A0A087WTY8_HUMAN Loading...

Family with sequence similarity 228 member B

AlphaFold DB , UniProt , Accession A0A087WTY8, Species HUMAN (Homo sapiens, Human), Gene FAM228B, Length 74 aa.

						>A0A087WTY8_HUMAN|A0A087WTY8|FAM228B
MKNVDSDDLVTGTLPKLKSSKEWLEPKPLCFMEVLAKEDTEAAIQSILYKENSVIKKQRVILSRKRTAVLSGGK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	37.8	Very low	48.2	Very low	241 Å²	241	144.6 Å²	144.6	100%	1.187	78%	0.784	S	S	*	*				0	132.5	0	-72.3	162.6	73.4	0	0	107.1
2	K	40.5	Very low	48.7	Very low	190 Å²	190	136.7 Å²	136.7	83%	0.826	76%	0.761	S	S	*	*			trans	-41.4	132.5	-165.8	59.1	-165.7	172.4	-175.2	0	116.1	V4	K2-V4 PolarHBondContact O-N 3.07Å
3	N	40.2	Very low	49.1	Very low	159 Å²	159	136.1 Å²	136.1	85%	0.85	76%	0.763	S	S	*	*			trans	-63.1	120.5	161.5	-57.6	-47	0	0	0	107.4	D5	N3-D5 PolarHBondContact O-N 3.36Å
4	V	53.1	Low	50	Low	128 Å²	128	136.6 Å²	136.6	78%	0.776	76%	0.762	S	S	*	*			trans	-78.6	82.8	167.6	169.8	0	0	0	0	105.5	K2 S6	K2-V4 PolarHBondContact O-N 3.07Å; V4-S6 VanDerWaalsContact C-N 3.33Å; V4-S6 PolarHBondContact O-N 3.24Å
5	D	46.9	Very low	50.9	Low	132 Å²	132	135.1 Å²	135.1	71%	0.706	76%	0.761	S	S	*	*			trans	-75.9	99.6	159.3	-160.4	9.3	0	0	0	105	N3 D7	N3-D5 PolarHBondContact O-N 3.36Å; D5-D7 PolarHBondContact O-N 3.26Å
6	S	53.9	Low	51.9	Low	92 Å²	92	139.1 Å²	139.1	64%	0.643	77%	0.767	S	S	*	*			trans	-69.3	88.7	172.5	-176.2	0	0	0	0	105.6	V4 D8	V4-S6 VanDerWaalsContact C-N 3.33Å; V4-S6 PolarHBondContact O-N 3.24Å; S6-D8 PolarHBondContact O-N 2.77Å
7	D	52.3	Low	52.5	Low	134 Å²	134	140.2 Å²	140.2	72%	0.717	77%	0.771	S	S	*	*			trans	-59.1	82.6	156.4	-80.9	-39	0	0	0	106.4	D5 L9	D5-D7 PolarHBondContact O-N 3.26Å; D7-L9 PolarHBondContact O-N 2.93Å
8	D	50.1	Low	53.4	Low	125 Å²	125	138.7 Å²	138.7	67%	0.668	76%	0.756	S	S	*	*			trans	-52.4	105.4	166.9	-171.1	19.9	0	0	0	105.3	S6 V10	S6-D8 PolarHBondContact O-N 2.77Å; D8-V10 HydrophobicContact CB-CG2 4.41Å; D8-V10 PolarHBondContact O-N 2.75Å
9	L	53.2	Low	54.3	Low	150 Å²	150	135.1 Å²	135.1	79%	0.785	74%	0.742	S	S	*	*			trans	-67.5	69.1	175.4	-67.7	175.3	0	0	0	107.8	D7 T11	D7-L9 PolarHBondContact O-N 2.93Å; L9-T11 PolarHBondContact O-N 2.71Å; L9-T11 PolarHBondContact O-OG1 2.9Å
10	V	50.6	Low	55	Low	105 Å²	105	132.9 Å²	132.9	64%	0.636	74%	0.736	S	S	*	*			trans	-66.9	87.4	162	-179.5	0	0	0	0	104.5	D8 G12	D8-V10 HydrophobicContact CB-CG2 4.41Å; D8-V10 PolarHBondContact O-N 2.75Å; V10-G12 PolarHBondContact O-N 2.69Å
11	T	52	Low	55.5	Low	135 Å²	135	134.3 Å²	134.3	83%	0.828	74%	0.735	S	S	*	*			trans	-70	58.3	163.6	-36.5	0	0	0	0	106.7	L9	L9-T11 PolarHBondContact O-N 2.71Å; L9-T11 PolarHBondContact O-OG1 2.9Å
12	G	53.6	Low	56.8	Low	49 Å²	49	128.1 Å²	128.1	51%	0.505	70%	0.703	S	S	.	*			trans	-104.9	28.2	-176.3	0	0	0	0	0	110.7	V10 L14	V10-G12 PolarHBondContact O-N 2.69Å; G12-L14 PolarHBondContact O-N 2.8Å
13	T	54.1	Low	58.1	Low	129 Å²	129	128.2 Å²	128.2	79%	0.791	70%	0.698	S	S	*	*			trans	-67.3	91.4	165.6	-44.3	0	0	0	0	106.8
14	L	62	Low	59.3	Low	143 Å²	143	126.9 Å²	126.9	75%	0.749	69%	0.691	S	S	*	*			trans	-37.7	133.7	161.4	-94.9	154.3	0	0	0	107.9	G12 K16	G12-L14 PolarHBondContact O-N 2.8Å; L14-K16 PolarHBondContact O-N 2.79Å
15	P	62.6	Low	60.1	Low	115 Å²	115	128.7 Å²	128.7	75%	0.747	69%	0.69	S	S	*	*			trans	-48.2	119.7	174.5	-19.8	27.8	0	0	0	106.9	L17	P15-L17 PolarHBondContact O-N 2.93Å
16	K	66.8	Low	61.3	Low	198 Å²	198	128 Å²	128	86%	0.861	69%	0.694	S	S	*	*			trans	-42.8	105.4	-171.2	-153.7	175.3	-170.9	175.7	0	107.7	L14 K18	L14-K16 PolarHBondContact O-N 2.79Å; K16-K18 PolarHBondContact O-N 2.71Å
17	L	63.2	Low	62.2	Low	158 Å²	158	132.1 Å²	132.1	83%	0.827	70%	0.7	S	S	*	*			trans	-60.3	112.5	-172.6	-177.1	68.7	0	0	0	105.6	P15 S19	P15-L17 PolarHBondContact O-N 2.93Å; L17-S19 PolarHBondContact O-N 2.9Å; L17-S19 VanDerWaalsContact O-N 3.1Å
18	K	68.1	Low	63.1	Low	114 Å²	114	131.3 Å²	131.3	50%	0.496	70%	0.702	S	S	.	*			trans	-48.5	123.9	-180	-73.7	-157.3	172.2	-133.1	0	107.9	K16 E22 W23	K16-K18 PolarHBondContact O-N 2.71Å; K18-E22 WeakPolarHBondContact CA-OE2 3.5Å; K18-E22 HydrophobicContact CB-CB 4.1Å; K18-E22 VanDerWaalsContact CB-OE2 3.32Å; K18-E22 WeakPolarHBondContact CB-OE2 3.41Å; K18-E22 HydrophobicContact CD-CB 4.44Å; K18-E22 HydrophobicContact CD-CG 4.2Å; K18-E22 WeakPolarHBondContact CE-OE1 3.35Å; K18-E22 VanDerWaalsContact CG-OE2 3.25Å; K18-E22 WeakPolarHBondContact CG-OE2 3.25Å; K18-E22 IonicContact NZ-OE1 2.71Å; K18-E22 PolarHBondContact NZ-OE1 2.79Å; K18-W23 PolarHBondContact O-NE1 3.1Å
19	S	71.4	Confident	64.2	Low	70 Å²	70	130.6 Å²	130.6	49%	0.49	70%	0.698	S	S	.	*			trans	-50.3	145.5	178.7	164.4	0	0	0	0	108.6	L17 K21 E22	L17-S19 PolarHBondContact O-N 2.9Å; L17-S19 VanDerWaalsContact O-N 3.1Å; S19-K21 PolarHBondContact O-N 3Å; S19-K21 PolarHBondContact OG-N 3Å; S19-E22 WeakPolarHBondContact O-CA 3.32Å; S19-E22 WeakPolarHBondContact O-CB 3.46Å; S19-E22 PolarHBondContact O-N 3.2Å
20	S	67.8	Low	65.4	Low	91 Å²	91	127.4 Å²	127.4	64%	0.636	69%	0.687	S	S	*	*	G	3₁₀ helix	trans	-47.9	-31	174	55.9	0	0	0	0	111.9	E22 W23 L24	S20-E22 VanDerWaalsContact C-N 3.34Å; S20-E22 PolarHBondContact O-N 3.43Å; S20-W23 WeakPolarHBondContact O-CB 3.46Å; S20-W23 PolarHBondContact O-N 3.29Å; S20-L24 WeakPolarHBondContact O-CG 3.34Å; S20-L24 PolarHBondContact O-N 3.41Å
21	K	66	Low	66.6	Low	162 Å²	162	129.7 Å²	129.7	70%	0.704	69%	0.688	S	S	*	*	G	3₁₀ helix	trans	-63.6	-31.8	175.2	-161.4	173	-171.8	178.2	0	114.7	S19 W23 L24	S19-K21 PolarHBondContact O-N 3Å; S19-K21 PolarHBondContact OG-N 3Å; K21-W23 VanDerWaalsContact C-N 3.31Å; K21-L24 PolarHBondContact O-N 3.07Å
22	E	64.6	Low	68.3	Low	111 Å²	111	128.5 Å²	128.5	52%	0.519	68%	0.675	S	S	.	*	G	3₁₀ helix	trans	-78.7	-17.4	177.7	-139.9	-178.9	157.8	0	0	112.2	K18 S19 S20	K18-E22 WeakPolarHBondContact CA-OE2 3.5Å; K18-E22 HydrophobicContact CB-CB 4.1Å; K18-E22 VanDerWaalsContact CB-OE2 3.32Å; K18-E22 WeakPolarHBondContact CB-OE2 3.41Å; K18-E22 HydrophobicContact CD-CB 4.44Å; K18-E22 HydrophobicContact CD-CG 4.2Å; K18-E22 WeakPolarHBondContact CE-OE1 3.35Å; K18-E22 VanDerWaalsContact CG-OE2 3.25Å; K18-E22 WeakPolarHBondContact CG-OE2 3.25Å; K18-E22 IonicContact NZ-OE1 2.71Å; K18-E22 PolarHBondContact NZ-OE1 2.79Å; S19-E22 WeakPolarHBondContact O-CA 3.32Å; S19-E22 WeakPolarHBondContact O-CB 3.46Å; S19-E22 PolarHBondContact O-N 3.2Å; S20-E22 VanDerWaalsContact C-N 3.34Å; S20-E22 PolarHBondContact O-N 3.43Å
23	W	67.1	Low	70	Confident	192 Å²	192	132.5 Å²	132.5	73%	0.727	68%	0.68	S	S	*	*	G	3₁₀ helix	trans	-84.8	-13.1	169.3	-68.9	91.6	0	0	0	113.1	K18 S20 K21	K18-W23 PolarHBondContact O-NE1 3.1Å; S20-W23 WeakPolarHBondContact O-CB 3.46Å; S20-W23 PolarHBondContact O-N 3.29Å; K21-W23 VanDerWaalsContact C-N 3.31Å
24	L	66.3	Low	71.7	Confident	132 Å²	132	130.4 Å²	130.4	69%	0.691	67%	0.667	S	S	*	*	S	Bend	trans	-87.4	-12.9	-174.2	-73.7	175.1	0	0	0	114.1	S20 K21 P26	S20-L24 WeakPolarHBondContact O-CG 3.34Å; S20-L24 PolarHBondContact O-N 3.41Å; K21-L24 PolarHBondContact O-N 3.07Å; L24-P26 WeakPolarHBondContact O-CD 3.23Å
25	E	69.9	Low	73.1	Confident	165 Å²	165	126.6 Å²	126.6	77%	0.771	65%	0.647	S	S	*	*	S	Bend	trans	-81.8	112.9	174.3	-80.5	-164.8	168.4	0	0	110.3	K27	E25-K27 PolarHBondContact O-N 3.02Å
26	P	71.9	Confident	74.5	Confident	119 Å²	119	123.5 Å²	123.5	77%	0.773	63%	0.632	S	S	*	*			trans	-60.9	124.6	172.3	25.4	-31.3	0	0	0	107.9	L24	L24-P26 WeakPolarHBondContact O-CD 3.23Å
27	K	71.9	Confident	75.9	Confident	177 Å²	177	120.2 Å²	120.2	77%	0.77	62%	0.617	S	S	*	*			trans	-56.5	131.7	172.4	-85.3	171.1	177.9	161.6	0	108.3	E25 L29	E25-K27 PolarHBondContact O-N 3.02Å; K27-L29 PolarHBondContact O-N 3.38Å
28	P	71.5	Confident	77.5	Confident	118 Å²	118	118.6 Å²	118.6	77%	0.766	61%	0.605	S	S	*	*			trans	-58.1	112.3	173.6	20.4	-28.9	0	0	0	108.7	C30	P28-C30 PolarHBondContact O-N 3.29Å
29	L	73.5	Confident	78.9	Confident	110 Å²	110	118.3 Å²	118.3	58%	0.576	61%	0.609	S	S	*	*			trans	-84	60.1	180	-65.1	176.3	0	0	0	109	K27 F31 M32 E33	K27-L29 PolarHBondContact O-N 3.38Å; L29-F31 PolarHBondContact O-N 3.2Å; L29-M32 HydrophobicContact CB-CB 3.69Å; L29-M32 HydrophobicContact CD1-CB 4.39Å; L29-M32 HydrophobicContact CD1-CE 4.46Å; L29-M32 WeakPolarHBondContact O-CA 3.45Å; L29-M32 WeakPolarHBondContact O-CB 3.37Å; L29-M32 PolarHBondContact O-N 3.5Å; L29-E33 PolarHBondContact O-N 2.88Å; L29-E33 VanDerWaalsContact O-N 3.14Å
30	C	78.6	Confident	80.1	Confident	83 Å²	83	118.8 Å²	118.8	56%	0.561	61%	0.61	S	S	*	*	H	α-helix	trans	-50.1	-33.4	-179.6	-177	0	0	0	0	112	P28 V34	P28-C30 PolarHBondContact O-N 3.29Å; C30-V34 WeakPolarHBondContact O-CG2 3.35Å; C30-V34 PolarHBondContact O-N 2.96Å
31	F	76.6	Confident	81.6	Confident	152 Å²	152	119.1 Å²	119.1	67%	0.667	60%	0.601	S	S	*	*	H	α-helix	trans	-66.1	-41.3	173.9	-174.2	-106.1	0	0	0	113.8	L29 E33 V34 L35	L29-F31 PolarHBondContact O-N 3.2Å; F31-E33 VanDerWaalsContact C-N 3.32Å; F31-E33 PolarHBondContact O-N 2.79Å; F31-V34 PolarHBondContact O-N 3.17Å; F31-L35 HydrophobicContact CD1-CD1 3.8Å; F31-L35 HydrophobicContact CD1-CG 4.41Å; F31-L35 HydrophobicContact CE1-CD1 3.28Å; F31-L35 HydrophobicContact CE1-CG 4.05Å; F31-L35 HydrophobicContact CZ-CD1 3.74Å; F31-L35 HydrophobicContact CZ-CD2 4.33Å; F31-L35 HydrophobicContact CZ-CG 4.13Å; F31-L35 WeakPolarHBondContact O-CG 3.45Å; F31-L35 PolarHBondContact O-N 2.93Å
32	M	87	Confident	83.1	Confident	110 Å²	110	114 Å²	114	54%	0.542	59%	0.589	S	S	.	*	H	α-helix	trans	-67.4	-35.9	178.7	-163.5	71.7	68.5	0	0	111.3	L29 A36	L29-M32 HydrophobicContact CB-CB 3.69Å; L29-M32 HydrophobicContact CD1-CB 4.39Å; L29-M32 HydrophobicContact CD1-CE 4.46Å; L29-M32 WeakPolarHBondContact O-CA 3.45Å; L29-M32 WeakPolarHBondContact O-CB 3.37Å; L29-M32 PolarHBondContact O-N 3.5Å; M32-A36 VanDerWaalsContact O-CB 3.23Å; M32-A36 WeakPolarHBondContact O-CB 3.19Å; M32-A36 PolarHBondContact O-N 3.14Å
33	E	88.5	Confident	84.7	Confident	133 Å²	133	111 Å²	111	62%	0.621	58%	0.583	S	S	*	*	H	α-helix	trans	-65.5	-41.8	176	-67.9	174.4	168.2	0	0	111.8	L29 F31 K37	L29-E33 PolarHBondContact O-N 2.88Å; L29-E33 VanDerWaalsContact O-N 3.14Å; F31-E33 VanDerWaalsContact C-N 3.32Å; F31-E33 PolarHBondContact O-N 2.79Å; E33-K37 WeakPolarHBondContact O-CB 3.47Å; E33-K37 PolarHBondContact O-N 2.92Å
34	V	91.1	Very high	86.2	Confident	86 Å²	86	106.6 Å²	106.6	52%	0.521	57%	0.573	S	S	.	*	H	α-helix	trans	-63.5	-46.7	176.2	172.5	0	0	0	0	111	C30 F31 K37 E38	C30-V34 WeakPolarHBondContact O-CG2 3.35Å; C30-V34 PolarHBondContact O-N 2.96Å; F31-V34 PolarHBondContact O-N 3.17Å; V34-K37 PolarHBondContact O-N 3.31Å; V34-E38 PolarHBondContact O-N 3.39Å
35	L	90.1	Very high	87.7	Confident	62 Å²	62	106.9 Å²	106.9	33%	0.325	57%	0.57	S	S	.	*	H	α-helix	trans	-62.5	-46.6	177.1	-71.7	179.2	0	0	0	112.1	F31 K37 E38 D39	F31-L35 HydrophobicContact CD1-CD1 3.8Å; F31-L35 HydrophobicContact CD1-CG 4.41Å; F31-L35 HydrophobicContact CE1-CD1 3.28Å; F31-L35 HydrophobicContact CE1-CG 4.05Å; F31-L35 HydrophobicContact CZ-CD1 3.74Å; F31-L35 HydrophobicContact CZ-CD2 4.33Å; F31-L35 HydrophobicContact CZ-CG 4.13Å; F31-L35 WeakPolarHBondContact O-CG 3.45Å; F31-L35 PolarHBondContact O-N 2.93Å; L35-K37 PolarHBondContact O-N 3.31Å; L35-E38 PolarHBondContact O-N 2.92Å; L35-D39 PolarHBondContact O-N 3.39Å
36	A	93.1	Very high	89.1	Confident	51 Å²	51	101.7 Å²	101.7	42%	0.421	55%	0.553	S	S	.	*	H	α-helix	trans	-60.9	-35.6	178.2	0	0	0	0	0	111.8	M32 T40	M32-A36 VanDerWaalsContact O-CB 3.23Å; M32-A36 WeakPolarHBondContact O-CB 3.19Å; M32-A36 PolarHBondContact O-N 3.14Å; A36-T40 WeakPolarHBondContact O-CB 3.37Å; A36-T40 VanDerWaalsContact O-CG2 3.23Å; A36-T40 WeakPolarHBondContact O-CG2 2.95Å; A36-T40 PolarHBondContact O-N 2.95Å; A36-T40 PolarHBondContact O-OG1 3.49Å
37	K	95.8	Very high	90.3	Very high	129 Å²	129	100.4 Å²	100.4	56%	0.561	54%	0.538	S	S	*	.	H	α-helix	trans	-67.2	-45.3	175.3	-175	178.5	172.2	-174.9	0	111.9	E33 V34 L35 T40 E41	E33-K37 WeakPolarHBondContact O-CB 3.47Å; E33-K37 PolarHBondContact O-N 2.92Å; V34-K37 PolarHBondContact O-N 3.31Å; L35-K37 PolarHBondContact O-N 3.31Å; K37-T40 WeakPolarHBondContact CA-OG1 3.42Å; K37-T40 PolarHBondContact O-N 3.18Å; K37-T40 PolarHBondContact O-OG1 2.96Å; K37-E41 WeakPolarHBondContact CE-OE1 3.23Å; K37-E41 IonicContact NZ-OE1 3.94Å; K37-E41 WeakPolarHBondContact O-CB 3.33Å; K37-E41 WeakPolarHBondContact O-CG 3.38Å; K37-E41 PolarHBondContact O-N 2.91Å
38	E	96.1	Very high	91.5	Very high	123 Å²	123	96.9 Å²	96.9	58%	0.575	53%	0.527	S	S	*	.	H	α-helix	trans	-60.5	-47.5	177	-176	178.1	-178.7	0	0	111.8	V34 L35 T40 E41 A42	V34-E38 PolarHBondContact O-N 3.39Å; L35-E38 PolarHBondContact O-N 2.92Å; E38-T40 VanDerWaalsContact C-N 3.33Å; E38-T40 PolarHBondContact O-N 3.41Å; E38-E41 PolarHBondContact O-N 3.29Å; E38-A42 WeakPolarHBondContact O-CB 3.39Å; E38-A42 PolarHBondContact O-N 2.97Å
39	D	97.7	Very high	92.8	Very high	109 Å²	109	99.6 Å²	99.6	58%	0.583	52%	0.523	S	S	*	.	H	α-helix	trans	-61.7	-41.4	179.1	-77	-22.5	0	0	0	111.9	L35 A42 A43	L35-D39 PolarHBondContact O-N 3.39Å; D39-A42 PolarHBondContact O-N 2.79Å; D39-A43 WeakPolarHBondContact O-CB 3.32Å; D39-A43 PolarHBondContact O-N 3.05Å
40	T	97.7	Very high	93.9	Very high	80 Å²	80	100.8 Å²	100.8	49%	0.491	52%	0.524	S	S	.	.	H	α-helix	trans	-68.6	-41.2	178.3	49.4	0	0	0	0	112	A36 K37 E38 A43 I44	A36-T40 WeakPolarHBondContact O-CB 3.37Å; A36-T40 VanDerWaalsContact O-CG2 3.23Å; A36-T40 WeakPolarHBondContact O-CG2 2.95Å; A36-T40 PolarHBondContact O-N 2.95Å; A36-T40 PolarHBondContact O-OG1 3.49Å; K37-T40 WeakPolarHBondContact CA-OG1 3.42Å; K37-T40 PolarHBondContact O-N 3.18Å; K37-T40 PolarHBondContact O-OG1 2.96Å; E38-T40 VanDerWaalsContact C-N 3.33Å; E38-T40 PolarHBondContact O-N 3.41Å; T40-A43 PolarHBondContact O-N 3.27Å; T40-I44 WeakPolarHBondContact O-CD1 3.37Å; T40-I44 VanDerWaalsContact O-CG1 3.25Å; T40-I44 WeakPolarHBondContact O-CG1 3.31Å; T40-I44 PolarHBondContact O-N 3.47Å
41	E	98.3	Very high	94.7	Very high	98 Å²	98	102 Å²	102	46%	0.458	52%	0.522	S	S	.	.	H	α-helix	trans	-62.1	-44.5	174.4	-75	178.9	-173.8	0	0	111.5	K37 E38 A43 I44 Q45	K37-E41 WeakPolarHBondContact CE-OE1 3.23Å; K37-E41 IonicContact NZ-OE1 3.94Å; K37-E41 WeakPolarHBondContact O-CB 3.33Å; K37-E41 WeakPolarHBondContact O-CG 3.38Å; K37-E41 PolarHBondContact O-N 2.91Å; E38-E41 PolarHBondContact O-N 3.29Å; E41-A43 PolarHBondContact O-N 2.97Å; E41-I44 PolarHBondContact O-N 2.95Å; E41-Q45 WeakPolarHBondContact O-CG 3.5Å; E41-Q45 PolarHBondContact O-N 3.47Å
42	A	98.1	Very high	95.6	Very high	54 Å²	54	98.3 Å²	98.3	45%	0.446	51%	0.509	S	S	.	.	H	α-helix	trans	-62.4	-41.6	176.2	0	0	0	0	0	112	E38 D39 Q45 S46	E38-A42 WeakPolarHBondContact O-CB 3.39Å; E38-A42 PolarHBondContact O-N 2.97Å; D39-A42 PolarHBondContact O-N 2.79Å; A42-Q45 PolarHBondContact O-N 3.43Å; A42-S46 WeakPolarHBondContact O-CB 3.39Å; A42-S46 PolarHBondContact O-N 2.95Å
43	A	98.4	Very high	95.9	Very high	48 Å²	48	95.8 Å²	95.8	40%	0.397	50%	0.502	S	S	.	.	H	α-helix	trans	-62.7	-45.6	176.3	0	0	0	0	0	111.8	D39 T40 E41 Q45 S46 I47	D39-A43 WeakPolarHBondContact O-CB 3.32Å; D39-A43 PolarHBondContact O-N 3.05Å; T40-A43 PolarHBondContact O-N 3.27Å; E41-A43 PolarHBondContact O-N 2.97Å; A43-Q45 PolarHBondContact O-N 3.01Å; A43-S46 PolarHBondContact O-N 3.47Å; A43-I47 VanDerWaalsContact O-CG1 3.31Å; A43-I47 WeakPolarHBondContact O-CG1 3.35Å; A43-I47 PolarHBondContact O-N 3.41Å
44	I	98.3	Very high	96.2	Very high	99 Å²	99	94 Å²	94	51%	0.508	50%	0.5	S	S	.	.	H	α-helix	trans	-58.4	-48.9	176.9	-70.7	164.3	0	0	0	110.3	T40 E41 S46 I47 L48	T40-I44 WeakPolarHBondContact O-CD1 3.37Å; T40-I44 VanDerWaalsContact O-CG1 3.25Å; T40-I44 WeakPolarHBondContact O-CG1 3.31Å; T40-I44 PolarHBondContact O-N 3.47Å; E41-I44 PolarHBondContact O-N 2.95Å; I44-S46 VanDerWaalsContact C-N 3.33Å; I44-S46 PolarHBondContact O-N 3.34Å; I44-I47 PolarHBondContact O-N 3.49Å; I44-L48 HydrophobicContact CG2-CD1 3.81Å; I44-L48 HydrophobicContact CG2-CG 4.37Å; I44-L48 WeakPolarHBondContact O-CB 3.21Å; I44-L48 VanDerWaalsContact O-CG 3.31Å; I44-L48 WeakPolarHBondContact O-CG 3.31Å; I44-L48 PolarHBondContact O-N 2.7Å
45	Q	98.1	Very high	96.4	Very high	138 Å²	138	94.7 Å²	94.7	65%	0.645	50%	0.499	S	S	*	.	H	α-helix	trans	-61	-41.8	179	-70.8	-177.4	7.1	0	0	112.1	E41 A42 A43 L48 Y49	E41-Q45 WeakPolarHBondContact O-CG 3.5Å; E41-Q45 PolarHBondContact O-N 3.47Å; A42-Q45 PolarHBondContact O-N 3.43Å; A43-Q45 PolarHBondContact O-N 3.01Å; Q45-L48 PolarHBondContact O-N 2.97Å; Q45-Y49 WeakPolarHBondContact O-CB 3.47Å; Q45-Y49 PolarHBondContact O-N 3.34Å
46	S	98	Very high	96.6	Very high	57 Å²	57	97.5 Å²	97.5	40%	0.399	51%	0.509	S	S	.	.	H	α-helix	trans	-62.8	-43.7	178.2	-171.9	0	0	0	0	112.3	A42 A43 I44 K50	A42-S46 WeakPolarHBondContact O-CB 3.39Å; A42-S46 PolarHBondContact O-N 2.95Å; A43-S46 PolarHBondContact O-N 3.47Å; I44-S46 VanDerWaalsContact C-N 3.33Å; I44-S46 PolarHBondContact O-N 3.34Å; S46-K50 WeakPolarHBondContact O-CG 3.25Å; S46-K50 PolarHBondContact O-N 2.92Å; S46-K50 VanDerWaalsContact O-N 3.1Å
47	I	98.1	Very high	96.6	Very high	91 Å²	91	102 Å²	102	47%	0.467	52%	0.519	S	S	.	.	H	α-helix	trans	-62.6	-52.7	176.7	-68.3	165.3	0	0	0	110.1	A43 I44 Y49 K50 E51	A43-I47 VanDerWaalsContact O-CG1 3.31Å; A43-I47 WeakPolarHBondContact O-CG1 3.35Å; A43-I47 PolarHBondContact O-N 3.41Å; I44-I47 PolarHBondContact O-N 3.49Å; I47-Y49 VanDerWaalsContact C-N 3.29Å; I47-Y49 PolarHBondContact O-N 3.22Å; I47-K50 PolarHBondContact O-N 3.17Å; I47-K50 VanDerWaalsContact O-N 3.15Å; I47-E51 HydrophobicContact CG2-CG 4.33Å; I47-E51 WeakPolarHBondContact O-CG 3.39Å; I47-E51 PolarHBondContact O-N 3.15Å
48	L	97.6	Very high	96.5	Very high	103 Å²	103	100.6 Å²	100.6	54%	0.539	52%	0.515	S	S	.	.	H	α-helix	trans	-59.1	-40.6	-178.7	-70.8	174.1	0	0	0	112.3	I44 Q45 N52	I44-L48 HydrophobicContact CG2-CD1 3.81Å; I44-L48 HydrophobicContact CG2-CG 4.37Å; I44-L48 WeakPolarHBondContact O-CB 3.21Å; I44-L48 VanDerWaalsContact O-CG 3.31Å; I44-L48 WeakPolarHBondContact O-CG 3.31Å; I44-L48 PolarHBondContact O-N 2.7Å; Q45-L48 PolarHBondContact O-N 2.97Å; L48-N52 WeakPolarHBondContact O-CB 3.34Å; L48-N52 PolarHBondContact O-N 3.31Å
49	Y	97.1	Very high	96.4	Very high	176 Å²	176	103.1 Å²	103.1	69%	0.69	52%	0.519	S	S	*	.	H	α-helix	trans	-63.5	-47.1	177.2	-179.6	-98.4	0	0	0	111.7	Q45 I47 N52 S53	Q45-Y49 WeakPolarHBondContact O-CB 3.47Å; Q45-Y49 PolarHBondContact O-N 3.34Å; I47-Y49 VanDerWaalsContact C-N 3.29Å; I47-Y49 PolarHBondContact O-N 3.22Å; Y49-N52 PolarHBondContact O-N 3.02Å; Y49-S53 PolarHBondContact O-N 3.44Å
50	K	96.8	Very high	96.3	Very high	134 Å²	134	101.3 Å²	101.3	58%	0.583	51%	0.512	S	S	*	.	H	α-helix	trans	-60.4	-48.3	178.1	-75.9	176.9	-179.1	177.7	0	111.1	S46 I47 S53 V54	S46-K50 WeakPolarHBondContact O-CG 3.25Å; S46-K50 PolarHBondContact O-N 2.92Å; S46-K50 VanDerWaalsContact O-N 3.1Å; I47-K50 PolarHBondContact O-N 3.17Å; I47-K50 VanDerWaalsContact O-N 3.15Å; K50-S53 WeakPolarHBondContact O-CB 3.5Å; K50-S53 PolarHBondContact O-N 3.3Å; K50-S53 PolarHBondContact O-OG 2.99Å; K50-V54 PolarHBondContact O-N 3.1Å
51	E	96	Very high	96.1	Very high	110 Å²	110	100.5 Å²	100.5	51%	0.514	50%	0.503	S	S	.	.	H	α-helix	trans	-62.6	-45	179.4	-70.8	-176.7	164.5	0	0	112.2	I47 S53 V54 I55	I47-E51 HydrophobicContact CG2-CG 4.33Å; I47-E51 WeakPolarHBondContact O-CG 3.39Å; I47-E51 PolarHBondContact O-N 3.15Å; E51-S53 VanDerWaalsContact C-N 3.26Å; E51-S53 PolarHBondContact O-N 2.94Å; E51-V54 PolarHBondContact O-N 3.32Å; E51-V54 VanDerWaalsContact O-N 3.11Å; E51-I55 WeakPolarHBondContact O-CG1 3.28Å; E51-I55 PolarHBondContact O-N 2.99Å
52	N	95.8	Very high	95.9	Very high	74 Å²	74	99.6 Å²	99.6	40%	0.396	50%	0.501	S	S	.	.	H	α-helix	trans	-59.4	-38.8	176.5	-173.4	25.8	0	0	0	111.7	L48 Y49 V54 I55 K56	L48-N52 WeakPolarHBondContact O-CB 3.34Å; L48-N52 PolarHBondContact O-N 3.31Å; Y49-N52 PolarHBondContact O-N 3.02Å; N52-V54 VanDerWaalsContact C-N 3.35Å; N52-V54 PolarHBondContact O-N 3.48Å; N52-I55 PolarHBondContact O-N 3.04Å; N52-K56 PolarHBondContact ND2-NZ 2.93Å; N52-K56 WeakPolarHBondContact O-CB 3.42Å; N52-K56 VanDerWaalsContact O-CG 3.28Å; N52-K56 WeakPolarHBondContact O-CG 3.45Å; N52-K56 PolarHBondContact O-N 3.33Å; N52-K56 WeakPolarHBondContact OD1-CE 3.39Å
53	S	93.5	Very high	95.6	Very high	57 Å²	57	99.8 Å²	99.8	40%	0.399	50%	0.499	S	S	.	.	H	α-helix	trans	-62.6	-41.5	176.4	85.3	0	0	0	0	112.1	Y49 K50 E51 K56 K57	Y49-S53 PolarHBondContact O-N 3.44Å; K50-S53 WeakPolarHBondContact O-CB 3.5Å; K50-S53 PolarHBondContact O-N 3.3Å; K50-S53 PolarHBondContact O-OG 2.99Å; E51-S53 VanDerWaalsContact C-N 3.26Å; E51-S53 PolarHBondContact O-N 2.94Å; S53-K56 PolarHBondContact O-N 3.48Å; S53-K57 WeakPolarHBondContact O-CB 3.46Å; S53-K57 PolarHBondContact O-N 2.9Å
54	V	94.8	Very high	95.2	Very high	95 Å²	95	105.9 Å²	105.9	58%	0.576	51%	0.512	S	S	*	.	H	α-helix	trans	-66.1	-46.2	178.1	173.2	0	0	0	0	110.4	K50 E51 N52 K56 K57 Q58	K50-V54 PolarHBondContact O-N 3.1Å; E51-V54 PolarHBondContact O-N 3.32Å; E51-V54 VanDerWaalsContact O-N 3.11Å; N52-V54 VanDerWaalsContact C-N 3.35Å; N52-V54 PolarHBondContact O-N 3.48Å; V54-K56 PolarHBondContact O-N 3.46Å; V54-K57 PolarHBondContact O-N 3.48Å; V54-Q58 WeakPolarHBondContact O-CB 3.43Å; V54-Q58 PolarHBondContact O-N 3.27Å
55	I	94.5	Very high	94.7	Very high	101 Å²	101	107.7 Å²	107.7	52%	0.518	52%	0.516	S	S	.	.	H	α-helix	trans	-59.9	-46.5	177.6	-68.2	167.3	0	0	0	110.7	E51 N52 K57 Q58 R59	E51-I55 WeakPolarHBondContact O-CG1 3.28Å; E51-I55 PolarHBondContact O-N 2.99Å; N52-I55 PolarHBondContact O-N 3.04Å; I55-K57 PolarHBondContact O-N 3.11Å; I55-Q58 PolarHBondContact O-N 3.18Å; I55-R59 WeakPolarHBondContact O-CB 3.39Å; I55-R59 PolarHBondContact O-N 3.49Å
56	K	94.8	Very high	94.3	Very high	120 Å²	120	109.3 Å²	109.3	52%	0.522	52%	0.517	S	S	.	.	H	α-helix	trans	-59.3	-47	177.1	-77.4	175.5	178.8	177.2	0	111.4	N52 S53 V54 Q58 R59 V60	N52-K56 PolarHBondContact ND2-NZ 2.93Å; N52-K56 WeakPolarHBondContact O-CB 3.42Å; N52-K56 VanDerWaalsContact O-CG 3.28Å; N52-K56 WeakPolarHBondContact O-CG 3.45Å; N52-K56 PolarHBondContact O-N 3.33Å; N52-K56 WeakPolarHBondContact OD1-CE 3.39Å; S53-K56 PolarHBondContact O-N 3.48Å; V54-K56 PolarHBondContact O-N 3.46Å; K56-Q58 PolarHBondContact O-N 3.46Å; K56-R59 PolarHBondContact O-N 2.92Å; K56-V60 WeakPolarHBondContact O-CG2 3.33Å; K56-V60 PolarHBondContact O-N 3.44Å
57	K	93.7	Very high	93.7	Very high	147 Å²	147	110.8 Å²	110.8	64%	0.639	52%	0.523	S	S	*	.	H	α-helix	trans	-60	-46.5	177.6	-177.2	176.9	178.7	-180	0	111.3	S53 V54 I55 R59 V60 I61	S53-K57 WeakPolarHBondContact O-CB 3.46Å; S53-K57 PolarHBondContact O-N 2.9Å; V54-K57 PolarHBondContact O-N 3.48Å; I55-K57 PolarHBondContact O-N 3.11Å; K57-R59 VanDerWaalsContact C-N 3.34Å; K57-R59 PolarHBondContact O-N 2.92Å; K57-V60 PolarHBondContact O-N 3.02Å; K57-I61 HydrophobicContact CG-CD1 4.08Å; K57-I61 WeakPolarHBondContact O-CG1 3.37Å; K57-I61 PolarHBondContact O-N 2.9Å
58	Q	93.5	Very high	92.9	Very high	99 Å²	99	109.2 Å²	109.2	46%	0.463	52%	0.524	S	S	.	.	H	α-helix	trans	-63.8	-40.5	179.9	-167.8	62.2	14.7	0	0	111.9	V54 I55 K56 V60 I61 L62	V54-Q58 WeakPolarHBondContact O-CB 3.43Å; V54-Q58 PolarHBondContact O-N 3.27Å; I55-Q58 PolarHBondContact O-N 3.18Å; K56-Q58 PolarHBondContact O-N 3.46Å; Q58-V60 VanDerWaalsContact C-N 3.35Å; Q58-V60 PolarHBondContact O-N 3.47Å; Q58-I61 PolarHBondContact O-N 2.91Å; Q58-L62 HydrophobicContact CG-CD1 4.12Å; Q58-L62 WeakPolarHBondContact O-CB 3.5Å; Q58-L62 WeakPolarHBondContact O-CG 3.41Å; Q58-L62 PolarHBondContact O-N 3.37Å
59	R	93.8	Very high	92.3	Very high	175 Å²	175	109.7 Å²	109.7	66%	0.66	53%	0.531	S	S	*	.	H	α-helix	trans	-58.6	-46	174.3	-177.1	-178.6	-79.3	176	-4.8	111.3	I55 K56 K57 I61 L62 S63	I55-R59 WeakPolarHBondContact O-CB 3.39Å; I55-R59 PolarHBondContact O-N 3.49Å; K56-R59 PolarHBondContact O-N 2.92Å; K57-R59 VanDerWaalsContact C-N 3.34Å; K57-R59 PolarHBondContact O-N 2.92Å; R59-I61 PolarHBondContact O-N 3Å; R59-L62 PolarHBondContact O-N 3.5Å; R59-S63 WeakPolarHBondContact O-CB 3.46Å; R59-S63 PolarHBondContact O-N 3.28Å; R59-S63 PolarHBondContact O-OG 3.46Å
60	V	95.1	Very high	91.4	Very high	72 Å²	72	108.3 Å²	108.3	44%	0.436	54%	0.535	S	S	.	.	H	α-helix	trans	-61.1	-45.3	177.5	171.8	0	0	0	0	111.3	K56 K57 Q58 L62 S63 R64	K56-V60 WeakPolarHBondContact O-CG2 3.33Å; K56-V60 PolarHBondContact O-N 3.44Å; K57-V60 PolarHBondContact O-N 3.02Å; Q58-V60 VanDerWaalsContact C-N 3.35Å; Q58-V60 PolarHBondContact O-N 3.47Å; V60-L62 PolarHBondContact O-N 3.23Å; V60-S63 PolarHBondContact O-N 3.31Å; V60-R64 WeakPolarHBondContact O-CG 3.4Å; V60-R64 PolarHBondContact O-N 3.45Å
61	I	93.9	Very high	90.4	Very high	62 Å²	62	106.6 Å²	106.6	32%	0.318	54%	0.54	S	S	.	.	H	α-helix	trans	-60.8	-47.3	178.3	-68.4	167.4	0	0	0	110.7	K57 Q58 R59 R64 K65	K57-I61 HydrophobicContact CG-CD1 4.08Å; K57-I61 WeakPolarHBondContact O-CG1 3.37Å; K57-I61 PolarHBondContact O-N 2.9Å; Q58-I61 PolarHBondContact O-N 2.91Å; R59-I61 PolarHBondContact O-N 3Å; I61-R64 PolarHBondContact O-N 2.77Å; I61-K65 HydrophobicContact CG2-CD 4.41Å; I61-K65 WeakPolarHBondContact O-CG 3.37Å; I61-K65 PolarHBondContact O-N 3.41Å
62	L	93.7	Very high	88.9	Confident	79 Å²	79	104.4 Å²	104.4	41%	0.414	55%	0.546	S	S	.	.	H	α-helix	trans	-61.8	-44	178.6	-73.8	167.9	0	0	0	111.8	Q58 R59 V60 R64 K65 R66	Q58-L62 HydrophobicContact CG-CD1 4.12Å; Q58-L62 WeakPolarHBondContact O-CB 3.5Å; Q58-L62 WeakPolarHBondContact O-CG 3.41Å; Q58-L62 PolarHBondContact O-N 3.37Å; R59-L62 PolarHBondContact O-N 3.5Å; V60-L62 PolarHBondContact O-N 3.23Å; L62-R64 PolarHBondContact O-N 3.05Å; L62-K65 PolarHBondContact O-N 3.48Å; L62-R66 WeakPolarHBondContact O-CG 3.44Å; L62-R66 PolarHBondContact O-N 3.03Å
63	S	91.3	Very high	87	Confident	58 Å²	58	104 Å²	104	41%	0.406	56%	0.559	S	S	.	*	H	α-helix	trans	-60.3	-44.5	176.4	-68.2	0	0	0	0	111.9	R59 V60 K65 R66 T67	R59-S63 WeakPolarHBondContact O-CB 3.46Å; R59-S63 PolarHBondContact O-N 3.28Å; R59-S63 PolarHBondContact O-OG 3.46Å; V60-S63 PolarHBondContact O-N 3.31Å; S63-K65 PolarHBondContact O-N 2.82Å; S63-R66 PolarHBondContact O-N 3.35Å; S63-T67 PolarHBondContact O-N 3.37Å; S63-T67 PolarHBondContact O-OG1 3.47Å
64	R	90.5	Very high	84.9	Confident	177 Å²	177	114.5 Å²	114.5	67%	0.668	60%	0.598	S	S	*	*	H	α-helix	trans	-63.2	-39.5	177.3	-72.9	178.8	-179.8	-178	0.2	112.9	V60 I61 L62 T67 A68	V60-R64 WeakPolarHBondContact O-CG 3.4Å; V60-R64 PolarHBondContact O-N 3.45Å; I61-R64 PolarHBondContact O-N 2.77Å; L62-R64 PolarHBondContact O-N 3.05Å; R64-T67 WeakPolarHBondContact CA-OG1 3.46Å; R64-T67 PolarHBondContact O-N 3.01Å; R64-T67 PolarHBondContact O-OG1 3.33Å; R64-A68 WeakPolarHBondContact O-CB 3.45Å; R64-A68 PolarHBondContact O-N 3.14Å
65	K	88.8	Confident	84.4	Confident	137 Å²	137	115.5 Å²	115.5	60%	0.596	60%	0.599	S	S	*	*	H	α-helix	trans	-62.3	-44.6	175.1	-74.7	-176.9	177	-170.6	0	111.3	I61 L62 S63 T67 A68 V69	I61-K65 HydrophobicContact CG2-CD 4.41Å; I61-K65 WeakPolarHBondContact O-CG 3.37Å; I61-K65 PolarHBondContact O-N 3.41Å; L62-K65 PolarHBondContact O-N 3.48Å; S63-K65 PolarHBondContact O-N 2.82Å; K65-T67 PolarHBondContact O-N 3.3Å; K65-A68 PolarHBondContact O-N 3.35Å; K65-V69 WeakPolarHBondContact O-CG2 3.33Å; K65-V69 PolarHBondContact O-N 3.43Å
66	R	88.9	Confident	83.9	Confident	172 Å²	172	116.2 Å²	116.2	65%	0.649	60%	0.603	S	S	*	*	H	α-helix	trans	-60.7	-44.3	176.3	-69.7	-179.4	-166.5	168.7	2.4	112	L62 S63 A68 V69 L70	L62-R66 WeakPolarHBondContact O-CG 3.44Å; L62-R66 PolarHBondContact O-N 3.03Å; S63-R66 PolarHBondContact O-N 3.35Å; R66-A68 VanDerWaalsContact C-N 3.34Å; R66-A68 PolarHBondContact O-N 3.27Å; R66-V69 PolarHBondContact O-N 3.46Å; R66-L70 WeakPolarHBondContact O-CG 3.48Å; R66-L70 PolarHBondContact O-N 3.48Å
67	T	85.1	Confident	83.3	Confident	87 Å²	87	116 Å²	116	53%	0.534	61%	0.608	S	S	.	*	H	α-helix	trans	-65.3	-36.2	178.3	53.1	0	0	0	0	112.6	S63 R64 K65 L70 S71	S63-T67 PolarHBondContact O-N 3.37Å; S63-T67 PolarHBondContact O-OG1 3.47Å; R64-T67 WeakPolarHBondContact CA-OG1 3.46Å; R64-T67 PolarHBondContact O-N 3.01Å; R64-T67 PolarHBondContact O-OG1 3.33Å; K65-T67 PolarHBondContact O-N 3.3Å; T67-L70 PolarHBondContact O-N 3.05Å; T67-S71 WeakPolarHBondContact O-CB 3.47Å; T67-S71 PolarHBondContact O-N 3.31Å; T67-S71 PolarHBondContact O-OG 3Å
68	A	82	Confident	82.6	Confident	59 Å²	59	114.2 Å²	114.2	49%	0.488	61%	0.606	S	S	.	*	H	α-helix	trans	-65.6	-42	175.6	0	0	0	0	0	112	R64 K65 R66 S71 G72	R64-A68 WeakPolarHBondContact O-CB 3.45Å; R64-A68 PolarHBondContact O-N 3.14Å; K65-A68 PolarHBondContact O-N 3.35Å; R66-A68 VanDerWaalsContact C-N 3.34Å; R66-A68 PolarHBondContact O-N 3.27Å; A68-S71 WeakPolarHBondContact CA-OG 3.39Å; A68-S71 PolarHBondContact O-N 3.33Å; A68-S71 PolarHBondContact O-OG 3.04Å; A68-S71 VanDerWaalsContact O-OG 3.14Å; A68-G72 PolarHBondContact O-N 3.06Å
69	V	84.4	Confident	82	Confident	113 Å²	113	115.1 Å²	115.1	69%	0.685	62%	0.615	S	S	*	*	H	α-helix	trans	-63.5	-43	175.9	172.7	0	0	0	0	111.4	K65 R66 S71 G72	K65-V69 WeakPolarHBondContact O-CG2 3.33Å; K65-V69 PolarHBondContact O-N 3.43Å; R66-V69 PolarHBondContact O-N 3.46Å; V69-S71 VanDerWaalsContact C-N 3.31Å; V69-S71 PolarHBondContact O-N 3.46Å; V69-G72 PolarHBondContact O-N 3.03Å
70	L	78.3	Confident	81.2	Confident	146 Å²	146	111.1 Å²	111.1	76%	0.764	61%	0.612	S	S	*	*	H	α-helix	trans	-69.6	-25.8	179.4	-67.8	172.4	0	0	0	113.5	R66 T67	R66-L70 WeakPolarHBondContact O-CG 3.48Å; R66-L70 PolarHBondContact O-N 3.48Å; T67-L70 PolarHBondContact O-N 3.05Å
71	S	76.1	Confident	80.2	Confident	99 Å²	99	113.9 Å²	113.9	69%	0.692	62%	0.624	S	S	*	*	H	α-helix	trans	-90.5	-18.5	178.5	51.1	0	0	0	0	113.9	T67 A68 V69	T67-S71 WeakPolarHBondContact O-CB 3.47Å; T67-S71 PolarHBondContact O-N 3.31Å; T67-S71 PolarHBondContact O-OG 3Å; A68-S71 WeakPolarHBondContact CA-OG 3.39Å; A68-S71 PolarHBondContact O-N 3.33Å; A68-S71 PolarHBondContact O-OG 3.04Å; A68-S71 VanDerWaalsContact O-OG 3.14Å; V69-S71 VanDerWaalsContact C-N 3.31Å; V69-S71 PolarHBondContact O-N 3.46Å
72	G	65.1	Low	79.1	Confident	63 Å²	63	117.9 Å²	117.9	65%	0.649	65%	0.648	S	S	*	*	S	Bend	trans	-90	2.1	177.4	0	0	0	0	0	115.4	A68 V69 K74	A68-G72 PolarHBondContact O-N 3.06Å; V69-G72 PolarHBondContact O-N 3.03Å; G72-K74 PolarHBondContact O-N 3.17Å
73	G	55.5	Low	77.9	Confident	65 Å²	65	121.2 Å²	121.2	67%	0.67	67%	0.667	S	S	*	*			trans	-81	84.8	174.2	0	0	0	0	0	112.2
74	K	49	Very low	76.7	Confident	278 Å²	278	126.9 Å²	126.9	100%	1.209	69%	0.691	S	S	*	*			trans	-138	0	154	-79.9	-169.2	-177.8	178.4	0	108.7	G72	G72-K74 PolarHBondContact O-N 3.17Å

Retrieved 74 of 74 residues in 49 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).