A0A087WTX8_HUMAN Loading...

Secretory carrier membrane protein 1

AlphaFold DB , UniProt , Accession A0A087WTX8, Species HUMAN (Homo sapiens, Human), Gene SCAMP1, Length 42 aa.

						>A0A087WTX8_HUMAN|A0A087WTX8|SCAMP1
MPNVPNTQPAIMKPTEEHPAYTQIAKEHALAQAELLKRQEEL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.3	Low	74.7	Confident	235 Å²	235	140.3 Å²	140.3	100%	1.158	81%	0.805	S	S	*	*				0	119.7	0	-60.5	174.5	-172.4	0	0	106.7	N3	M1-N3 PolarHBondContact O-N 3.28Å
2	P	63.6	Low	75.4	Confident	122 Å²	122	142.2 Å²	142.2	79%	0.792	81%	0.805	S	S	*	*			trans	-73.4	127.3	-179	29.9	-30.5	0	0	0	109.1	V4	P2-V4 PolarHBondContact O-N 3.13Å
3	N	70.5	Confident	76.2	Confident	160 Å²	160	145.5 Å²	145.5	86%	0.856	81%	0.805	S	S	*	*			trans	-72.2	95.7	179.5	-156.7	67.6	0	0	0	108.1	M1 P5	M1-N3 PolarHBondContact O-N 3.28Å; N3-P5 WeakPolarHBondContact O-CD 3.5Å
4	V	71.2	Confident	76.4	Confident	123 Å²	123	143.6 Å²	143.6	75%	0.745	80%	0.803	S	S	*	*			trans	-69.3	121.3	179.2	-153.1	0	0	0	0	107.8	P2 N6	P2-V4 PolarHBondContact O-N 3.13Å; V4-N6 PolarHBondContact O-N 3.08Å
5	P	75.6	Confident	76.5	Confident	100 Å²	100	141.9 Å²	141.9	65%	0.649	80%	0.797	S	S	*	*			trans	-59.5	125.6	174.6	-18.7	30.6	0	0	0	108.7	N3 T7	N3-P5 WeakPolarHBondContact O-CD 3.5Å; P5-T7 PolarHBondContact O-N 3.46Å
6	N	74.4	Confident	76.4	Confident	147 Å²	147	144.6 Å²	144.6	79%	0.786	80%	0.801	S	S	*	*			trans	-69.3	94.8	175.5	-174.3	-4.3	0	0	0	108.6	V4 Q8	V4-N6 PolarHBondContact O-N 3.08Å; N6-Q8 VanDerWaalsContact C-N 3.27Å; N6-Q8 PolarHBondContact O-N 3.27Å; N6-Q8 VanDerWaalsContact O-N 3.11Å
7	T	80.3	Confident	76.1	Confident	121 Å²	121	142.9 Å²	142.9	74%	0.742	79%	0.786	S	S	*	*			trans	-85	69.8	177.7	59.5	0	0	0	0	109.4	P5	P5-T7 PolarHBondContact O-N 3.46Å
8	Q	82.8	Confident	76.3	Confident	164 Å²	164	142.8 Å²	142.8	77%	0.766	78%	0.779	S	S	*	*	P	Polyproline II helix	trans	-71.2	125.8	168.6	-155	177.1	64.5	0	0	108	N6 A10	N6-Q8 VanDerWaalsContact C-N 3.27Å; N6-Q8 PolarHBondContact O-N 3.27Å; N6-Q8 VanDerWaalsContact O-N 3.11Å; Q8-A10 PolarHBondContact O-N 2.89Å
9	P	80.8	Confident	76.3	Confident	110 Å²	110	141 Å²	141	71%	0.714	78%	0.775	S	S	*	*	P	Polyproline II helix	trans	-62.9	131.4	179.1	24.1	-31.7	0	0	0	109.7	I11	P9-I11 PolarHBondContact O-N 3.21Å
10	A	82.1	Confident	76.4	Confident	97 Å²	97	137.2 Å²	137.2	80%	0.802	76%	0.763	S	S	*	*	P	Polyproline II helix	trans	-69.1	116.9	178.3	0	0	0	0	0	109.7	Q8 M12	Q8-A10 PolarHBondContact O-N 2.89Å; A10-M12 PolarHBondContact O-N 3.44Å
11	I	85.8	Confident	76.4	Confident	164 Å²	164	137.5 Å²	137.5	84%	0.841	75%	0.754	S	S	*	*			trans	-78.3	104.7	172.4	-57.8	172.9	0	0	0	107.1	P9	P9-I11 PolarHBondContact O-N 3.21Å
12	M	83.9	Confident	77.6	Confident	163 Å²	163	128.8 Å²	128.8	80%	0.803	71%	0.714	S	S	*	*	P	Polyproline II helix	trans	-70.8	137.2	169.9	-73.4	-178.6	65	0	0	109.5	A10	A10-M12 PolarHBondContact O-N 3.44Å
13	K	85.3	Confident	78.4	Confident	185 Å²	185	127.6 Å²	127.6	80%	0.804	70%	0.697	S	S	*	*	P	Polyproline II helix	trans	-64.8	145.9	171.3	-60.8	-165.5	-168.9	-175.7	0	109.3	T15	K13-T15 PolarHBondContact O-N 3.24Å
14	P	78.4	Confident	79.1	Confident	120 Å²	120	124.2 Å²	124.2	78%	0.779	68%	0.678	S	S	*	*	P	Polyproline II helix	trans	-55.8	131.7	168.9	-18.5	30	0	0	0	108.9	E16	P14-E16 PolarHBondContact O-N 3.09Å; P14-E16 VanDerWaalsContact O-N 3.17Å
15	T	78.2	Confident	79.9	Confident	117 Å²	117	120.5 Å²	120.5	72%	0.718	66%	0.66	S	S	*	*	P	Polyproline II helix	trans	-64.3	116.6	172	-56.9	0	0	0	0	107.7	K13 E17	K13-T15 PolarHBondContact O-N 3.24Å; T15-E17 PolarHBondContact O-N 3.35Å
16	E	74.6	Confident	80.5	Confident	185 Å²	185	121.5 Å²	121.5	86%	0.864	66%	0.655	S	S	*	*	P	Polyproline II helix	trans	-66.5	120.3	167	-79.5	177.6	108.5	0	0	107.9	P14 H18	P14-E16 PolarHBondContact O-N 3.09Å; P14-E16 VanDerWaalsContact O-N 3.17Å; E16-H18 PolarHBondContact O-N 3.42Å
17	E	72.4	Confident	81.4	Confident	117 Å²	117	119.5 Å²	119.5	55%	0.547	64%	0.641	S	S	.	*	P	Polyproline II helix	trans	-59.9	135	176.1	-76.8	-76.3	99.3	0	0	109.9	T15 Y21	T15-E17 PolarHBondContact O-N 3.35Å; E17-Y21 WeakPolarHBondContact OE2-CD1 3.31Å; E17-Y21 VanDerWaalsContact OE2-CE1 3.26Å; E17-Y21 WeakPolarHBondContact OE2-CE1 3.42Å
18	H	78.8	Confident	82	Confident	141 Å²	141	119.5 Å²	119.5	65%	0.653	63%	0.632	S	S	*	*	P	Polyproline II helix	trans	-59.4	137.9	-179.3	-75.7	-92.9	0	0	0	110.7	E16 A20 Y21 T22	E16-H18 PolarHBondContact O-N 3.42Å; H18-A20 PolarHBondContact O-N 2.99Å; H18-A20 VanDerWaalsContact O-N 3.16Å; H18-Y21 PolarHBondContact O-N 3.01Å; H18-T22 PolarHBondContact O-N 3.46Å; H18-T22 PolarHBondContact O-OG1 2.96Å
19	P	77.1	Confident	82.5	Confident	108 Å²	108	114.4 Å²	114.4	70%	0.701	62%	0.618	S	S	*	*	H	α-helix	trans	-60.9	-30.7	-177.4	21.4	-31.8	0	0	0	112.4	T22 Q23	P19-T22 WeakPolarHBondContact O-CB 3.34Å; P19-T22 PolarHBondContact O-N 3.37Å; P19-Q23 WeakPolarHBondContact O-CB 3.46Å; P19-Q23 PolarHBondContact O-N 2.91Å
20	A	78.1	Confident	83.2	Confident	65 Å²	65	115 Å²	115	54%	0.537	62%	0.615	S	S	.	*	H	α-helix	trans	-63.9	-44.3	174.2	0	0	0	0	0	112.4	H18 T22 Q23 I24	H18-A20 PolarHBondContact O-N 2.99Å; H18-A20 VanDerWaalsContact O-N 3.16Å; A20-T22 VanDerWaalsContact C-N 3.32Å; A20-Q23 PolarHBondContact O-N 3.36Å; A20-I24 WeakPolarHBondContact O-CD1 3.47Å; A20-I24 VanDerWaalsContact O-CG1 3.3Å; A20-I24 WeakPolarHBondContact O-CG1 3.26Å; A20-I24 PolarHBondContact O-N 3.48Å
21	Y	75.8	Confident	83.7	Confident	144 Å²	144	112.9 Å²	112.9	57%	0.565	60%	0.597	S	S	*	*	H	α-helix	trans	-67.2	-37.8	176.8	-173.9	-101.5	0	0	0	111.1	E17 H18 Q23 I24 A25	E17-Y21 WeakPolarHBondContact OE2-CD1 3.31Å; E17-Y21 VanDerWaalsContact OE2-CE1 3.26Å; E17-Y21 WeakPolarHBondContact OE2-CE1 3.42Å; H18-Y21 PolarHBondContact O-N 3.01Å; Y21-Q23 VanDerWaalsContact C-N 3.32Å; Y21-Q23 PolarHBondContact O-N 3.45Å; Y21-I24 PolarHBondContact O-N 3.45Å; Y21-A25 VanDerWaalsContact O-CB 3.26Å; Y21-A25 WeakPolarHBondContact O-CB 3.47Å; Y21-A25 PolarHBondContact O-N 3.21Å
22	T	80.1	Confident	84.1	Confident	52 Å²	52	110.8 Å²	110.8	32%	0.319	58%	0.584	S	S	.	*	H	α-helix	trans	-61.2	-40.3	173.8	-58.5	0	0	0	0	111.8	H18 P19 A20 K26	H18-T22 PolarHBondContact O-N 3.46Å; H18-T22 PolarHBondContact O-OG1 2.96Å; P19-T22 WeakPolarHBondContact O-CB 3.34Å; P19-T22 PolarHBondContact O-N 3.37Å; A20-T22 VanDerWaalsContact C-N 3.32Å; T22-K26 WeakPolarHBondContact O-CG 3.36Å; T22-K26 PolarHBondContact O-N 3.21Å; T22-K26 VanDerWaalsContact O-N 3.12Å
23	Q	80.4	Confident	84.6	Confident	96 Å²	96	106 Å²	106	45%	0.449	57%	0.57	S	S	.	*	H	α-helix	trans	-67.3	-47	178.3	-174.1	59.6	33.8	0	0	111.6	P19 A20 Y21 A25 K26 E27	P19-Q23 WeakPolarHBondContact O-CB 3.46Å; P19-Q23 PolarHBondContact O-N 2.91Å; A20-Q23 PolarHBondContact O-N 3.36Å; Y21-Q23 VanDerWaalsContact C-N 3.32Å; Y21-Q23 PolarHBondContact O-N 3.45Å; Q23-A25 VanDerWaalsContact C-N 3.32Å; Q23-A25 PolarHBondContact O-N 3.43Å; Q23-K26 PolarHBondContact O-N 3.42Å; Q23-E27 PolarHBondContact NE2-OE1 3Å; Q23-E27 PolarHBondContact O-N 2.97Å; Q23-E27 VanDerWaalsContact O-N 3.11Å
24	I	86.1	Confident	85	Confident	89 Å²	89	102.3 Å²	102.3	46%	0.456	56%	0.555	S	S	.	*	H	α-helix	trans	-60.5	-43.3	176.4	-66.6	162.1	0	0	0	110.6	A20 Y21 K26 E27 H28	A20-I24 WeakPolarHBondContact O-CD1 3.47Å; A20-I24 VanDerWaalsContact O-CG1 3.3Å; A20-I24 WeakPolarHBondContact O-CG1 3.26Å; A20-I24 PolarHBondContact O-N 3.48Å; Y21-I24 PolarHBondContact O-N 3.45Å; I24-K26 VanDerWaalsContact C-N 3.32Å; I24-K26 PolarHBondContact O-N 3.07Å; I24-E27 PolarHBondContact O-N 3.02Å; I24-H28 WeakPolarHBondContact O-CB 3.3Å; I24-H28 PolarHBondContact O-CD2 3.02Å; I24-H28 PolarHBondContact O-N 3.34Å
25	A	87.9	Confident	85.8	Confident	45 Å²	45	101.5 Å²	101.5	37%	0.372	54%	0.544	S	S	.	.	H	α-helix	trans	-61.8	-39.2	178.7	0	0	0	0	0	112.4	Y21 Q23 A29	Y21-A25 VanDerWaalsContact O-CB 3.26Å; Y21-A25 WeakPolarHBondContact O-CB 3.47Å; Y21-A25 PolarHBondContact O-N 3.21Å; Q23-A25 VanDerWaalsContact C-N 3.32Å; Q23-A25 PolarHBondContact O-N 3.43Å; A25-A29 WeakPolarHBondContact O-CB 3.26Å; A25-A29 PolarHBondContact O-N 3.02Å
26	K	88.1	Confident	86.6	Confident	121 Å²	121	100.5 Å²	100.5	53%	0.526	53%	0.534	S	S	.	.	H	α-helix	trans	-64.6	-46.1	175.7	-74.4	171.9	-177.7	176.5	0	111.9	T22 Q23 I24 H28 A29 L30	T22-K26 WeakPolarHBondContact O-CG 3.36Å; T22-K26 PolarHBondContact O-N 3.21Å; T22-K26 VanDerWaalsContact O-N 3.12Å; Q23-K26 PolarHBondContact O-N 3.42Å; I24-K26 VanDerWaalsContact C-N 3.32Å; I24-K26 PolarHBondContact O-N 3.07Å; K26-H28 VanDerWaalsContact C-N 3.35Å; K26-A29 PolarHBondContact O-N 3.27Å; K26-L30 WeakPolarHBondContact O-CG 3.47Å; K26-L30 PolarHBondContact O-N 2.87Å
27	E	92.4	Very high	87.5	Confident	106 Å²	106	97.7 Å²	97.7	50%	0.495	52%	0.518	S	S	.	.	H	α-helix	trans	-62.2	-44	178.4	-71.5	168.5	-162	0	0	111.4	Q23 I24 A29 L30 A31	Q23-E27 PolarHBondContact NE2-OE1 3Å; Q23-E27 PolarHBondContact O-N 2.97Å; Q23-E27 VanDerWaalsContact O-N 3.11Å; I24-E27 PolarHBondContact O-N 3.02Å; E27-A29 VanDerWaalsContact C-N 3.34Å; E27-A29 PolarHBondContact O-N 3.43Å; E27-L30 PolarHBondContact O-N 3.4Å; E27-A31 PolarHBondContact O-N 2.94Å
28	H	93.4	Very high	88.5	Confident	120 Å²	120	98.6 Å²	98.6	56%	0.556	52%	0.517	S	S	*	.	H	α-helix	trans	-60.8	-41.2	173.1	-91.1	-103.3	0	0	0	112.7	I24 K26 A31 Q32	I24-H28 WeakPolarHBondContact O-CB 3.3Å; I24-H28 PolarHBondContact O-CD2 3.02Å; I24-H28 PolarHBondContact O-N 3.34Å; K26-H28 VanDerWaalsContact C-N 3.35Å; H28-A31 PolarHBondContact O-N 2.99Å; H28-Q32 WeakPolarHBondContact O-CG 3.33Å; H28-Q32 PolarHBondContact O-N 2.95Å
29	A	93.4	Very high	89.1	Confident	58 Å²	58	98.5 Å²	98.5	48%	0.479	52%	0.517	S	S	.	.	H	α-helix	trans	-64	-41.7	178.4	0	0	0	0	0	111.8	A25 K26 E27 Q32 A33	A25-A29 WeakPolarHBondContact O-CB 3.26Å; A25-A29 PolarHBondContact O-N 3.02Å; K26-A29 PolarHBondContact O-N 3.27Å; E27-A29 VanDerWaalsContact C-N 3.34Å; E27-A29 PolarHBondContact O-N 3.43Å; A29-Q32 PolarHBondContact O-N 3.4Å; A29-A33 PolarHBondContact O-N 3.11Å
30	L	94.2	Very high	89.4	Confident	123 Å²	123	100.6 Å²	100.6	64%	0.644	52%	0.517	S	S	*	.	H	α-helix	trans	-63.3	-46.8	175.6	-68.7	172.2	0	0	0	111.5	K26 E27 Q32 A33 E34	K26-L30 WeakPolarHBondContact O-CG 3.47Å; K26-L30 PolarHBondContact O-N 2.87Å; E27-L30 PolarHBondContact O-N 3.4Å; L30-Q32 VanDerWaalsContact C-N 3.32Å; L30-Q32 PolarHBondContact O-N 3.4Å; L30-A33 PolarHBondContact O-N 3.24Å; L30-E34 PolarHBondContact O-N 3.42Å; L30-E34 VanDerWaalsContact O-N 3.07Å
31	A	93.6	Very high	89.6	Confident	51 Å²	51	104.1 Å²	104.1	42%	0.421	52%	0.523	S	S	.	.	H	α-helix	trans	-60.3	-41.7	178	0	0	0	0	0	112.1	E27 H28 E34 L35	E27-A31 PolarHBondContact O-N 2.94Å; H28-A31 PolarHBondContact O-N 2.99Å; A31-E34 PolarHBondContact O-N 3.3Å; A31-L35 WeakPolarHBondContact O-CG 3.32Å; A31-L35 PolarHBondContact O-N 3.16Å; A31-L35 VanDerWaalsContact O-N 3.08Å
32	Q	93.5	Very high	89.1	Confident	121 Å²	121	107.3 Å²	107.3	57%	0.565	55%	0.548	S	S	*	.	H	α-helix	trans	-64.1	-41.9	175.6	-78.4	-169.9	49.8	0	0	112.5	H28 A29 L30 E34 L35 L36	H28-Q32 WeakPolarHBondContact O-CG 3.33Å; H28-Q32 PolarHBondContact O-N 2.95Å; A29-Q32 PolarHBondContact O-N 3.4Å; L30-Q32 VanDerWaalsContact C-N 3.32Å; L30-Q32 PolarHBondContact O-N 3.4Å; Q32-E34 VanDerWaalsContact C-N 3.34Å; Q32-E34 PolarHBondContact O-N 2.91Å; Q32-L35 PolarHBondContact O-N 3.27Å; Q32-L36 PolarHBondContact O-N 3.03Å
33	A	94	Very high	89.6	Confident	62 Å²	62	110.1 Å²	110.1	51%	0.512	56%	0.56	S	S	.	*	H	α-helix	trans	-62.1	-41.3	178.4	0	0	0	0	0	112	A29 L30 L36 K37	A29-A33 PolarHBondContact O-N 3.11Å; L30-A33 PolarHBondContact O-N 3.24Å; A33-L36 PolarHBondContact O-N 3.46Å; A33-K37 WeakPolarHBondContact O-CB 3.37Å; A33-K37 PolarHBondContact O-N 3.39Å
34	E	94.1	Very high	90.1	Very high	108 Å²	108	110.8 Å²	110.8	51%	0.505	57%	0.566	S	S	.	*	H	α-helix	trans	-66.8	-39.1	175.3	-68.6	-167.3	163.9	0	0	113.1	L30 A31 Q32 K37 R38	L30-E34 PolarHBondContact O-N 3.42Å; L30-E34 VanDerWaalsContact O-N 3.07Å; A31-E34 PolarHBondContact O-N 3.3Å; Q32-E34 VanDerWaalsContact C-N 3.34Å; Q32-E34 PolarHBondContact O-N 2.91Å; E34-K37 PolarHBondContact O-N 3.17Å; E34-R38 WeakPolarHBondContact O-CG 3.42Å; E34-R38 PolarHBondContact O-N 3.3Å; E34-R38 VanDerWaalsContact O-N 3.09Å; E34-R38 IonicContact OE2-CZ 3.69Å; E34-R38 IonicContact OE2-NH1 3.48Å; E34-R38 PolarHBondContact OE2-NH1 3.37Å; E34-R38 IonicContact OE2-NH2 3.01Å; E34-R38 PolarHBondContact OE2-NH2 3.12Å
35	L	95.7	Very high	90.3	Very high	103 Å²	103	112.1 Å²	112.1	54%	0.539	57%	0.572	S	S	.	*	H	α-helix	trans	-61.9	-45.2	175.8	-74.4	173.1	0	0	0	111.1	A31 Q32 R38 Q39	A31-L35 WeakPolarHBondContact O-CG 3.32Å; A31-L35 PolarHBondContact O-N 3.16Å; A31-L35 VanDerWaalsContact O-N 3.08Å; Q32-L35 PolarHBondContact O-N 3.27Å; L35-R38 PolarHBondContact O-N 3.32Å; L35-Q39 WeakPolarHBondContact O-CG 3.5Å; L35-Q39 PolarHBondContact O-N 3.23Å
36	L	95.6	Very high	90.4	Very high	96 Å²	96	116 Å²	116	50%	0.503	58%	0.584	S	S	.	*	H	α-helix	trans	-59.7	-48.1	175.1	-108.8	86	0	0	0	111.4	Q32 A33 R38 Q39 E40	Q32-L36 PolarHBondContact O-N 3.03Å; A33-L36 PolarHBondContact O-N 3.46Å; L36-R38 PolarHBondContact O-N 3.25Å; L36-Q39 WeakPolarHBondContact O-CA 3.26Å; L36-Q39 VanDerWaalsContact O-CB 3.31Å; L36-Q39 WeakPolarHBondContact O-CB 3.03Å; L36-Q39 PolarHBondContact O-N 2.92Å; L36-E40 PolarHBondContact O-N 3.23Å; L36-E40 VanDerWaalsContact O-N 3.13Å
37	K	93.1	Very high	90.6	Very high	125 Å²	125	115.7 Å²	115.7	54%	0.543	59%	0.587	S	S	.	*	H	α-helix	trans	-56.6	-40.2	-179.9	-171.7	-176.2	175.7	-169	0	112	A33 E34 Q39 E40 E41	A33-K37 WeakPolarHBondContact O-CB 3.37Å; A33-K37 PolarHBondContact O-N 3.39Å; E34-K37 PolarHBondContact O-N 3.17Å; K37-Q39 VanDerWaalsContact C-N 3.29Å; K37-Q39 PolarHBondContact O-N 3.11Å; K37-E40 PolarHBondContact O-N 3.04Å; K37-E41 VanDerWaalsContact CE-OE1 3.26Å; K37-E41 WeakPolarHBondContact CE-OE1 3.39Å; K37-E41 PolarHBondContact O-N 3.44Å
38	R	93.3	Very high	90.4	Very high	136 Å²	136	116.3 Å²	116.3	51%	0.513	59%	0.593	S	S	.	*	H	α-helix	trans	-67.2	-27.2	175.3	-69.1	176.2	-171	111.3	4.3	113.1	E34 L35 L36	E34-R38 WeakPolarHBondContact O-CG 3.42Å; E34-R38 PolarHBondContact O-N 3.3Å; E34-R38 VanDerWaalsContact O-N 3.09Å; E34-R38 IonicContact OE2-CZ 3.69Å; E34-R38 IonicContact OE2-NH1 3.48Å; E34-R38 PolarHBondContact OE2-NH1 3.37Å; E34-R38 IonicContact OE2-NH2 3.01Å; E34-R38 PolarHBondContact OE2-NH2 3.12Å; L35-R38 PolarHBondContact O-N 3.32Å; L36-R38 PolarHBondContact O-N 3.25Å
39	Q	90.6	Very high	90.2	Very high	139 Å²	139	116.1 Å²	116.1	65%	0.65	60%	0.596	S	S	*	*	H	α-helix	trans	-73.4	-31.8	174.1	-69	179.4	-17.9	0	0	112.2	L35 L36 K37 E41	L35-Q39 WeakPolarHBondContact O-CG 3.5Å; L35-Q39 PolarHBondContact O-N 3.23Å; L36-Q39 WeakPolarHBondContact O-CA 3.26Å; L36-Q39 VanDerWaalsContact O-CB 3.31Å; L36-Q39 WeakPolarHBondContact O-CB 3.03Å; L36-Q39 PolarHBondContact O-N 2.92Å; K37-Q39 VanDerWaalsContact C-N 3.29Å; K37-Q39 PolarHBondContact O-N 3.11Å; Q39-E41 VanDerWaalsContact C-N 3.34Å
40	E	84.6	Confident	90	Very high	153 Å²	153	120.5 Å²	120.5	72%	0.715	61%	0.605	S	S	*	*	H	α-helix	trans	-76.5	-21.3	179.3	-64.5	176.3	133.7	0	0	113.2	L36 K37	L36-E40 PolarHBondContact O-N 3.23Å; L36-E40 VanDerWaalsContact O-N 3.13Å; K37-E40 PolarHBondContact O-N 3.04Å
41	E	80.9	Confident	89.6	Confident	139 Å²	139	120.3 Å²	120.3	65%	0.65	60%	0.602	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.8	0.6	-179	-71.8	176.6	-172.2	0	0	114.2	K37 Q39	K37-E41 VanDerWaalsContact CE-OE1 3.26Å; K37-E41 WeakPolarHBondContact CE-OE1 3.39Å; K37-E41 PolarHBondContact O-N 3.44Å; Q39-E41 VanDerWaalsContact C-N 3.34Å
42	L	66.8	Low	89.3	Confident	211 Å²	211	126.6 Å²	126.6	100%	1.105	62%	0.618	S	S	*	*			trans	-105.6	0	179.2	-74.3	171.1	0	0	0	112.3

Retrieved 42 of 42 residues in 12 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).