very high	94.4	Very high	27 Å²	27	65.9 Å²	65.9	19%	0.189	36%	0.358	C	S	.	.			trans	-65.4	152.8	173.5	57.2	0	0	0	0	110.6	D41 G42 T43 R44	S39-D41 WeakPolarHBondContact CB-OD1 3.34Å; S39-D41 PolarHBondContact O-N 2.92Å; S39-D41 PolarHBondContact OG-OD1 2.99Å; S39-G42 PolarHBondContact O-N 2.9Å; S39-T43 PolarHBondContact OG-N 2.77Å; S39-R44 PolarHBondContact N-O 3.41Å; S39-R44 PolarHBondContact OG-N 3.37Å; S39-R44 PolarHBondContact OG-O 3.39Å
40	P	95.1	Very high	94.5	Very high	146 Å²	146	63.5 Å²	63.5	95%	0.948	33%	0.334	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.9	-35	-179.9	-26.9	35.5	0	0	0	113.9	G42	P40-G42 PolarHBondContact O-N 2.93Å
41	D	95	Very high	94.6	Very high	72 Å²	72	58.8 Å²	58.8	39%	0.385	31%	0.311	S	S	.	.	T	Hydrogen-bonded Turn	trans	-78.6	-2.8	177	68.5	-11.3	0	0	0	113.7	S18 S39 T43	S18-D41 WeakPolarHBondContact CB-O 3.29Å; S39-D41 WeakPolarHBondContact CB-OD1 3.34Å; S39-D41 PolarHBondContact O-N 2.92Å; S39-D41 PolarHBondContact OG-OD1 2.99Å; D41-T43 HydrophobicContact CB-CG2 4.31Å; D41-T43 PolarHBondContact O-N 2.95Å; D41-T43 PolarHBondContact OD1-N 2.79Å; D41-T43 VanDerWaalsContact OD1-N 3.11Å; D41-T43 PolarHBondContact OD1-OG1 3.29Å; D41-T43 WeakPolarHBondContact OD2-CG2 3.46Å; D41-T43 PolarHBondContact OD2-OG1 3.36Å
42	G	96.2	Very high	94.7	Very high	4 Å²	4	55.8 Å²	55.8	4%	0.041	30%	0.299	C	S	.	.	S	Bend	trans	69.5	6.2	-179.5	0	0	0	0	0	115	L19 S39 P40	L19-G42 WeakPolarHBondContact CB-O 3.41Å; L19-G42 PolarHBondContact N-O 3.14Å; S39-G42 PolarHBondContact O-N 2.9Å; P40-G42 PolarHBondContact O-N 2.93Å
43	T	97.9	Very high	94.4	Very high	7 Å²	7	59.9 Å²	59.9	4%	0.043	33%	0.325	C	S	.	.	S	Bend	trans	-86.4	-17.9	-175.8	68.6	0	0	0	0	113.3	L12 S39 D41 L69	L12-T43 PolarHBondContact N-O 3.05Å; S39-T43 PolarHBondContact OG-N 2.77Å; D41-T43 HydrophobicContact CB-CG2 4.31Å; D41-T43 PolarHBondContact O-N 2.95Å; D41-T43 PolarHBondContact OD1-N 2.79Å; D41-T43 VanDerWaalsContact OD1-N 3.11Å; D41-T43 PolarHBondContact OD1-OG1 3.29Å; D41-T43 WeakPolarHBondContact OD2-CG2 3.46Å; D41-T43 PolarHBondContact OD2-OG1 3.36Å; T43-L69 HydrophobicContact CG2-CD1 4.45Å
44	R	97.6	Very high	94.5	Very high	102 Å²	102	57.9 Å²	57.9	39%	0.385	32%	0.315	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.2	140.3	-177.1	-66.2	-178.5	175	94.8	-6.3	111.8	I10 Y13 K38 S39	I10-R44 CarbonylContact O-C 3.58Å; I10-R44 WeakPolarHBondContact O-CA 3.41Å; Y13-R44 VanDerWaalsContact CD1-NH2 3.31Å; K38-R44 CarbonylContact C-O 3.57Å; K38-R44 WeakPolarHBondContact CA-O 3.34Å; S39-R44 PolarHBondContact N-O 3.41Å; S39-R44 PolarHBondContact OG-N 3.37Å; S39-R44 PolarHBondContact OG-O 3.39Å
45	V	97.8	Very high	94.4	Very high	1 Å²	1	61.2 Å²	61.2	1%	0.006	32%	0.323	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.3	135.2	169.7	-178.2	0	0	0	0	108.9	F8 S9 I10 L19 W25 I36 K37 K38	F8-V45 HydrophobicContact CE2-CG1 3.86Å; F8-V45 HydrophobicContact CZ-CG1 4.27Å; S9-V45 CarbonylContact C-O 3.46Å; S9-V45 WeakPolarHBondContact CA-O 3.4Å; S9-V45 WeakPolarHBondContact CB-O 3.19Å; I10-V45 HydrophobicContact CB-CB 4.01Å; I10-V45 HydrophobicContact CB-CG2 4.34Å; I10-V45 HydrophobicContact CD1-CB 4.32Å; I10-V45 HydrophobicContact CD1-CG2 4.37Å; I10-V45 HydrophobicContact CG1-CB 4.28Å; I10-V45 PolarHBondContact N-O 2.87Å; I10-V45 PolarHBondContact O-N 3.5Å; L19-V45 HydrophobicContact CD1-CG2 3.38Å; W25-V45 HydrophobicContact CH2-CB 4.43Å; W25-V45 HydrophobicContact CH2-CG1 3.88Å; W25-V45 HydrophobicContact CH2-CG2 3.85Å; W25-V45 HydrophobicContact CZ2-CG1 4.21Å; W25-V45 HydrophobicContact CZ3-CG1 4.28Å; W25-V45 HydrophobicContact CZ3-CG2 4.43Å; I36-V45 HydrophobicContact CG2-CG1 3.6Å; K37-V45 VanDerWaalsContact O-CA 3.3Å; K37-V45 WeakPolarHBondContact O-CA 3.42Å; K38-V45 HydrophobicContact CB-CG2 4.31Å; K38-V45 HydrophobicContact CG-CG2 4.17Å
46	V	97.8	Very high	94.3	Very high	87 Å²	87	58.1 Å²	58.1	53%	0.527	31%	0.308	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.7	131.5	166.4	-68.1	0	0	0	0	108.4	K37	K37-V46 HydrophobicContact CB-CG2 4.12Å; K37-V46 PolarHBondContact N-O 3.27Å; K37-V46 PolarHBondContact O-N 3.12Å
47	G	96.1	Very high	94.1	Very high	8 Å²	8	58.3 Å²	58.3	8%	0.082	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.2	144.4	-173.5	0	0	0	0	0	113.3	R7 F8 D35	R7-G47 CarbonylContact C-O 3.21Å; R7-G47 VanDerWaalsContact CA-O 3.29Å; R7-G47 WeakPolarHBondContact CA-O 3.44Å; F8-G47 PolarHBondContact N-O 2.85Å; F8-G47 PolarHBondContact O-N 3.31Å; D35-G47 CarbonylContact O-C 3.57Å; D35-G47 WeakPolarHBondContact O-CA 3.39Å
48	K	95.3	Very high	93.9	Very high	90 Å²	90	54.2 Å²	54.2	39%	0.391	30%	0.298	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.8	120.4	164.7	-165.9	-174.8	-166.1	-155.5	0	107.8	Q5 G6 R7 D35	Q5-K48 HydrophobicContact CB-CD 4.42Å; Q5-K48 HydrophobicContact CB-CG 3.99Å; G6-K48 WeakPolarHBondContact O-CA 3.33Å; R7-K48 HydrophobicContact CG-CG 4.46Å; D35-K48 HydrophobicContact CB-CB 4.43Å; D35-K48 PolarHBondContact N-O 2.75Å; D35-K48 PolarHBondContact O-N 2.81Å
49	C	94	Very high	93.8	Very high	20 Å²	20	51 Å²	51	14%	0.135	29%	0.285	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-141	143.9	-170.9	171.9	0	0	0	0	111.4	Q5 G6 F8 V33 C56	Q5-C49 CarbonylContact C-O 3.52Å; Q5-C49 WeakPolarHBondContact CA-O 3.01Å; G6-C49 PolarHBondContact N-O 3.48Å; G6-C49 PolarHBondContact O-N 3.1Å; F8-C49 HydrophobicContact CE1-CB 4.31Å; V33-C49 WeakPolarHBondContact O-CA 3.37Å; C49-C56 VanDerWaalsContact CA-SG 3.57Å; C49-C56 HydrophobicContact CB-CB 4.03Å; C49-C56 WeakPolarHBondContact CB-SG 3.25Å; C49-C56 WeakPolarHBondContact SG-CA 3.44Å; C49-C56 WeakPolarHBondContact SG-CB 2.88Å; C49-C56 PolarHBondContact SG-N 3.3Å; C49-C56 CovalentContact SG-SG 2.02Å; C49-C56 PolarHBondContact SG-SG 2.82Å
50	G	92.5	Very high	93.3	Very high	10 Å²	10	55.3 Å²	55.3	10%	0.103	32%	0.315	C	S	.	.	E	Extended strand (participates in β ladder)	trans	149.7	-142.1	174.6	0	0	0	0	0	110.9	A32 V33 G54	A32-G50 CarbonylContact C-O 3.58Å; A32-G50 WeakPolarHBondContact CA-O 3.33Å; V33-G50 PolarHBondContact N-O 3.32Å; V33-G50 PolarHBondContact O-N 2.02Å; V33-G50 VanDerWaalsContact O-N 3.11Å; G50-G54 CarbonylContact C-O 3.58Å; G50-G54 WeakPolarHBondContact CA-O 3.29Å
51	G	89.6	Confident	92.9	Very high	10 Å²	10	51.7 Å²	51.7	10%	0.103	30%	0.304	C	S	.	.	E	Extended strand (participates in β ladder)	trans	127	-163.3	179.9	0	0	0	0	0	113	C3 P4 C53	C3-G51 VanDerWaalsContact CB-O 3.25Å; C3-G51 WeakPolarHBondContact CB-O 3.29Å; P4-G51 PolarHBondContact O-N 3.29Å; G51-C53 PolarHBondContact O-N 3.11Å
52	Y	89.1	Confident	92.4	Very high	132 Å²	132	50.8 Å²	50.8	52%	0.518	30%	0.301	S	S	.	.	S	Bend	trans	-81.1	85.5	-176.1	-170.6	-112.2	0	0	0	111.3	A1 C3 N30 Y31 G54	A1-Y52 HydrophobicContact CB-CD2 4.21Å; C3-Y52 WeakPolarHBondContact SG-CA 3.19Å; C3-Y52 WeakPolarHBondContact SG-CB 3.44Å; C3-Y52 WeakPolarHBondContact SG-CD2 3.41Å; N30-Y52 CarbonylContact O-C 3.49Å; Y31-Y52 HydrophobicContact CD2-CD1 4.3Å; Y52-G54 PolarHBondContact O-N 3.04Å
53	C	85.1	Confident	92.2	Very high	115 Å²	115	52 Å²	52	78%	0.777	31%	0.313	S	S	*	.	S	Bend	trans	59.2	21.7	-165.3	-55.4	0	0	0	0	112.5	G51	G51-C53 PolarHBondContact O-N 3.11Å
54	G	91	Very high	91.9	Very high	11 Å²	11	55.2 Å²	55.2	11%	0.113	33%	0.33	C	S	.	.			trans	-92.7	143	173.8	0	0	0	0	0	111.1	Q28 G50 Y52	Q28-G54 CarbonylContact O-C 3.56Å; Q28-G54 VanDerWaalsContact O-CA 3.31Å; Q28-G54 WeakPolarHBondContact O-CA 3.49Å; G50-G54 CarbonylContact C-O 3.58Å; G50-G54 WeakPolarHBondContact CA-O 3.29Å; Y52-G54 PolarHBondContact O-N 3.04Å
55	K	91.8	Very high	91.8	Very high	118 Å²	118	55.1 Å²	55.1	51%	0.513	33%	0.334	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.7	168.4	173.5	69	-176.6	-175.1	-178.4	0	110	Q28 T57	Q28-K55 HydrophobicContact CB-CG 4Å; Q28-K55 PolarHBondContact N-O 3.49Å; Q28-K55 PolarHBondContact O-N 2.94Å; K55-T57 HydrophobicContact CD-CG2 4.34Å; K55-T57 HydrophobicContact CG-CG2 4.45Å
56	C	93	Very high	91.7	Very high	21 Å²	21	58.3 Å²	58.3	14%	0.142	35%	0.353	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.1	134.9	172.2	-20.1	0	0	0	0	108.1	I26 V33 I36 C49	I26-C56 VanDerWaalsContact O-CA 3.23Å; I26-C56 WeakPolarHBondContact O-CA 3.46Å; V33-C56 PolarHBondContact O-SG 2.83Å; V33-C56 VanDerWaalsContact O-SG 3.32Å; I36-C56 HydrophobicContact CD1-CB 4.33Å; C49-C56 VanDerWaalsContact CA-SG 3.57Å; C49-C56 HydrophobicContact CB-CB 4.03Å; C49-C56 WeakPolarHBondContact CB-SG 3.25Å; C49-C56 WeakPolarHBondContact SG-CA 3.44Å; C49-C56 WeakPolarHBondContact SG-CB 2.88Å; C49-C56 PolarHBondContact SG-N 3.3Å; C49-C56 CovalentContact SG-SG 2.02Å; C49-C56 PolarHBondContact SG-SG 2.82Å
57	T	92.2	Very high	91.6	Very high	38 Å²	38	59.8 Å²	59.8	23%	0.233	35%	0.349	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.2	154.5	179.8	62.1	0	0	0	0	108.6	W25 I26 Q28 K55 S59	W25-T57 CarbonylContact C-O 3.58Å; W25-T57 VanDerWaalsContact CA-O 3.29Å; W25-T57 WeakPolarHBondContact CA-O 3.39Å; I26-T57 WeakPolarHBondContact CG1-O 3.46Å; I26-T57 PolarHBondContact N-O 2.74Å; I26-T57 PolarHBondContact O-N 3.16Å; Q28-T57 PolarHBondContact NE2-OG1 2.95Å; K55-T57 HydrophobicContact CD-CG2 4.34Å; K55-T57 HydrophobicContact CG-CG2 4.45Å; T57-S59 PolarHBondContact O-N 3.36Å
58	P	93	Very high	91.6	Very high	49 Å²	49	64.9 Å²	64.9	32%	0.318	38%	0.379	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-50.4	144.4	162.7	-24.1	34.4	0	0	0	110.3	R24 S60 L64	R24-P58 WeakPolarHBondContact O-CA 3.35Å; P58-S60 PolarHBondContact O-N 3.06Å; P58-L64 HydrophobicContact CB-CB 4.3Å; P58-L64 HydrophobicContact CG-CB 4.19Å
59	S	92.9	Very high	91.2	Very high	4 Å²	4	67.9 Å²	67.9	3%	0.028	40%	0.398	C	S	.	.			trans	-55.3	126.3	176.2	166	0	0	0	0	109.6	R24 T57 G61 T62 G63	R24-S59 PolarHBondContact NH2-OG 3.11Å; R24-S59 PolarHBondContact O-N 3.3Å; T57-S59 PolarHBondContact O-N 3.36Å; S59-G61 PolarHBondContact O-N 2.8Å; S59-T62 PolarHBondContact O-N 3.07Å; S59-G63 WeakPolarHBondContact O-CA 3.46Å; S59-G63 PolarHBondContact O-N 2.85Å
60	S	85.8	Confident	91.1	Very high	117 Å²	117	70.3 Å²	70.3	82%	0.818	41%	0.411	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.2	-27.2	-178.4	49.8	0	0	0	0	113.5	P58	P58-S60 PolarHBondContact O-N 3.06Å
61	G	86.5	Confident	91	Very high	70 Å²	70	73.4 Å²	73.4	72%	0.722	43%	0.427	S	S	*	.	T	Hydrogen-bonded Turn	trans	-75.3	-22	179.5	0	0	0	0	0	114.7	S59	S59-G61 PolarHBondContact O-N 2.8Å
62	T	85.8	Confident	91.1	Very high	52 Å²	52	76.9 Å²	76.9	32%	0.319	45%	0.446	S	S	.	.	T	Hydrogen-bonded Turn	trans	-127.1	-17.9	-174.7	51.6	0	0	0	0	113.1	S22 S59	S22-T62 PolarHBondContact O-OG1 2.81Å; S59-T62 PolarHBondContact O-N 3.07Å
63	G	90.7	Very high	91.2	Very high	29 Å²	29	73.7 Å²	73.7	30%	0.299	44%	0.441	S	S	.	.			trans	61.3	-154.1	-173	0	0	0	0	0	112.5	S59	S59-G63 WeakPolarHBondContact O-CA 3.46Å; S59-G63 PolarHBondContact O-N 2.85Å
64	L	93.4	Very high	91.6	Very high	76 Å²	76	71.1 Å²	71.1	40%	0.398	42%	0.42	S	S	.	.	S	Bend	trans	-105.3	72.1	170.1	-171.6	73.4	0	0	0	108.3	I10 L19 W25 P58	I10-L64 HydrophobicContact CD1-CD1 4.18Å; I10-L64 HydrophobicContact CD1-CD2 3.95Å; L19-L64 HydrophobicContact CD1-CD1 4.19Å; L19-L64 HydrophobicContact CD2-CD1 3.63Å; L19-L64 HydrophobicContact CD2-CG 3.74Å; W25-L64 HydrophobicContact CH2-CD1 3.66Å; W25-L64 HydrophobicContact CZ2-CD1 3.48Å; W25-L64 VanDerWaalsContact CZ2-CD1 3.48Å; P58-L64 HydrophobicContact CB-CB 4.3Å; P58-L64 HydrophobicContact CG-CB 4.19Å
65	E	94.4	Very high	91.6	Very high	99 Å²	99	75.1 Å²	75.1	46%	0.463	44%	0.441	S	S	.	.			trans	-73	135.9	-176.4	-171.5	-175.3	-162.9	0	0	111.6	L19 T20 S22	L19-E65 WeakPolarHBondContact CD2-O 3.37Å; T20-E65 HydrophobicContact CG2-CB 4.1Å; T20-E65 HydrophobicContact CG2-CG 3.68Å; T20-E65 PolarHBondContact N-O 3.03Å; T20-E65 VanDerWaalsContact N-O 3.14Å; T20-E65 PolarHBondContact OG1-OE2 3.3Å; S22-E65 PolarHBondContact OG-OE2 3.18Å; S22-E65 VanDerWaalsContact OG-OE2 3.12Å
66	V	95.4	Very high	91.6	Very high	69 Å²	69	72.1 Å²	72.1	42%	0.418	44%	0.436	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.6	138.5	-179.5	-178.4	0	0	0	0	108.1	L12 L17 S18 L19	L12-V66 HydrophobicContact CD1-CG1 4.39Å; L17-V66 HydrophobicContact CB-CG1 3.8Å; L17-V66 HydrophobicContact CD1-CG1 4.34Å; L17-V66 HydrophobicContact CD2-CG1 4.22Å; L17-V66 HydrophobicContact CG-CG1 4.34Å; S18-V66 CarbonylContact O-C 3.53Å; S18-V66 WeakPolarHBondContact O-CA 3.31Å; L19-V66 HydrophobicContact CD2-CG2 3.9Å
67	R	95.7	Very high	91.5	Very high	117 Å²	117	76 Å²	76	44%	0.442	46%	0.458	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.7	160.5	172.8	67.7	177.2	-177.4	-154.2	0.8	111.1	L17 S18 T20	L17-R67 CarbonylContact C-O 3.52Å; L17-R67 WeakPolarHBondContact CA-O 3.15Å; S18-R67 PolarHBondContact N-O 3.24Å; S18-R67 PolarHBondContact O-N 3.18Å; S18-R67 VanDerWaalsContact OG-CG 3.28Å; S18-R67 WeakPolarHBondContact OG-CG 3.23Å; S18-R67 PolarHBondContact OG-NE 3.39Å; T20-R67 HydrophobicContact CG2-CB 4.18Å; T20-R67 HydrophobicContact CG2-CG 4.3Å
68	V	96.1	Very high	91.5	Very high	116 Å²	116	79.2 Å²	79.2	70%	0.703	48%	0.477	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-82.8	141.6	168.7	-175.8	0	0	0	0	109	G16 L17	G16-V68 WeakPolarHBondContact O-CA 3.47Å; L17-V68 HydrophobicContact CD2-CG2 3.99Å
69	L	87.9	Confident	91.3	Very high	152 Å²	152	81.9 Å²	81.9	80%	0.796	49%	0.491	S	S	*	.			trans	-81.9	0	175.5	-70.9	174.3	0	0	0	112.5	G16 T43	G16-L69 PolarHBondContact O-N 3.23Å; T43-L69 HydrophobicContact CG2-CD1 4.45Å

Retrieved 69 of 69 residues in 51.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).