A0A087WU21_HUMAN Loading...

CD24 molecule

AlphaFold DB , UniProt , Accession A0A087WU21, Species HUMAN (Homo sapiens, Human), Gene CD24, Length 37 aa.

						>A0A087WU21_HUMAN|A0A087WU21|CD24
MGRAMVARLGLGLLLLALLLPTQKMLRIPNLIDLKNM
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57.7	Low	76.5	Confident	233 Å²	233	124 Å²	124	100%	1.148	67%	0.668	S	S	*	*				0	25.6	0	-69.1	91	154.3	0	0	115
2	G	66.4	Low	77.4	Confident	58 Å²	58	116.8 Å²	116.8	60%	0.598	64%	0.644	S	S	*	*			trans	-90.1	-24.8	-175.6	0	0	0	0	0	116.4
3	R	74.1	Confident	78	Confident	229 Å²	229	116.9 Å²	116.9	86%	0.864	64%	0.643	S	S	*	*	H	α-helix	trans	-89.2	-29.4	-167.4	-60.3	-175.2	-174.9	-169.8	1.6	114.5	M5 V6 A7	R3-M5 PolarHBondContact O-N 3.36Å; R3-M5 VanDerWaalsContact C-N 3.25Å; R3-V6 PolarHBondContact O-N 3.25Å; R3-A7 PolarHBondContact O-N 3.4Å
4	A	75.6	Confident	78.5	Confident	72 Å²	72	117.6 Å²	117.6	60%	0.595	64%	0.644	S	S	*	*	H	α-helix	trans	-66.7	-27.6	179.2	0	0	0	0	0	112.9	R8	A4-R8 PolarHBondContact O-N 3.14Å; A4-R8 VanDerWaalsContact O-N 3.07Å
5	M	76.6	Confident	78.9	Confident	138 Å²	138	116.7 Å²	116.7	68%	0.68	64%	0.638	S	S	*	*	H	α-helix	trans	-74.6	-39.7	179.1	-158.8	166.8	-157.8	0	0	112	R3 R8 L9	R3-M5 PolarHBondContact O-N 3.36Å; R3-M5 VanDerWaalsContact C-N 3.25Å; M5-R8 PolarHBondContact O-N 2.7Å; M5-L9 WeakPolarHBondContact O-CG 3.13Å; M5-L9 PolarHBondContact O-N 2.84Å
6	V	77.9	Confident	79.1	Confident	104 Å²	104	116.6 Å²	116.6	63%	0.63	64%	0.636	S	S	*	*	H	α-helix	trans	-65	-42.4	174.6	-179.9	0	0	0	0	110.7	R3 R8 L9 G10	R3-V6 PolarHBondContact O-N 3.25Å; V6-R8 PolarHBondContact O-N 3.22Å; V6-L9 PolarHBondContact O-N 2.95Å; V6-G10 PolarHBondContact O-N 3.41Å
7	A	78.9	Confident	79.2	Confident	60 Å²	60	113.6 Å²	113.6	50%	0.496	63%	0.63	S	S	.	*	H	α-helix	trans	-61.3	-43.8	174.8	0	0	0	0	0	111.8	R3 L9 G10 L11	R3-A7 PolarHBondContact O-N 3.4Å; A7-L9 PolarHBondContact O-N 3.44Å; A7-G10 PolarHBondContact O-N 3.09Å; A7-L11 PolarHBondContact O-N 2.75Å; A7-L11 WeakPolarHBondContact O-CB 3.35Å
8	R	80.8	Confident	79.3	Confident	210 Å²	210	113.8 Å²	113.8	79%	0.792	63%	0.629	S	S	*	*	H	α-helix	trans	-62.4	-40.4	175.3	-88.1	-178.6	72.4	161.9	1.1	113.3	A4 M5 V6 G12	A4-R8 PolarHBondContact O-N 3.14Å; A4-R8 VanDerWaalsContact O-N 3.07Å; M5-R8 PolarHBondContact O-N 2.7Å; V6-R8 PolarHBondContact O-N 3.22Å; R8-G12 PolarHBondContact O-N 3.29Å
9	L	82.9	Confident	79.2	Confident	115 Å²	115	113 Å²	113	60%	0.602	62%	0.623	S	S	*	*	H	α-helix	trans	-65.9	-44.3	176.9	-79.7	161.6	0	0	0	111.6	M5 V6 A7 G12 L13	M5-L9 WeakPolarHBondContact O-CG 3.13Å; M5-L9 PolarHBondContact O-N 2.84Å; V6-L9 PolarHBondContact O-N 2.95Å; A7-L9 PolarHBondContact O-N 3.44Å; L9-G12 PolarHBondContact O-N 3.46Å; L9-L13 WeakPolarHBondContact O-CG 3.41Å; L9-L13 PolarHBondContact O-N 2.99Å; L9-L13 VanDerWaalsContact O-N 3.11Å
10	G	86.6	Confident	78.9	Confident	37 Å²	37	113.4 Å²	113.4	38%	0.381	62%	0.624	S	S	.	*	H	α-helix	trans	-64.1	-42.7	176.8	0	0	0	0	0	113	V6 A7 L13 L14	V6-G10 PolarHBondContact O-N 3.41Å; A7-G10 PolarHBondContact O-N 3.09Å; G10-L13 PolarHBondContact O-N 2.85Å; G10-L14 WeakPolarHBondContact O-CB 3.41Å; G10-L14 PolarHBondContact O-N 3.08Å
11	L	84.5	Confident	78.3	Confident	108 Å²	108	111.3 Å²	111.3	57%	0.565	62%	0.616	S	S	*	*	H	α-helix	trans	-67.3	-39.1	178.3	-129.4	151.9	0	0	0	111.8	A7 L14 L15	A7-L11 PolarHBondContact O-N 2.75Å; A7-L11 WeakPolarHBondContact O-CB 3.35Å; L11-L14 PolarHBondContact O-N 2.95Å; L11-L15 HydrophobicContact CD2-CD1 4.04Å; L11-L15 PolarHBondContact O-N 3.49Å; L11-L15 WeakPolarHBondContact O-CG 3.35Å; L11-L15 HydrophobicContact CD2-CG 4.29Å; L11-L15 VanDerWaalsContact O-CG 3.28Å
12	G	87.3	Confident	78.8	Confident	37 Å²	37	103.2 Å²	103.2	38%	0.381	58%	0.579	S	S	.	*	H	α-helix	trans	-63.2	-41.4	175.3	0	0	0	0	0	113	R8 L9 L15 L16	R8-G12 PolarHBondContact O-N 3.29Å; L9-G12 PolarHBondContact O-N 3.46Å; G12-L15 PolarHBondContact O-N 3.38Å; G12-L16 WeakPolarHBondContact O-CB 3.37Å; G12-L16 PolarHBondContact O-N 3.02Å
13	L	84.7	Confident	78.7	Confident	119 Å²	119	105.8 Å²	105.8	62%	0.623	58%	0.576	S	S	*	*	H	α-helix	trans	-67	-40.1	175.3	-76.5	166.6	0	0	0	112.4	L9 G10 L16 A17	L9-L13 WeakPolarHBondContact O-CG 3.41Å; L9-L13 PolarHBondContact O-N 2.99Å; L9-L13 VanDerWaalsContact O-N 3.11Å; G10-L13 PolarHBondContact O-N 2.85Å; L13-L16 PolarHBondContact O-N 3.22Å; L13-A17 VanDerWaalsContact O-CB 3.31Å; L13-A17 WeakPolarHBondContact O-CB 2.86Å; L13-A17 PolarHBondContact O-N 3.42Å
14	L	84.8	Confident	78.3	Confident	127 Å²	127	103 Å²	103	67%	0.665	57%	0.57	S	S	*	*	H	α-helix	trans	-61.6	-43.9	175.7	-120	153.4	0	0	0	111.6	G10 L11 A17 L18	G10-L14 WeakPolarHBondContact O-CB 3.41Å; G10-L14 PolarHBondContact O-N 3.08Å; L11-L14 PolarHBondContact O-N 2.95Å; L14-A17 PolarHBondContact O-N 2.84Å; L14-L18 WeakPolarHBondContact O-CB 3.47Å; L14-L18 PolarHBondContact O-N 3.33Å
15	L	84.5	Confident	77.8	Confident	104 Å²	104	107.6 Å²	107.6	55%	0.545	58%	0.581	S	S	.	*	H	α-helix	trans	-65.4	-41.1	175.3	-70.6	170.9	0	0	0	111.9	L11 G12 L18 L19	L11-L15 HydrophobicContact CD2-CD1 4.04Å; L11-L15 PolarHBondContact O-N 3.49Å; L11-L15 WeakPolarHBondContact O-CG 3.35Å; L11-L15 HydrophobicContact CD2-CG 4.29Å; L11-L15 VanDerWaalsContact O-CG 3.28Å; G12-L15 PolarHBondContact O-N 3.38Å; L15-L18 PolarHBondContact O-N 2.88Å; L15-L19 VanDerWaalsContact O-CB 3.27Å; L15-L19 WeakPolarHBondContact O-CB 3.44Å; L15-L19 PolarHBondContact O-N 3.02Å
16	L	81.6	Confident	77.1	Confident	115 Å²	115	107.3 Å²	107.3	60%	0.602	58%	0.581	S	S	*	*	H	α-helix	trans	-63.3	-43	176.7	-152.7	88.6	0	0	0	111.5	G12 L13 L18 L19 L20	G12-L16 WeakPolarHBondContact O-CB 3.37Å; G12-L16 PolarHBondContact O-N 3.02Å; L13-L16 PolarHBondContact O-N 3.22Å; L16-L18 VanDerWaalsContact C-N 3.3Å; L16-L18 PolarHBondContact O-N 3.33Å; L16-L19 PolarHBondContact O-N 2.9Å; L16-L20 WeakPolarHBondContact O-CB 3.47Å; L16-L20 PolarHBondContact O-N 3.3Å
17	A	81.3	Confident	76.3	Confident	66 Å²	66	110.8 Å²	110.8	55%	0.545	58%	0.583	S	S	.	*	H	α-helix	trans	-66.5	-30.3	177.2	0	0	0	0	0	112.8	L13 L14 P21	L13-A17 VanDerWaalsContact O-CB 3.31Å; L13-A17 WeakPolarHBondContact O-CB 2.86Å; L13-A17 PolarHBondContact O-N 3.42Å; L14-A17 PolarHBondContact O-N 2.84Å; A17-P21 WeakPolarHBondContact O-CD 3.2Å; A17-P21 WeakPolarHBondContact O-CG 3.36Å
18	L	80.4	Confident	75.5	Confident	117 Å²	117	114.7 Å²	114.7	61%	0.613	59%	0.594	S	S	*	*	H	α-helix	trans	-79.9	-33.8	174.3	-174.4	62.4	0	0	0	112.5	L14 L15 L16 P21 T22	L14-L18 WeakPolarHBondContact O-CB 3.47Å; L14-L18 PolarHBondContact O-N 3.33Å; L15-L18 PolarHBondContact O-N 2.88Å; L16-L18 VanDerWaalsContact C-N 3.3Å; L16-L18 PolarHBondContact O-N 3.33Å; L18-P21 WeakPolarHBondContact O-CD 3.31Å; L18-P21 WeakPolarHBondContact O-CG 3.48Å; L18-T22 PolarHBondContact O-OG1 2.86Å
19	L	78.3	Confident	74.5	Confident	98 Å²	98	108 Å²	108	51%	0.513	58%	0.578	S	S	.	*	H	α-helix	trans	-72.4	-38.7	179.2	-173.2	63.3	0	0	0	112.2	L15 L16 T22 Q23	L15-L19 VanDerWaalsContact O-CB 3.27Å; L15-L19 WeakPolarHBondContact O-CB 3.44Å; L15-L19 PolarHBondContact O-N 3.02Å; L16-L19 PolarHBondContact O-N 2.9Å; L19-T22 PolarHBondContact O-N 3.19Å; L19-Q23 HydrophobicContact CD1-CG 4.43Å; L19-Q23 HydrophobicContact CG-CG 4.26Å; L19-Q23 VanDerWaalsContact O-CG 3.29Å; L19-Q23 WeakPolarHBondContact O-CG 3.28Å; L19-Q23 PolarHBondContact O-N 3.49Å
20	L	72.2	Confident	73.5	Confident	121 Å²	121	106.3 Å²	106.3	63%	0.634	57%	0.57	S	S	*	*	H	α-helix	trans	-56.9	-46.1	-179.1	-152.8	73	0	0	0	115	L16 K24	L16-L20 WeakPolarHBondContact O-CB 3.47Å; L16-L20 PolarHBondContact O-N 3.3Å; L20-K24 PolarHBondContact O-N 3.29Å
21	P	66.7	Low	72.4	Confident	70 Å²	70	111.1 Å²	111.1	46%	0.455	59%	0.586	S	S	.	*	H	α-helix	trans	-71.9	-34	174.9	26	-32.9	0	0	0	112.3	A17 L18 Q23 K24 M25	A17-P21 WeakPolarHBondContact O-CD 3.2Å; A17-P21 WeakPolarHBondContact O-CG 3.36Å; L18-P21 WeakPolarHBondContact O-CD 3.31Å; L18-P21 WeakPolarHBondContact O-CG 3.48Å; P21-Q23 VanDerWaalsContact C-N 3.29Å; P21-Q23 PolarHBondContact O-N 2.87Å; P21-K24 PolarHBondContact O-N 2.87Å; P21-K24 VanDerWaalsContact O-N 3.08Å; P21-M25 PolarHBondContact O-N 3.35Å
22	T	69.4	Low	71.2	Confident	63 Å²	63	111.1 Å²	111.1	39%	0.387	59%	0.585	S	S	.	*	H	α-helix	trans	-62.7	-38.9	175.4	-52	0	0	0	0	110.9	L18 L19 K24 M25 L26	L18-T22 PolarHBondContact O-OG1 2.86Å; L19-T22 PolarHBondContact O-N 3.19Å; T22-K24 VanDerWaalsContact C-N 3.35Å; T22-K24 PolarHBondContact O-N 3.41Å; T22-M25 PolarHBondContact O-N 2.98Å; T22-L26 WeakPolarHBondContact O-CB 3.29Å; T22-L26 PolarHBondContact O-N 3.5Å
23	Q	63.5	Low	70.1	Confident	111 Å²	111	114.3 Å²	114.3	52%	0.519	59%	0.594	S	S	.	*	H	α-helix	trans	-65.8	-34.3	173.1	-67.7	-77.6	64	0	0	112.2	L19 P21 R27	L19-Q23 HydrophobicContact CD1-CG 4.43Å; L19-Q23 HydrophobicContact CG-CG 4.26Å; L19-Q23 VanDerWaalsContact O-CG 3.29Å; L19-Q23 WeakPolarHBondContact O-CG 3.28Å; L19-Q23 PolarHBondContact O-N 3.49Å; P21-Q23 VanDerWaalsContact C-N 3.29Å; P21-Q23 PolarHBondContact O-N 2.87Å; Q23-R27 WeakPolarHBondContact O-CA 2.89Å; Q23-R27 PolarHBondContact O-N 3.32Å; Q23-R27 WeakPolarHBondContact O-CB 3.46Å
24	K	65.9	Low	69.1	Low	170 Å²	170	113.5 Å²	113.5	74%	0.739	59%	0.589	S	S	*	*	H	α-helix	trans	-71.3	-34.6	174.6	-74	-169.2	178.6	-176.1	0	112.8	L20 P21 T22	L20-K24 PolarHBondContact O-N 3.29Å; P21-K24 PolarHBondContact O-N 2.87Å; P21-K24 VanDerWaalsContact O-N 3.08Å; T22-K24 VanDerWaalsContact C-N 3.35Å; T22-K24 PolarHBondContact O-N 3.41Å
25	M	64.1	Low	68.1	Low	169 Å²	169	115.8 Å²	115.8	83%	0.833	59%	0.594	S	S	*	*	H	α-helix	trans	-78.3	-34.9	179.6	-166	168.5	82.2	0	0	112.4	P21 T22	P21-M25 PolarHBondContact O-N 3.35Å; T22-M25 PolarHBondContact O-N 2.98Å
26	L	63.6	Low	67.1	Low	132 Å²	132	117.1 Å²	117.1	69%	0.691	60%	0.602	S	S	*	*	H	α-helix	trans	-90.6	-18.3	179.4	-154.9	94.7	0	0	0	113.1	T22 I28	T22-L26 WeakPolarHBondContact O-CB 3.29Å; T22-L26 PolarHBondContact O-N 3.5Å; L26-I28 PolarHBondContact O-N 3.33Å
27	R	60	Low	66.2	Low	178 Å²	178	121.8 Å²	121.8	67%	0.672	62%	0.623	S	S	*	*	S	Bend	trans	-69.4	92	164.3	-171.9	177.8	-157.8	-146.1	5.6	105.8	Q23	Q23-R27 WeakPolarHBondContact O-CA 2.89Å; Q23-R27 PolarHBondContact O-N 3.32Å; Q23-R27 WeakPolarHBondContact O-CB 3.46Å
28	I	62.8	Low	65.4	Low	142 Å²	142	124.6 Å²	124.6	73%	0.728	63%	0.627	S	S	*	*			trans	-31.5	118.7	158.3	-63.2	163.2	0	0	0	105.6	L26 N30	L26-I28 PolarHBondContact O-N 3.33Å; I28-N30 PolarHBondContact O-N 3.07Å
29	P	60.1	Low	64.7	Low	68 Å²	68	125 Å²	125	44%	0.442	63%	0.628	S	S	.	*			trans	-49.2	122.8	-176.8	18.7	-30.1	0	0	0	105.9	L31	P29-L31 PolarHBondContact O-N 3.4Å
30	N	61.1	Low	63.9	Low	81 Å²	81	126.5 Å²	126.5	43%	0.433	63%	0.634	S	S	.	*			trans	-48.5	135.4	-179	-169.5	16.7	0	0	0	106	I28 I32 D33 L34	I28-N30 PolarHBondContact O-N 3.07Å; N30-I32 CarbonylContact O-C 3.53Å; N30-I32 PolarHBondContact O-N 2.94Å; N30-D33 HydrophobicContact CB-CB 4.34Å; N30-D33 WeakPolarHBondContact O-CA 3.35Å; N30-D33 WeakPolarHBondContact O-CB 3.5Å; N30-D33 PolarHBondContact O-N 2.94Å; N30-L34 VanDerWaalsContact O-N 3.14Å; N30-L34 PolarHBondContact O-N 3Å
31	L	62.7	Low	63.4	Low	137 Å²	137	126.8 Å²	126.8	72%	0.717	63%	0.634	S	S	*	*	H	α-helix	trans	-53.8	-21.9	-176.7	-73.4	164.4	0	0	0	112	P29 K35	P29-L31 PolarHBondContact O-N 3.4Å; L31-K35 WeakPolarHBondContact O-CB 3.27Å; L31-K35 PolarHBondContact O-N 3.42Å; L31-K35 VanDerWaalsContact O-N 3.09Å
32	I	61	Low	63.2	Low	108 Å²	108	130.4 Å²	130.4	55%	0.554	65%	0.645	S	S	*	*	H	α-helix	trans	-69.9	-39	171.6	-62.8	163.4	0	0	0	113	N30 N36	N30-I32 CarbonylContact O-C 3.53Å; N30-I32 PolarHBondContact O-N 2.94Å; I32-N36 PolarHBondContact O-N 3.11Å; I32-N36 PolarHBondContact O-ND2 3.47Å
33	D	63.3	Low	62.8	Low	104 Å²	104	134.9 Å²	134.9	56%	0.556	66%	0.663	S	S	*	*	H	α-helix	trans	-72.1	-43.2	177.6	-157.3	-113.1	0	0	0	110.7	N30 K35 N36 M37	N30-D33 HydrophobicContact CB-CB 4.34Å; N30-D33 WeakPolarHBondContact O-CA 3.35Å; N30-D33 WeakPolarHBondContact O-CB 3.5Å; N30-D33 PolarHBondContact O-N 2.94Å; D33-K35 VanDerWaalsContact C-N 3.31Å; D33-K35 PolarHBondContact O-N 3.46Å; D33-N36 PolarHBondContact O-N 2.96Å; D33-M37 PolarHBondContact O-N 2.98Å
34	L	63.8	Low	62.7	Low	102 Å²	102	136.6 Å²	136.6	53%	0.534	67%	0.673	S	S	.	*	H	α-helix	trans	-66.1	-31.3	174.4	-175	63.5	0	0	0	113	N30 N36	N30-L34 VanDerWaalsContact O-N 3.14Å; N30-L34 PolarHBondContact O-N 3Å; L34-N36 VanDerWaalsContact C-N 3.3Å
35	K	63.9	Low	62.5	Low	175 Å²	175	134 Å²	134	76%	0.761	67%	0.668	S	S	*	*	H	α-helix	trans	-74.3	-20.7	177.7	177	176.6	165.6	-164.1	0	113.2	L31 D33	L31-K35 WeakPolarHBondContact O-CB 3.27Å; L31-K35 PolarHBondContact O-N 3.42Å; L31-K35 VanDerWaalsContact O-N 3.09Å; D33-K35 VanDerWaalsContact C-N 3.31Å; D33-K35 PolarHBondContact O-N 3.46Å
36	N	63.4	Low	62.4	Low	133 Å²	133	131.1 Å²	131.1	71%	0.711	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn	trans	-104	5.7	-178.8	-71.5	-54.8	0	0	0	113.1	I32 D33 L34	I32-N36 PolarHBondContact O-N 3.11Å; I32-N36 PolarHBondContact O-ND2 3.47Å; D33-N36 PolarHBondContact O-N 2.96Å; L34-N36 VanDerWaalsContact C-N 3.3Å
37	M	62.7	Low	62.3	Low	213 Å²	213	131 Å²	131	100%	1.049	65%	0.651	S	S	*	*			trans	-106.2	0	174.5	-137.7	177.2	-175.2	0	0	109.4	D33	D33-M37 PolarHBondContact O-N 2.98Å

Retrieved 37 of 37 residues in 42 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).