A0A087WUG5_HUMAN Loading...

SEM1 26S proteasome subunit

AlphaFold DB , UniProt , Accession A0A087WUG5, Species HUMAN (Homo sapiens, Human), Gene SEM1, Length 30 aa.

						>A0A087WUG5_HUMAN|A0A087WUG5|SEM1
MSEKKQPVDLGLLEEDDEFEEFPAEGQLYS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.7	Low	62.7	Low	242 Å²	242	143.8 Å²	143.8	100%	1.192	76%	0.755	S	S	*	*				0	85.9	0	-60.2	-59.7	-161.8	0	106.8	E3	M1-E3 PolarHBondContact O-N 3.43Å
2	S	55.5	Low	62.5	Low	123 Å²	123	140.5 Å²	140.5	86%	0.86	74%	0.738	S	S	*	*			trans	-57.4	129.6	-165.9	-70.7	0	0	0	113
3	E	59.2	Low	62.6	Low	174 Å²	174	135.8 Å²	135.8	81%	0.813	71%	0.713	S	S	*	*			trans	37.5	100.5	137.6	-140.1	124.1	88.4	0	115.9	M1 K5	M1-E3 PolarHBondContact O-N 3.43Å; E3-K5 PolarHBondContact O-N 2.95Å
4	K	64.5	Low	62.6	Low	198 Å²	198	137.8 Å²	137.8	86%	0.861	72%	0.717	S	S	*	*			trans	-55.4	107.4	163.9	-51.3	176.9	179	73.8	105.7	Q6	K4-Q6 VanDerWaalsContact O-N 3.08Å; K4-Q6 PolarHBondContact O-N 3.08Å
5	K	63.8	Low	62.6	Low	200 Å²	200	139.3 Å²	139.3	87%	0.87	72%	0.719	S	S	*	*			trans	-47.2	121.4	175.6	-67.5	-167.5	170.4	92.9	107.1	E3	E3-K5 PolarHBondContact O-N 2.95Å
6	Q	66.9	Low	62.8	Low	169 Å²	169	140.3 Å²	140.3	79%	0.79	73%	0.725	S	S	*	*			trans	-53.7	145.2	179	-66.9	-156.9	-73.2	0	108.8	K4 V8	K4-Q6 VanDerWaalsContact O-N 3.08Å; K4-Q6 PolarHBondContact O-N 3.08Å; Q6-V8 PolarHBondContact O-N 2.91Å
7	P	65.7	Low	63.1	Low	123 Å²	123	137.4 Å²	137.4	80%	0.799	71%	0.711	S	S	*	*			trans	-55.9	113.5	173.9	25	-32	0	0	106.4	D9	P7-D9 PolarHBondContact O-N 3.05Å
8	V	68.6	Low	63.3	Low	98 Å²	98	140 Å²	140	59%	0.594	72%	0.72	S	S	*	*			trans	-61.7	112.5	176.1	179.8	0	0	0	105	Q6 L10 L13	Q6-V8 PolarHBondContact O-N 2.91Å; V8-L10 PolarHBondContact O-N 3.02Å; V8-L13 HydrophobicContact CG1-CD1 3.8Å; V8-L13 HydrophobicContact CG1-CD2 4.05Å; V8-L13 HydrophobicContact CG1-CG 4.06Å
9	D	69.7	Low	63.6	Low	100 Å²	100	140.3 Å²	140.3	54%	0.535	72%	0.716	S	S	.	*			trans	-71.1	102	-179.4	-170.5	10.3	0	0	107.7	P7 G11 L12 L13	P7-D9 PolarHBondContact O-N 3.05Å; D9-G11 PolarHBondContact O-N 3.45Å; D9-L12 HydrophobicContact CB-CD1 3.95Å; D9-L12 PolarHBondContact O-N 3.35Å; D9-L12 WeakPolarHBondContact O-CB 3.47Å; D9-L12 HydrophobicContact CB-CG 4.02Å; D9-L12 HydrophobicContact CB-CB 4.44Å; D9-L13 PolarHBondContact O-N 3.19Å
10	L	62.9	Low	64	Low	119 Å²	119	142 Å²	142	62%	0.623	72%	0.72	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.6	-18.3	-173.5	-57.1	177.3	0	0	112.1	V8 L12 L13	V8-L10 PolarHBondContact O-N 3.02Å; L10-L12 VanDerWaalsContact C-N 3.33Å; L10-L13 HydrophobicContact CD2-CD1 3.52Å; L10-L13 WeakPolarHBondContact O-CB 3.44Å; L10-L13 PolarHBondContact O-N 2.95Å
11	G	62.5	Low	64.4	Low	36 Å²	36	144.1 Å²	144.1	37%	0.371	73%	0.728	S	S	.	*	T	Hydrogen-bonded Turn	trans	-76.2	-17.5	171.3	0	0	0	0	113.9	D9	D9-G11 PolarHBondContact O-N 3.45Å
12	L	60.5	Low	65.5	Low	104 Å²	104	140.7 Å²	140.7	55%	0.545	71%	0.706	S	S	.	*	T	Hydrogen-bonded Turn	trans	-86.3	-17.6	169	-62.4	178.9	0	0	112.1	D9 L10 E14	D9-L12 HydrophobicContact CB-CD1 3.95Å; D9-L12 PolarHBondContact O-N 3.35Å; D9-L12 WeakPolarHBondContact O-CB 3.47Å; D9-L12 HydrophobicContact CB-CG 4.02Å; D9-L12 HydrophobicContact CB-CB 4.44Å; L10-L12 VanDerWaalsContact C-N 3.33Å; L12-E14 PolarHBondContact O-N 3.5Å
13	L	63.6	Low	66.4	Low	80 Å²	80	137 Å²	137	42%	0.419	68%	0.68	S	S	.	*	T	Hydrogen-bonded Turn	trans	-78.1	-4.7	169.1	-56.7	-179	0	0	112	V8 D9 L10 D17	V8-L13 HydrophobicContact CG1-CD1 3.8Å; V8-L13 HydrophobicContact CG1-CD2 4.05Å; V8-L13 HydrophobicContact CG1-CG 4.06Å; D9-L13 PolarHBondContact O-N 3.19Å; L10-L13 HydrophobicContact CD2-CD1 3.52Å; L10-L13 WeakPolarHBondContact O-CB 3.44Å; L10-L13 PolarHBondContact O-N 2.95Å; L13-D17 WeakPolarHBondContact O-CB 2.88Å
14	E	62	Low	67.2	Low	163 Å²	163	131.7 Å²	131.7	76%	0.762	67%	0.665	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.2	-13.4	175.6	-66.9	178.3	-169.8	0	112.1	L12	L12-E14 PolarHBondContact O-N 3.5Å
15	E	63.1	Low	67.6	Low	161 Å²	161	131.6 Å²	131.6	75%	0.752	67%	0.668	S	S	*	*	T	Hydrogen-bonded Turn	trans	-107.2	-25.3	-177.2	-63	-178.5	172.2	0	113.8
16	D	66.4	Low	67.8	Low	154 Å²	154	125.5 Å²	125.5	82%	0.824	66%	0.662	S	S	*	*	S	Bend	trans	-103.4	-1.1	175.8	-83.3	-22.6	0	0	113.5
17	D	67	Low	67.8	Low	91 Å²	91	124 Å²	124	49%	0.487	66%	0.655	S	S	.	*			trans	-108.8	39.3	-179.1	-141.4	39	0	0	111.4	L13 F19	L13-D17 WeakPolarHBondContact O-CB 2.88Å; D17-F19 PolarHBondContact O-N 3.4Å; D17-F19 WeakPolarHBondContact OD1-CD2 3.46Å; D17-F19 WeakPolarHBondContact OD1-CE2 2.92Å; D17-F19 WeakPolarHBondContact OD2-CD2 2.86Å
18	E	66	Low	68	Low	185 Å²	185	123.2 Å²	123.2	86%	0.864	64%	0.643	S	S	*	*			trans	-68.1	67.2	150.4	-151.6	172.2	-135.9	0	106.7	E20	E18-E20 PolarHBondContact O-N 3.04Å
19	F	70	Confident	68	Low	146 Å²	146	128.8 Å²	128.8	64%	0.64	66%	0.655	S	S	*	*			trans	-52.6	116.8	178.8	-113.7	-76.3	0	0	107.1	D17 E21 F22	D17-F19 PolarHBondContact O-N 3.4Å; D17-F19 WeakPolarHBondContact OD1-CD2 3.46Å; D17-F19 WeakPolarHBondContact OD1-CE2 2.92Å; D17-F19 WeakPolarHBondContact OD2-CD2 2.86Å; F19-E21 PolarHBondContact O-N 2.97Å; F19-F22 HydrophobicContact CE1-CE2 4.44Å
20	E	70.9	Confident	67.7	Low	173 Å²	173	132.9 Å²	132.9	81%	0.808	69%	0.691	S	S	*	*			trans	-55.8	116	167.4	-78	-176.4	175.7	0	106.6	E18 F22	E18-E20 PolarHBondContact O-N 3.04Å; E20-F22 PolarHBondContact O-N 2.98Å
21	E	72.8	Confident	68	Low	188 Å²	188	133.6 Å²	133.6	88%	0.879	70%	0.695	S	S	*	*			trans	-52.6	115.2	178.5	-170.2	172.5	-147	0	107.2	F19 P23	F19-E21 PolarHBondContact O-N 2.97Å; E21-P23 WeakPolarHBondContact O-CD 3.44Å
22	F	73.3	Confident	68.2	Low	169 Å²	169	138.7 Å²	138.7	74%	0.741	71%	0.712	S	S	*	*	P	Polyproline II helix	trans	-49.3	121.1	-173.1	-102.6	-90.6	0	0	108.6	F19 E20 A24	F19-F22 HydrophobicContact CE1-CE2 4.44Å; E20-F22 PolarHBondContact O-N 2.98Å; F22-A24 PolarHBondContact O-N 2.98Å
23	P	75.4	Confident	68.7	Low	46 Å²	46	140.6 Å²	140.6	30%	0.299	72%	0.721	S	S	.	*	P	Polyproline II helix	trans	-55.5	122.9	179.5	14.1	-25.3	0	0	108	E21 E25 Q27 L28	E21-P23 WeakPolarHBondContact O-CD 3.44Å; P23-E25 PolarHBondContact O-N 2.84Å; P23-Q27 HydrophobicContact CB-CB 3.71Å; P23-L28 HydrophobicContact CB-CD2 4.14Å; P23-L28 HydrophobicContact CB-CG 4.07Å; P23-L28 HydrophobicContact CG-CD1 4.1Å; P23-L28 HydrophobicContact CG-CD2 3.38Å; P23-L28 HydrophobicContact CG-CG 3.63Å
24	A	76.1	Confident	69	Low	62 Å²	62	144.2 Å²	144.2	51%	0.512	74%	0.739	S	S	.	*	P	Polyproline II helix	trans	-51.6	141.2	174	0	0	0	0	107.9	F22 G26 Q27	F22-A24 PolarHBondContact O-N 2.98Å; A24-G26 CarbonylContact O-C 3.58Å; A24-G26 PolarHBondContact O-N 2.81Å; A24-Q27 PolarHBondContact O-N 2.64Å
25	E	72.2	Confident	69.4	Low	197 Å²	197	143 Å²	143	92%	0.921	74%	0.738	S	S	*	*	T	Hydrogen-bonded Turn	trans	-48.8	-10.7	-163.7	-61.1	180	165.6	0	116.7	P23	P23-E25 PolarHBondContact O-N 2.84Å
26	G	68.3	Low	69.8	Low	71 Å²	71	141.8 Å²	141.8	73%	0.732	74%	0.737	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.2	2.3	172.3	0	0	0	0	117.1	A24	A24-G26 CarbonylContact O-C 3.58Å; A24-G26 PolarHBondContact O-N 2.81Å
27	Q	67.4	Low	70.1	Confident	137 Å²	137	140.9 Å²	140.9	64%	0.64	73%	0.73	S	S	*	*	S	Bend	trans	-101.2	-9.7	-178.2	-64.8	177.1	49.7	0	113.9	P23 A24	P23-Q27 HydrophobicContact CB-CB 3.71Å; A24-Q27 PolarHBondContact O-N 2.64Å
28	L	70.4	Confident	70.3	Confident	108 Å²	108	144.8 Å²	144.8	57%	0.565	75%	0.749	S	S	*	*	S	Bend	trans	-87.8	-6.9	-177.3	-73.3	176.2	0	0	114.9	P23	P23-L28 HydrophobicContact CB-CD2 4.14Å; P23-L28 HydrophobicContact CB-CG 4.07Å; P23-L28 HydrophobicContact CG-CD1 4.1Å; P23-L28 HydrophobicContact CG-CD2 3.38Å; P23-L28 HydrophobicContact CG-CG 3.63Å
29	Y	67	Low	70.7	Confident	215 Å²	215	141.4 Å²	141.4	84%	0.843	74%	0.74	S	S	*	*			trans	-144.8	95.2	-179	-61.4	-77.6	0	0	110.6
30	S	64.4	Low	70.7	Confident	185 Å²	185	141 Å²	141	100%	1.294	75%	0.749	S	S	*	*			trans	-146.7	0	160	61.6	0	0	0	109.6

Retrieved 30 of 30 residues in 27.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).