A0A087WTU2_HUMAN Loading...

Pyrroline-5-carboxylate reductase 3

AlphaFold DB , UniProt , Accession A0A087WTU2, Species HUMAN (Homo sapiens, Human), Gene PYCR3, Length 59 aa.

						>A0A087WTU2_HUMAN|A0A087WTU2|PYCR3
MARGRHVGSSETKLLQHLLEACGRCEEVPEAYVDIHTGLSGSGVAFVCAFSEALAEGAV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	92.3	Very high	95.5	Very high	49 Å²	49	89.4 Å²	89.4	24%	0.241	48%	0.479	C	S	.	.				0	155.1	0	64.8	176.3	180	0	0	110.1	T12 L15 Q16 L19 E26 E27 V28	M1-T12 HydrophobicContact CE-CG2 3.53Å; M1-L15 HydrophobicContact SD-CD2 3.79Å; M1-L15 HydrophobicContact SD-CG 3.99Å; M1-Q16 HydrophobicContact CE-CB 3.76Å; M1-Q16 HydrophobicContact CE-CG 4.29Å; M1-L19 HydrophobicContact CB-CD1 4.42Å; M1-L19 HydrophobicContact SD-CD1 4.4Å; M1-E26 PolarHBondContact N-O 3.02Å; M1-E27 HydrophobicContact CE-CB 4.19Å; M1-E27 HydrophobicContact CG-CB 4.4Å; M1-E27 CarbonylContact O-C 3.58Å; M1-E27 WeakPolarHBondContact O-CA 3.32Å; M1-V28 PolarHBondContact O-N 3.03Å
2	A	96.1	Very high	95.6	Very high	41 Å²	41	82.5 Å²	82.5	34%	0.339	44%	0.442	S	S	.	.			trans	-116.3	131.1	171.3	0	0	0	0	0	109.3	E30 V33	A2-E30 HydrophobicContact CB-CB 4.01Å; A2-E30 HydrophobicContact CB-CG 4.38Å; A2-V33 HydrophobicContact CB-CG2 3.89Å
3	R	95.4	Very high	95.8	Very high	122 Å²	122	87.4 Å²	87.4	46%	0.46	46%	0.457	S	S	.	.			trans	-85.7	124.9	-176	-169.3	-168.6	-43.1	-177.1	6.7	110.9	V7 T12 E27	R3-V7 HydrophobicContact CG-CB 3.96Å; R3-V7 HydrophobicContact CG-CG1 4.23Å; R3-T12 WeakPolarHBondContact CD-OG1 3.32Å; R3-T12 PolarHBondContact NE-OG1 3.4Å; R3-E27 HydrophobicContact CB-CG 4.48Å; R3-E27 WeakPolarHBondContact CB-OE1 3.26Å; R3-E27 IonicContact CZ-OE1 3.26Å; R3-E27 IonicContact CZ-OE2 3.1Å; R3-E27 VanDerWaalsContact CZ-OE2 3.26Å; R3-E27 VanDerWaalsContact NE-CD 3.31Å; R3-E27 IonicContact NE-OE1 2.78Å; R3-E27 PolarHBondContact NE-OE1 2.93Å; R3-E27 IonicContact NE-OE2 3.15Å; R3-E27 PolarHBondContact NE-OE2 3.21Å; R3-E27 VanDerWaalsContact NE-OE2 3.15Å; R3-E27 IonicContact NH2-OE1 2.63Å; R3-E27 PolarHBondContact NH2-OE1 2.84Å; R3-E27 IonicContact NH2-OE2 2.75Å; R3-E27 PolarHBondContact NH2-OE2 2.99Å
4	G	94.6	Very high	95.9	Very high	41 Å²	41	88.8 Å²	88.8	42%	0.423	47%	0.465	S	S	.	.			trans	-74.2	153.7	173.6	0	0	0	0	0	112.9	H6 V7	G4-H6 PolarHBondContact O-N 3.36Å; G4-V7 PolarHBondContact O-N 2.71Å
5	R	95.3	Very high	96	Very high	232 Å²	232	88.2 Å²	88.2	88%	0.875	46%	0.462	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.3	-19.3	-175.6	67	177.1	176.6	-116.5	-0.3	116.5
6	H	96	Very high	96.1	Very high	153 Å²	153	85.9 Å²	85.9	71%	0.708	45%	0.448	S	S	*	.	T	Hydrogen-bonded Turn	trans	-100.9	2.3	-179.2	-49.9	116.9	0	0	0	113	G4	G4-H6 PolarHBondContact O-N 3.36Å
7	V	95.8	Very high	96.2	Very high	63 Å²	63	88.6 Å²	88.6	38%	0.382	46%	0.457	S	S	.	.			trans	-97.2	121.1	-174.9	-177.2	0	0	0	0	109.8	R3 G4 E11	R3-V7 HydrophobicContact CG-CB 3.96Å; R3-V7 HydrophobicContact CG-CG1 4.23Å; G4-V7 PolarHBondContact O-N 2.71Å; V7-E11 HydrophobicContact CG1-CB 3.72Å
8	G	95.3	Very high	96.3	Very high	28 Å²	28	89.6 Å²	89.6	29%	0.289	46%	0.463	S	S	.	.			trans	-76.4	174.6	176.5	0	0	0	0	0	113.8	S10 E11 T12	G8-S10 VanDerWaalsContact C-N 3.35Å; G8-E11 WeakPolarHBondContact CA-OE2 3.39Å; G8-T12 WeakPolarHBondContact O-CB 3.32Å; G8-T12 PolarHBondContact O-N 3.15Å; G8-T12 PolarHBondContact O-OG1 2.92Å
9	S	95.8	Very high	96.4	Very high	76 Å²	76	88.7 Å²	88.7	53%	0.531	46%	0.459	S	S	.	.	H	α-helix	trans	-68.7	-31.7	-179.9	59.7	0	0	0	0	113	K13	S9-K13 WeakPolarHBondContact O-CB 3.34Å; S9-K13 VanDerWaalsContact O-CG 3.25Å; S9-K13 WeakPolarHBondContact O-CG 3.34Å; S9-K13 PolarHBondContact O-N 3.27Å
10	S	97.1	Very high	96.4	Very high	80 Å²	80	88.8 Å²	88.8	56%	0.559	46%	0.457	S	S	*	.	H	α-helix	trans	-64.1	-49	175.7	28.7	0	0	0	0	112.3	G8 T12 K13 L14	G8-S10 VanDerWaalsContact C-N 3.35Å; S10-T12 VanDerWaalsContact C-N 3.34Å; S10-K13 PolarHBondContact O-N 2.78Å; S10-L14 PolarHBondContact O-N 2.78Å
11	E	97.3	Very high	96.5	Very high	98 Å²	98	88.7 Å²	88.7	46%	0.458	47%	0.469	S	S	.	.	H	α-helix	trans	-67	-39.7	-179.6	-62.2	93.3	138.1	0	0	110.4	V7 G8 L14 L15	V7-E11 HydrophobicContact CG1-CB 3.72Å; G8-E11 WeakPolarHBondContact CA-OE2 3.39Å; E11-L14 PolarHBondContact O-N 3.07Å; E11-L15 WeakPolarHBondContact O-CB 3.35Å; E11-L15 PolarHBondContact O-N 2.97Å
12	T	96.9	Very high	96.7	Very high	7 Å²	7	92.2 Å²	92.2	4%	0.043	50%	0.497	C	S	.	.	H	α-helix	trans	-60.9	-47.1	174.6	-56.9	0	0	0	0	111.4	M1 R3 G8 S10 L15 Q16 E27	M1-T12 HydrophobicContact CE-CG2 3.53Å; R3-T12 WeakPolarHBondContact CD-OG1 3.32Å; R3-T12 PolarHBondContact NE-OG1 3.4Å; G8-T12 WeakPolarHBondContact O-CB 3.32Å; G8-T12 PolarHBondContact O-N 3.15Å; G8-T12 PolarHBondContact O-OG1 2.92Å; S10-T12 VanDerWaalsContact C-N 3.34Å; T12-L15 PolarHBondContact O-N 2.75Å; T12-Q16 WeakPolarHBondContact O-CB 3.48Å; T12-Q16 PolarHBondContact O-N 2.63Å; T12-E27 VanDerWaalsContact CG2-OE2 3.23Å; T12-E27 WeakPolarHBondContact CG2-OE2 3.39Å
13	K	97.3	Very high	96.7	Very high	146 Å²	146	92.2 Å²	92.2	64%	0.635	50%	0.501	S	S	*	.	H	α-helix	trans	-63.8	-41.6	178.2	-76.3	174.4	-178.4	-177.6	0	112.2	S9 S10 Q16 H17	S9-K13 WeakPolarHBondContact O-CB 3.34Å; S9-K13 VanDerWaalsContact O-CG 3.25Å; S9-K13 WeakPolarHBondContact O-CG 3.34Å; S9-K13 PolarHBondContact O-N 3.27Å; S10-K13 PolarHBondContact O-N 2.78Å; K13-Q16 PolarHBondContact O-N 2.89Å; K13-H17 WeakPolarHBondContact O-CB 3.25Å; K13-H17 PolarHBondContact O-N 3.01Å
14	L	97.6	Very high	96.7	Very high	107 Å²	107	97.7 Å²	97.7	56%	0.56	52%	0.522	S	S	*	.	H	α-helix	trans	-61.4	-48.7	175.9	176.9	61.5	0	0	0	110.7	S10 E11 Q16 H17 L18	S10-L14 PolarHBondContact O-N 2.78Å; E11-L14 PolarHBondContact O-N 3.07Å; L14-Q16 PolarHBondContact O-N 2.67Å; L14-H17 PolarHBondContact O-N 3.4Å; L14-L18 HydrophobicContact CD1-CD1 4.28Å; L14-L18 HydrophobicContact CD1-CG 4.41Å; L14-L18 HydrophobicContact CG-CD1 4.19Å; L14-L18 VanDerWaalsContact O-CG 3.3Å; L14-L18 WeakPolarHBondContact O-CG 3.24Å; L14-L18 PolarHBondContact O-N 2.84Å
15	L	97.3	Very high	96.8	Very high	80 Å²	80	96.2 Å²	96.2	42%	0.419	51%	0.505	S	S	.	.	H	α-helix	trans	-60.2	-45.5	177.8	178.6	62	0	0	0	111.7	M1 E11 T12 H17 L18 L19	M1-L15 HydrophobicContact SD-CD2 3.79Å; M1-L15 HydrophobicContact SD-CG 3.99Å; E11-L15 WeakPolarHBondContact O-CB 3.35Å; E11-L15 PolarHBondContact O-N 2.97Å; T12-L15 PolarHBondContact O-N 2.75Å; L15-H17 PolarHBondContact O-N 2.9Å; L15-L18 PolarHBondContact O-N 3.37Å; L15-L19 HydrophobicContact CD1-CD1 3.91Å; L15-L19 HydrophobicContact CD1-CG 4.08Å; L15-L19 HydrophobicContact CG-CD1 3.92Å; L15-L19 HydrophobicContact CG-CG 4.44Å; L15-L19 WeakPolarHBondContact O-CG 3.5Å; L15-L19 PolarHBondContact O-N 3.39Å
16	Q	97.7	Very high	96.7	Very high	51 Å²	51	90.8 Å²	90.8	24%	0.238	49%	0.49	C	S	.	.	H	α-helix	trans	-58.4	-48.8	177	-173.8	169.1	19.1	0	0	111.1	M1 T12 K13 L14 L18 L19 E20 C25	M1-Q16 HydrophobicContact CE-CB 3.76Å; M1-Q16 HydrophobicContact CE-CG 4.29Å; T12-Q16 WeakPolarHBondContact O-CB 3.48Å; T12-Q16 PolarHBondContact O-N 2.63Å; K13-Q16 PolarHBondContact O-N 2.89Å; L14-Q16 PolarHBondContact O-N 2.67Å; Q16-L18 VanDerWaalsContact C-N 3.28Å; Q16-L18 PolarHBondContact O-N 2.86Å; Q16-L19 PolarHBondContact O-N 3.36Å; Q16-L19 VanDerWaalsContact O-N 3.16Å; Q16-E20 HydrophobicContact CG-CG 4.19Å; Q16-E20 WeakPolarHBondContact CG-OE1 3.07Å; Q16-E20 PolarHBondContact NE2-OE1 2.86Å; Q16-E20 WeakPolarHBondContact O-CB 3.23Å; Q16-E20 VanDerWaalsContact O-CG 3.3Å; Q16-E20 WeakPolarHBondContact O-CG 3.37Å; Q16-E20 PolarHBondContact O-N 3.34Å; Q16-C25 PolarHBondContact NE2-O 2.9Å; Q16-C25 VanDerWaalsContact NE2-O 3.09Å
17	H	97.8	Very high	96.7	Very high	133 Å²	133	87.1 Å²	87.1	62%	0.616	47%	0.473	S	S	*	.	H	α-helix	trans	-58.6	-39.7	179.1	-175.8	58.8	0	0	0	112.6	K13 L14 L15	K13-H17 WeakPolarHBondContact O-CB 3.25Å; K13-H17 PolarHBondContact O-N 3.01Å; L14-H17 PolarHBondContact O-N 3.4Å; L15-H17 PolarHBondContact O-N 2.9Å
18	L	98.1	Very high	96.7	Very high	105 Å²	105	85.9 Å²	85.9	55%	0.55	47%	0.465	S	S	.	.	H	α-helix	trans	-67.1	-44.1	176.4	-68.2	170.4	0	0	0	112	L14 L15 Q16 A21	L14-L18 HydrophobicContact CD1-CD1 4.28Å; L14-L18 HydrophobicContact CD1-CG 4.41Å; L14-L18 HydrophobicContact CG-CD1 4.19Å; L14-L18 VanDerWaalsContact O-CG 3.3Å; L14-L18 WeakPolarHBondContact O-CG 3.24Å; L14-L18 PolarHBondContact O-N 2.84Å; L15-L18 PolarHBondContact O-N 3.37Å; Q16-L18 VanDerWaalsContact C-N 3.28Å; Q16-L18 PolarHBondContact O-N 2.86Å; L18-A21 WeakPolarHBondContact O-CB 3.45Å; L18-A21 PolarHBondContact O-N 3.1Å
19	L	97.4	Very high	96.7	Very high	74 Å²	74	88.2 Å²	88.2	39%	0.387	48%	0.475	S	S	.	.	H	α-helix	trans	-71.6	-31.1	-179.3	-67.7	175.7	0	0	0	112.5	M1 L15 Q16 A21 C22 G23 C25	M1-L19 HydrophobicContact CB-CD1 4.42Å; M1-L19 HydrophobicContact SD-CD1 4.4Å; L15-L19 HydrophobicContact CD1-CD1 3.91Å; L15-L19 HydrophobicContact CD1-CG 4.08Å; L15-L19 HydrophobicContact CG-CD1 3.92Å; L15-L19 HydrophobicContact CG-CG 4.44Å; L15-L19 WeakPolarHBondContact O-CG 3.5Å; L15-L19 PolarHBondContact O-N 3.39Å; Q16-L19 PolarHBondContact O-N 3.36Å; Q16-L19 VanDerWaalsContact O-N 3.16Å; L19-A21 PolarHBondContact O-N 2.98Å; L19-C22 PolarHBondContact O-N 3Å; L19-G23 PolarHBondContact O-N 2.89Å; L19-C25 HydrophobicContact CB-CB 3.65Å; L19-C25 VanDerWaalsContact CD1-SG 3.51Å
20	E	97.8	Very high	96.8	Very high	90 Å²	90	92.1 Å²	92.1	42%	0.421	49%	0.485	S	S	.	.	H	α-helix	trans	-66.1	-21.5	176.7	-77.3	177.2	171.1	0	0	113.2	Q16 C22 G23 C25	Q16-E20 HydrophobicContact CG-CG 4.19Å; Q16-E20 WeakPolarHBondContact CG-OE1 3.07Å; Q16-E20 PolarHBondContact NE2-OE1 2.86Å; Q16-E20 WeakPolarHBondContact O-CB 3.23Å; Q16-E20 VanDerWaalsContact O-CG 3.3Å; Q16-E20 WeakPolarHBondContact O-CG 3.37Å; Q16-E20 PolarHBondContact O-N 3.34Å; E20-C22 PolarHBondContact O-N 2.95Å; E20-G23 CarbonylContact C-O 3.45Å; E20-G23 WeakPolarHBondContact CA-O 3.44Å; E20-G23 PolarHBondContact O-N 3.41Å; E20-C25 HydrophobicContact CG-CB 4.08Å
21	A	97.9	Very high	96.8	Very high	87 Å²	87	92.5 Å²	92.5	72%	0.719	49%	0.493	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.3	-21.7	171.1	0	0	0	0	0	112.8	L18 L19	L18-A21 WeakPolarHBondContact O-CB 3.45Å; L18-A21 PolarHBondContact O-N 3.1Å; L19-A21 PolarHBondContact O-N 2.98Å
22	C	96.3	Very high	96.8	Very high	122 Å²	122	94.1 Å²	94.1	82%	0.824	50%	0.496	S	S	*	.	T	Hydrogen-bonded Turn	trans	-104.6	-2.3	-179.4	-60.1	0	0	0	0	113.4	L19 E20	L19-C22 PolarHBondContact O-N 3Å; E20-C22 PolarHBondContact O-N 2.95Å
23	G	95.8	Very high	96.7	Very high	42 Å²	42	96.5 Å²	96.5	43%	0.433	51%	0.51	S	S	.	.	S	Bend	trans	153.6	-154.8	-176.4	0	0	0	0	0	112.9	L19 E20	L19-G23 PolarHBondContact O-N 2.89Å; E20-G23 CarbonylContact C-O 3.45Å; E20-G23 WeakPolarHBondContact CA-O 3.44Å; E20-G23 PolarHBondContact O-N 3.41Å
24	R	95.3	Very high	96.6	Very high	237 Å²	237	96.1 Å²	96.1	89%	0.894	52%	0.515	S	S	*	.			trans	-87.1	132.7	173.8	-67.3	-67.2	-170.5	167.3	0.6	109.8
25	C	96.2	Very high	96.5	Very high	9 Å²	9	96.4 Å²	96.4	6%	0.061	52%	0.516	C	S	.	.			trans	-130.1	105.5	174.2	-179.9	0	0	0	0	110.6	Q16 L19 E20	Q16-C25 PolarHBondContact NE2-O 2.9Å; Q16-C25 VanDerWaalsContact NE2-O 3.09Å; L19-C25 HydrophobicContact CB-CB 3.65Å; L19-C25 VanDerWaalsContact CD1-SG 3.51Å; E20-C25 HydrophobicContact CG-CB 4.08Å
26	E	95	Very high	96.3	Very high	119 Å²	119	96.5 Å²	96.5	56%	0.556	51%	0.514	S	S	*	.			trans	-103.9	145.4	174.9	-63.9	-61.6	145.9	0	0	110.5	M1	M1-E26 PolarHBondContact N-O 3.02Å
27	E	95.6	Very high	96.1	Very high	76 Å²	76	97.7 Å²	97.7	36%	0.355	53%	0.525	S	S	.	.			trans	-83.5	129	170.5	-169.1	177.3	146.3	0	0	110.8	M1 R3 T12	M1-E27 HydrophobicContact CE-CB 4.19Å; M1-E27 HydrophobicContact CG-CB 4.4Å; M1-E27 CarbonylContact O-C 3.58Å; M1-E27 WeakPolarHBondContact O-CA 3.32Å; R3-E27 HydrophobicContact CB-CG 4.48Å; R3-E27 WeakPolarHBondContact CB-OE1 3.26Å; R3-E27 IonicContact CZ-OE1 3.26Å; R3-E27 IonicContact CZ-OE2 3.1Å; R3-E27 VanDerWaalsContact CZ-OE2 3.26Å; R3-E27 VanDerWaalsContact NE-CD 3.31Å; R3-E27 IonicContact NE-OE1 2.78Å; R3-E27 PolarHBondContact NE-OE1 2.93Å; R3-E27 IonicContact NE-OE2 3.15Å; R3-E27 PolarHBondContact NE-OE2 3.21Å; R3-E27 VanDerWaalsContact NE-OE2 3.15Å; R3-E27 IonicContact NH2-OE1 2.63Å; R3-E27 PolarHBondContact NH2-OE1 2.84Å; R3-E27 IonicContact NH2-OE2 2.75Å; R3-E27 PolarHBondContact NH2-OE2 2.99Å; T12-E27 VanDerWaalsContact CG2-OE2 3.23Å; T12-E27 WeakPolarHBondContact CG2-OE2 3.39Å
28	V	95.3	Very high	95.9	Very high	37 Å²	37	93.1 Å²	93.1	22%	0.224	51%	0.514	C	S	.	.			trans	-135.8	160.6	-176.4	-63	0	0	0	0	110.9	M1	M1-V28 PolarHBondContact O-N 3.03Å
29	P	96.2	Very high	95.7	Very high	76 Å²	76	94.1 Å²	94.1	49%	0.494	52%	0.519	S	S	.	.			trans	-55.3	141	169.3	-24.9	34.9	0	0	0	112	A31 Y32	P29-A31 PolarHBondContact O-N 3.31Å; P29-Y32 HydrophobicContact CB-CD2 4.42Å; P29-Y32 HydrophobicContact CG-CD2 4.16Å; P29-Y32 HydrophobicContact CG-CE2 4.09Å; P29-Y32 PolarHBondContact O-N 2.93Å
30	E	96.6	Very high	95.5	Very high	159 Å²	159	94.1 Å²	94.1	74%	0.743	53%	0.525	S	S	*	.	G	3₁₀ helix	trans	-57	-35.1	179	-172.5	-178.1	-179.4	0	0	112.5	A2 Y32 V33	A2-E30 HydrophobicContact CB-CB 4.01Å; A2-E30 HydrophobicContact CB-CG 4.38Å; E30-Y32 PolarHBondContact O-N 3.48Å; E30-V33 WeakPolarHBondContact O-CB 3.2Å; E30-V33 VanDerWaalsContact O-CG2 3.26Å; E30-V33 WeakPolarHBondContact O-CG2 3.32Å; E30-V33 PolarHBondContact O-N 2.85Å
31	A	97.2	Very high	95.1	Very high	87 Å²	87	92.4 Å²	92.4	72%	0.719	53%	0.532	S	S	*	.	G	3₁₀ helix	trans	-58	-17.9	176.3	0	0	0	0	0	113.9	P29	P29-A31 PolarHBondContact O-N 3.31Å
32	Y	96.8	Very high	95	Very high	132 Å²	132	91.1 Å²	91.1	52%	0.518	52%	0.518	S	S	.	.	G	3₁₀ helix	trans	-93.6	-3.2	177.7	-62.2	-9.9	0	0	0	113.3	P29 E30 D34 I35 H36	P29-Y32 HydrophobicContact CB-CD2 4.42Å; P29-Y32 HydrophobicContact CG-CD2 4.16Å; P29-Y32 HydrophobicContact CG-CE2 4.09Å; P29-Y32 PolarHBondContact O-N 2.93Å; E30-Y32 PolarHBondContact O-N 3.48Å; Y32-D34 VanDerWaalsContact C-N 3.31Å; Y32-D34 PolarHBondContact O-N 3.31Å; Y32-I35 WeakPolarHBondContact O-CG2 3.4Å; Y32-I35 PolarHBondContact O-N 2.97Å; Y32-H36 WeakPolarHBondContact O-CB 3.36Å; Y32-H36 PolarHBondContact O-CD2 3.26Å; Y32-H36 PolarHBondContact O-N 3.04Å
33	V	94.8	Very high	94.8	Very high	57 Å²	57	86 Å²	86	35%	0.345	49%	0.485	S	S	.	.	H	α-helix	trans	-63	-38.5	-177.1	173.7	0	0	0	0	111.6	A2 E30 H36 T37	A2-V33 HydrophobicContact CB-CG2 3.89Å; E30-V33 WeakPolarHBondContact O-CB 3.2Å; E30-V33 VanDerWaalsContact O-CG2 3.26Å; E30-V33 WeakPolarHBondContact O-CG2 3.32Å; E30-V33 PolarHBondContact O-N 2.85Å; V33-H36 PolarHBondContact O-N 3.16Å; V33-T37 WeakPolarHBondContact O-CB 3.3Å; V33-T37 PolarHBondContact O-N 3.45Å; V33-T37 PolarHBondContact O-OG1 3.02Å
34	D	96.1	Very high	94.8	Very high	138 Å²	138	88.3 Å²	88.3	74%	0.738	49%	0.491	S	S	*	.	H	α-helix	trans	-66.1	-44.6	179.9	-68.6	-13.7	0	0	0	112	Y32 T37 G38	Y32-D34 VanDerWaalsContact C-N 3.31Å; Y32-D34 PolarHBondContact O-N 3.31Å; D34-T37 WeakPolarHBondContact O-CB 3.35Å; D34-T37 PolarHBondContact O-N 3.47Å; D34-G38 PolarHBondContact O-N 3.45Å
35	I	95.3	Very high	94.8	Very high	114 Å²	114	80.1 Å²	80.1	59%	0.585	47%	0.473	S	S	*	.	H	α-helix	trans	-66.9	-38.3	177	-172.3	168.9	0	0	0	111.5	Y32 T37 G38 L39	Y32-I35 WeakPolarHBondContact O-CG2 3.4Å; Y32-I35 PolarHBondContact O-N 2.97Å; I35-T37 VanDerWaalsContact C-N 3.35Å; I35-G38 PolarHBondContact O-N 3.35Å; I35-L39 VanDerWaalsContact O-CB 3.24Å; I35-L39 WeakPolarHBondContact O-CB 3.3Å; I35-L39 PolarHBondContact O-N 3.27Å
36	H	94.1	Very high	94.7	Very high	81 Å²	81	87 Å²	87	38%	0.375	50%	0.502	S	S	.	.	H	α-helix	trans	-65.4	-38.2	173.6	-80.2	-64.1	0	0	0	112.2	Y32 V33 S40	Y32-H36 WeakPolarHBondContact O-CB 3.36Å; Y32-H36 PolarHBondContact O-CD2 3.26Å; Y32-H36 PolarHBondContact O-N 3.04Å; V33-H36 PolarHBondContact O-N 3.16Å; H36-S40 VanDerWaalsContact O-CB 3.32Å; H36-S40 WeakPolarHBondContact O-CB 3.4Å; H36-S40 PolarHBondContact O-N 3.09Å
37	T	93.4	Very high	94.7	Very high	77 Å²	77	85.6 Å²	85.6	47%	0.472	50%	0.502	S	S	.	.	I	π-helix	trans	-62.2	-48.6	174.9	-59.7	0	0	0	0	110.6	V33 D34 I35 G41 S42	V33-T37 WeakPolarHBondContact O-CB 3.3Å; V33-T37 PolarHBondContact O-N 3.45Å; V33-T37 PolarHBondContact O-OG1 3.02Å; D34-T37 WeakPolarHBondContact O-CB 3.35Å; D34-T37 PolarHBondContact O-N 3.47Å; I35-T37 VanDerWaalsContact C-N 3.35Å; T37-G41 CarbonylContact O-C 3.56Å; T37-G41 WeakPolarHBondContact O-CA 3.37Å; T37-G41 PolarHBondContact O-N 3.16Å; T37-S42 PolarHBondContact O-N 3.42Å
38	G	93.3	Very high	94.7	Very high	36 Å²	36	85 Å²	85	37%	0.371	51%	0.505	S	S	.	.	I	π-helix	trans	-62.1	-46.6	177.5	0	0	0	0	0	112.7	D34 I35 S42 G43	D34-G38 PolarHBondContact O-N 3.45Å; I35-G38 PolarHBondContact O-N 3.35Å; G38-S42 CarbonylContact O-C 3.56Å; G38-S42 WeakPolarHBondContact O-CB 3.44Å; G38-G43 PolarHBondContact O-N 3.21Å
39	L	94.1	Very high	94.8	Very high	126 Å²	126	85.7 Å²	85.7	66%	0.66	52%	0.515	S	S	*	.	I	π-helix	trans	-74.8	-43.1	-175.4	-177.3	63.1	0	0	0	113.4	I35 G43	I35-L39 VanDerWaalsContact O-CB 3.24Å; I35-L39 WeakPolarHBondContact O-CB 3.3Å; I35-L39 PolarHBondContact O-N 3.27Å; L39-G43 VanDerWaalsContact O-CA 3.31Å; L39-G43 WeakPolarHBondContact O-CA 3.31Å
40	S	91.8	Very high	94.8	Very high	75 Å²	75	88.2 Å²	88.2	52%	0.524	52%	0.519	S	S	.	.	I	π-helix	trans	-101.5	-36.6	-173.1	-57.5	0	0	0	0	113.1	H36 V44	H36-S40 VanDerWaalsContact O-CB 3.32Å; H36-S40 WeakPolarHBondContact O-CB 3.4Å; H36-S40 PolarHBondContact O-N 3.09Å; S40-V44 WeakPolarHBondContact O-CG2 3.41Å
41	G	90	Very high	94.7	Very high	54 Å²	54	83.5 Å²	83.5	56%	0.557	50%	0.503	S	S	*	.	I	π-helix	trans	-77.9	-63.2	176.6	0	0	0	0	0	111.3	T37	T37-G41 CarbonylContact O-C 3.56Å; T37-G41 WeakPolarHBondContact O-CA 3.37Å; T37-G41 PolarHBondContact O-N 3.16Å
42	S	95.2	Very high	94.7	Very high	60 Å²	60	85.7 Å²	85.7	42%	0.42	50%	0.498	S	S	.	.	I	π-helix	trans	-75.9	-29	-179.6	-53.1	0	0	0	0	113.2	T37 G38 V44 A45	T37-S42 PolarHBondContact O-N 3.42Å; G38-S42 CarbonylContact O-C 3.56Å; G38-S42 WeakPolarHBondContact O-CB 3.44Å; S42-V44 PolarHBondContact O-N 3.02Å; S42-A45 WeakPolarHBondContact O-CB 3.46Å; S42-A45 PolarHBondContact O-N 3.3Å
43	G	93.9	Very high	94.7	Very high	14 Å²	14	82.4 Å²	82.4	14%	0.144	50%	0.499	C	S	.	.	H	α-helix	trans	-57.4	-34.2	-177.9	0	0	0	0	0	114.3	G38 L39 A45 F46 V47	G38-G43 PolarHBondContact O-N 3.21Å; L39-G43 VanDerWaalsContact O-CA 3.31Å; L39-G43 WeakPolarHBondContact O-CA 3.31Å; G43-A45 VanDerWaalsContact C-N 3.27Å; G43-A45 PolarHBondContact O-N 3.39Å; G43-F46 PolarHBondContact O-N 3.02Å; G43-F46 VanDerWaalsContact O-N 3.16Å; G43-V47 WeakPolarHBondContact O-CG2 3.47Å; G43-V47 PolarHBondContact O-N 3.42Å
44	V	94	Very high	94.7	Very high	91 Å²	91	84.4 Å²	84.4	55%	0.552	51%	0.507	S	S	*	.	H	α-helix	trans	-60.3	-39.3	176.6	178.4	0	0	0	0	111.1	S40 S42 F46 V47 C48	S40-V44 WeakPolarHBondContact O-CG2 3.41Å; S42-V44 PolarHBondContact O-N 3.02Å; V44-F46 VanDerWaalsContact C-N 3.34Å; V44-F46 PolarHBondContact O-N 2.99Å; V44-V47 PolarHBondContact O-N 3.32Å; V44-C48 PolarHBondContact O-N 2.97Å; V44-C48 PolarHBondContact O-SG 3.37Å; V44-C48 VanDerWaalsContact O-SG 3.35Å
45	A	95.3	Very high	94.6	Very high	64 Å²	64	81.6 Å²	81.6	53%	0.529	50%	0.503	S	S	.	.	H	α-helix	trans	-64.1	-39.5	177.6	0	0	0	0	0	112	S42 G43 V47 C48 A49	S42-A45 WeakPolarHBondContact O-CB 3.46Å; S42-A45 PolarHBondContact O-N 3.3Å; G43-A45 VanDerWaalsContact C-N 3.27Å; G43-A45 PolarHBondContact O-N 3.39Å; A45-V47 VanDerWaalsContact C-N 3.35Å; A45-C48 PolarHBondContact O-N 3.45Å; A45-A49 PolarHBondContact O-N 2.94Å
46	F	94.5	Very high	94.6	Very high	153 Å²	153	83.8 Å²	83.8	67%	0.671	51%	0.51	S	S	*	.	H	α-helix	trans	-65.7	-38	174.8	-65.5	-57	0	0	0	112.3	G43 V44 A49 F50	G43-F46 PolarHBondContact O-N 3.02Å; G43-F46 VanDerWaalsContact O-N 3.16Å; V44-F46 VanDerWaalsContact C-N 3.34Å; V44-F46 PolarHBondContact O-N 2.99Å; F46-A49 PolarHBondContact O-N 3.35Å; F46-F50 WeakPolarHBondContact O-CB 3.33Å; F46-F50 PolarHBondContact O-N 3.34Å
47	V	96.1	Very high	94.2	Very high	90 Å²	90	82.7 Å²	82.7	55%	0.545	52%	0.521	S	S	.	.	H	α-helix	trans	-64.9	-42.1	175.4	173.4	0	0	0	0	111.1	G43 V44 A45 F50 S51	G43-V47 WeakPolarHBondContact O-CG2 3.47Å; G43-V47 PolarHBondContact O-N 3.42Å; V44-V47 PolarHBondContact O-N 3.32Å; A45-V47 VanDerWaalsContact C-N 3.35Å; V47-F50 PolarHBondContact O-N 3.45Å; V47-S51 WeakPolarHBondContact O-CB 3.22Å; V47-S51 PolarHBondContact O-N 2.75Å; V47-S51 PolarHBondContact O-OG 3.47Å
48	C	96	Very high	93.4	Very high	63 Å²	63	83 Å²	83	43%	0.426	53%	0.532	S	S	.	.	H	α-helix	trans	-60	-51.7	174.5	-69.2	0	0	0	0	111	V44 A45 F50 S51 E52	V44-C48 PolarHBondContact O-N 2.97Å; V44-C48 PolarHBondContact O-SG 3.37Å; V44-C48 VanDerWaalsContact O-SG 3.35Å; A45-C48 PolarHBondContact O-N 3.45Å; C48-F50 VanDerWaalsContact C-N 3.31Å; C48-F50 PolarHBondContact O-N 3.06Å; C48-S51 WeakPolarHBondContact O-CB 3.39Å; C48-S51 PolarHBondContact O-N 2.84Å; C48-E52 WeakPolarHBondContact O-CG 3.48Å; C48-E52 PolarHBondContact O-N 3.34Å
49	A	96.3	Very high	91.7	Very high	52 Å²	52	90.4 Å²	90.4	43%	0.43	57%	0.569	S	S	.	*	H	α-helix	trans	-59.3	-41	179	0	0	0	0	0	112.7	A45 F46 E52 A53	A45-A49 PolarHBondContact O-N 2.94Å; F46-A49 PolarHBondContact O-N 3.35Å; A49-E52 PolarHBondContact O-N 3.21Å; A49-A53 WeakPolarHBondContact O-CB 3.47Å; A49-A53 PolarHBondContact O-N 3.01Å
50	F	95.4	Very high	91.5	Very high	130 Å²	130	88.7 Å²	88.7	57%	0.57	57%	0.565	S	S	*	*	H	α-helix	trans	-62.3	-44	173.6	169	-102.5	0	0	0	112.1	F46 V47 C48 A53 L54	F46-F50 WeakPolarHBondContact O-CB 3.33Å; F46-F50 PolarHBondContact O-N 3.34Å; V47-F50 PolarHBondContact O-N 3.45Å; C48-F50 VanDerWaalsContact C-N 3.31Å; C48-F50 PolarHBondContact O-N 3.06Å; F50-A53 PolarHBondContact O-N 2.91Å; F50-L54 HydrophobicContact CD1-CD1 4.11Å; F50-L54 HydrophobicContact CE1-CD1 3.4Å; F50-L54 HydrophobicContact CE1-CG 4.18Å; F50-L54 HydrophobicContact CE2-CD1 4.18Å; F50-L54 HydrophobicContact CE2-CD2 4.36Å; F50-L54 HydrophobicContact CE2-CG 4.17Å; F50-L54 HydrophobicContact CZ-CD1 3.45Å; F50-L54 VanDerWaalsContact CZ-CD1 3.45Å; F50-L54 HydrophobicContact CZ-CD2 4.27Å; F50-L54 HydrophobicContact CZ-CG 3.95Å; F50-L54 WeakPolarHBondContact O-CG 3.37Å; F50-L54 PolarHBondContact O-N 2.9Å
51	S	96.3	Very high	91.5	Very high	60 Å²	60	89.4 Å²	89.4	42%	0.42	57%	0.567	S	S	.	*	H	α-helix	trans	-66	-38.9	179.2	-56.1	0	0	0	0	111.8	V47 C48 L54 A55	V47-S51 WeakPolarHBondContact O-CB 3.22Å; V47-S51 PolarHBondContact O-N 2.75Å; V47-S51 PolarHBondContact O-OG 3.47Å; C48-S51 WeakPolarHBondContact O-CB 3.39Å; C48-S51 PolarHBondContact O-N 2.84Å; S51-L54 PolarHBondContact O-N 3.49Å; S51-A55 WeakPolarHBondContact O-CB 3.49Å; S51-A55 PolarHBondContact O-N 3.27Å
52	E	96.3	Very high	91.6	Very high	132 Å²	132	91.3 Å²	91.3	62%	0.617	57%	0.568	S	S	*	*	H	α-helix	trans	-61.9	-46.6	173.6	-73.8	172.1	178.6	0	0	111	C48 A49 L54 A55 E56	C48-E52 WeakPolarHBondContact O-CG 3.48Å; C48-E52 PolarHBondContact O-N 3.34Å; A49-E52 PolarHBondContact O-N 3.21Å; E52-L54 VanDerWaalsContact C-N 3.31Å; E52-L54 PolarHBondContact O-N 3.1Å; E52-A55 PolarHBondContact O-N 3.37Å; E52-A55 VanDerWaalsContact O-N 3.1Å; E52-E56 PolarHBondContact O-N 2.99Å
53	A	96.1	Very high	91.4	Very high	63 Å²	63	93.2 Å²	93.2	52%	0.521	58%	0.576	S	S	.	*	H	α-helix	trans	-60.6	-39.2	176.7	0	0	0	0	0	112.5	A49 F50 G57	A49-A53 WeakPolarHBondContact O-CB 3.47Å; A49-A53 PolarHBondContact O-N 3.01Å; F50-A53 PolarHBondContact O-N 2.91Å; A53-G57 PolarHBondContact O-N 3.37Å
54	L	95.8	Very high	91.2	Very high	100 Å²	100	98.1 Å²	98.1	52%	0.524	60%	0.603	S	S	.	*	H	α-helix	trans	-64.9	-40.5	173.4	-72.8	-179.1	0	0	0	112.3	F50 S51 E52 G57 A58	F50-L54 HydrophobicContact CD1-CD1 4.11Å; F50-L54 HydrophobicContact CE1-CD1 3.4Å; F50-L54 HydrophobicContact CE1-CG 4.18Å; F50-L54 HydrophobicContact CE2-CD1 4.18Å; F50-L54 HydrophobicContact CE2-CD2 4.36Å; F50-L54 HydrophobicContact CE2-CG 4.17Å; F50-L54 HydrophobicContact CZ-CD1 3.45Å; F50-L54 VanDerWaalsContact CZ-CD1 3.45Å; F50-L54 HydrophobicContact CZ-CD2 4.27Å; F50-L54 HydrophobicContact CZ-CG 3.95Å; F50-L54 WeakPolarHBondContact O-CG 3.37Å; F50-L54 PolarHBondContact O-N 2.9Å; S51-L54 PolarHBondContact O-N 3.49Å; E52-L54 VanDerWaalsContact C-N 3.31Å; E52-L54 PolarHBondContact O-N 3.1Å; L54-G57 PolarHBondContact O-N 2.92Å; L54-A58 WeakPolarHBondContact O-CB 3.48Å; L54-A58 PolarHBondContact O-N 2.96Å
55	A	94.5	Very high	91.1	Very high	78 Å²	78	98.6 Å²	98.6	65%	0.645	61%	0.607	S	S	*	*	H	α-helix	trans	-66.4	-39.9	179.1	0	0	0	0	0	111.9	S51 E52	S51-A55 WeakPolarHBondContact O-CB 3.49Å; S51-A55 PolarHBondContact O-N 3.27Å; E52-A55 PolarHBondContact O-N 3.37Å; E52-A55 VanDerWaalsContact O-N 3.1Å
56	E	93.8	Very high	90.8	Very high	160 Å²	160	101.1 Å²	101.1	75%	0.748	61%	0.612	S	S	*	*	H	α-helix	trans	-73.8	-32.1	177.5	-173.7	155.6	-162.7	0	0	112.8	E52 A58	E52-E56 PolarHBondContact O-N 2.99Å; E56-A58 VanDerWaalsContact C-N 3.35Å
57	G	86.8	Confident	90.5	Very high	58 Å²	58	97.1 Å²	97.1	60%	0.598	61%	0.608	S	S	*	*	H	α-helix	trans	-79.1	-8.7	177.9	0	0	0	0	0	115.6	A53 L54 V59	A53-G57 PolarHBondContact O-N 3.37Å; L54-G57 PolarHBondContact O-N 2.92Å; G57-V59 PolarHBondContact O-N 3.18Å
58	A	77.1	Confident	90	Very high	85 Å²	85	97.7 Å²	97.7	70%	0.702	61%	0.613	S	S	*	*			trans	-82.1	22.4	-177.2	0	0	0	0	0	114.5	L54 E56	L54-A58 WeakPolarHBondContact O-CB 3.48Å; L54-A58 PolarHBondContact O-N 2.96Å; E56-A58 VanDerWaalsContact C-N 3.35Å
59	V	55.9	Low	89.5	Confident	191 Å²	191	100.8 Å²	100.8	100%	1.158	63%	0.63	S	S	*	*			trans	-78.2	0	175.1	-68.4	0	0	0	0	113.4	G57	G57-V59 PolarHBondContact O-N 3.18Å

Retrieved 59 of 59 residues in 17.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).