A0A087WUJ8_HUMAN Loading...

Interferon alpha inducible protein 27

AlphaFold DB , UniProt , Accession A0A087WUJ8, Species HUMAN (Homo sapiens, Human), Gene IFI27, Length 96 aa.

						>A0A087WUJ8_HUMAN|A0A087WUJ8|IFI27
MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAMAAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41.7	Very low	43.1	Very low	235 Å²	235	104.7 Å²	104.7	100%	1.158	64%	0.641	S	S	*	*				0	39.7	0	-150.8	156.8	173.5	0	0	110.2
2	E	38.9	Very low	43.5	Very low	161 Å²	161	103.4 Å²	103.4	75%	0.752	63%	0.633	S	S	*	*			trans	-120	-23.3	-169.2	-61.8	-118.7	92.5	0	0	112.1	L6	E2-L6 WeakPolarHBondContact O-CD1 3.47Å
3	A	37.4	Very low	43.7	Very low	81 Å²	81	101.5 Å²	101.5	67%	0.669	63%	0.627	S	S	*	*	H	α-helix	trans	-74	-29.2	-178.8	0	0	0	0	0	113.9	A5 L6 T7	A3-A5 VanDerWaalsContact C-N 3.31Å; A3-A5 PolarHBondContact O-N 3.44Å; A3-L6 PolarHBondContact O-N 3.34Å; A3-T7 PolarHBondContact O-N 3.47Å
4	S	43.5	Very low	43.8	Very low	95 Å²	95	100.8 Å²	100.8	66%	0.664	62%	0.621	S	S	*	*	H	α-helix	trans	-71.6	-23.7	179	-57.3	0	0	0	0	113.2	T7 S8	S4-T7 WeakPolarHBondContact O-CG2 2.99Å; S4-S8 PolarHBondContact O-N 2.86Å
5	A	41.3	Very low	44.1	Very low	59 Å²	59	97.7 Å²	97.7	49%	0.488	61%	0.61	S	S	.	*	H	α-helix	trans	-77.8	-35.1	177.2	0	0	0	0	0	112.2	A3 S9	A3-A5 VanDerWaalsContact C-N 3.31Å; A3-A5 PolarHBondContact O-N 3.44Å; A5-S9 WeakPolarHBondContact O-CB 3.46Å; A5-S9 PolarHBondContact O-N 3.5Å; A5-S9 VanDerWaalsContact O-N 3.13Å; A5-S9 PolarHBondContact O-OG 2.99Å
6	L	45.4	Very low	44.1	Very low	132 Å²	132	101.8 Å²	101.8	69%	0.691	62%	0.616	S	S	*	*	H	α-helix	trans	-68.3	-38.6	175.6	-88.5	88.3	0	0	0	112.2	E2 A3 S9 A10	E2-L6 WeakPolarHBondContact O-CD1 3.47Å; A3-L6 PolarHBondContact O-N 3.34Å; L6-S9 PolarHBondContact O-N 3.45Å; L6-A10 WeakPolarHBondContact O-CB 3.44Å; L6-A10 PolarHBondContact O-N 3.25Å
7	T	47.7	Very low	44.5	Very low	95 Å²	95	101.8 Å²	101.8	58%	0.583	62%	0.616	S	S	*	*	H	α-helix	trans	-68.7	-36.3	179.5	-150.7	0	0	0	0	112.3	A3 S4 V11	A3-T7 PolarHBondContact O-N 3.47Å; S4-T7 WeakPolarHBondContact O-CG2 2.99Å; T7-V11 PolarHBondContact O-N 3.49Å; T7-V11 VanDerWaalsContact O-N 3.15Å
8	S	42.3	Very low	44.8	Very low	69 Å²	69	101.4 Å²	101.4	48%	0.483	61%	0.614	S	S	.	*	H	α-helix	trans	-72.3	-32.3	176.6	-161.6	0	0	0	0	112.9	S4 V11 T12	S4-S8 PolarHBondContact O-N 2.86Å; S8-V11 WeakPolarHBondContact O-CG1 3.43Å; S8-T12 WeakPolarHBondContact O-CB 3.49Å; S8-T12 PolarHBondContact O-N 3.23Å; S8-T12 PolarHBondContact O-OG1 3.13Å
9	S	43.3	Very low	44.8	Very low	76 Å²	76	107.3 Å²	107.3	53%	0.531	62%	0.624	S	S	.	*	H	α-helix	trans	-74	-34.2	176.1	-59.9	0	0	0	0	112.7	A5 L6 S13	A5-S9 WeakPolarHBondContact O-CB 3.46Å; A5-S9 PolarHBondContact O-N 3.5Å; A5-S9 VanDerWaalsContact O-N 3.13Å; A5-S9 PolarHBondContact O-OG 2.99Å; L6-S9 PolarHBondContact O-N 3.45Å; S9-S13 PolarHBondContact O-N 3.05Å; S9-S13 PolarHBondContact O-OG 3.35Å; S9-S13 VanDerWaalsContact O-OG 3.07Å
10	A	46.7	Very low	44.9	Very low	57 Å²	57	107.7 Å²	107.7	47%	0.471	63%	0.628	S	S	.	*	H	α-helix	trans	-72.7	-42.7	177.4	0	0	0	0	0	112.3	L6 T12 S13 V14	L6-A10 WeakPolarHBondContact O-CB 3.44Å; L6-A10 PolarHBondContact O-N 3.25Å; A10-T12 VanDerWaalsContact C-N 3.33Å; A10-T12 PolarHBondContact O-N 3.07Å; A10-S13 PolarHBondContact O-N 3.39Å; A10-V14 PolarHBondContact O-N 3.49Å
11	V	46.2	Very low	45	Very low	92 Å²	92	106.3 Å²	106.3	56%	0.558	63%	0.629	S	S	*	*	H	α-helix	trans	-67.2	-35	179.6	77.8	0	0	0	0	111.9	T7 S8 V14 A15	T7-V11 PolarHBondContact O-N 3.49Å; T7-V11 VanDerWaalsContact O-N 3.15Å; S8-V11 WeakPolarHBondContact O-CG1 3.43Å; V11-V14 PolarHBondContact O-N 3.3Å; V11-A15 WeakPolarHBondContact O-CB 3.42Å; V11-A15 PolarHBondContact O-N 3.43Å
12	T	47	Very low	45.3	Very low	89 Å²	89	100.2 Å²	100.2	55%	0.546	61%	0.609	S	S	.	*	H	α-helix	trans	-70.7	-36.6	176.8	-53.9	0	0	0	0	111.6	S8 A10 A15 K16	S8-T12 WeakPolarHBondContact O-CB 3.49Å; S8-T12 PolarHBondContact O-N 3.23Å; S8-T12 PolarHBondContact O-OG1 3.13Å; A10-T12 VanDerWaalsContact C-N 3.33Å; A10-T12 PolarHBondContact O-N 3.07Å; T12-A15 PolarHBondContact O-N 3.22Å; T12-K16 WeakPolarHBondContact O-CB 3.46Å; T12-K16 PolarHBondContact O-N 2.86Å
13	S	46.5	Very low	45.9	Very low	79 Å²	79	95.6 Å²	95.6	55%	0.552	61%	0.605	S	S	*	*	H	α-helix	trans	-66.6	-42	174	-69.2	0	0	0	0	112.3	S9 A10 K16 V17	S9-S13 PolarHBondContact O-N 3.05Å; S9-S13 PolarHBondContact O-OG 3.35Å; S9-S13 VanDerWaalsContact O-OG 3.07Å; A10-S13 PolarHBondContact O-N 3.39Å; S13-K16 PolarHBondContact O-N 3.48Å; S13-V17 WeakPolarHBondContact O-CG2 3.45Å; S13-V17 PolarHBondContact O-N 2.78Å
14	V	45.8	Very low	46	Very low	91 Å²	91	95.4 Å²	95.4	55%	0.552	60%	0.598	S	S	*	*	H	α-helix	trans	-64.3	-42.7	174.9	163.4	0	0	0	0	111.4	A10 V11 K16 V17 V18	A10-V14 PolarHBondContact O-N 3.49Å; V11-V14 PolarHBondContact O-N 3.3Å; V14-K16 VanDerWaalsContact C-N 3.32Å; V14-K16 PolarHBondContact O-N 3.35Å; V14-V17 PolarHBondContact O-N 3.45Å; V14-V18 WeakPolarHBondContact O-CG2 3.45Å; V14-V18 PolarHBondContact O-N 3.31Å
15	A	48.3	Very low	46.1	Very low	54 Å²	54	94.4 Å²	94.4	45%	0.446	60%	0.596	S	S	.	*	H	α-helix	trans	-64.2	-35.7	177.5	0	0	0	0	0	112.7	V11 T12 R19	V11-A15 WeakPolarHBondContact O-CB 3.42Å; V11-A15 PolarHBondContact O-N 3.43Å; T12-A15 PolarHBondContact O-N 3.22Å; A15-R19 WeakPolarHBondContact O-CB 3.16Å; A15-R19 WeakPolarHBondContact O-CG 3.12Å; A15-R19 PolarHBondContact O-N 3.07Å
16	K	43.9	Very low	46.4	Very low	164 Å²	164	98.3 Å²	98.3	71%	0.713	61%	0.614	S	S	*	*	H	α-helix	trans	-70.6	-38.8	176.1	-161.4	179.8	-179.5	84.8	0	112	T12 S13 V14 R19 V20	T12-K16 WeakPolarHBondContact O-CB 3.46Å; T12-K16 PolarHBondContact O-N 2.86Å; S13-K16 PolarHBondContact O-N 3.48Å; V14-K16 VanDerWaalsContact C-N 3.32Å; V14-K16 PolarHBondContact O-N 3.35Å; K16-R19 PolarHBondContact O-N 2.89Å; K16-V20 PolarHBondContact O-N 2.72Å
17	V	49.8	Very low	46.3	Very low	102 Å²	102	95.7 Å²	95.7	62%	0.618	60%	0.603	S	S	*	*	H	α-helix	trans	-62.5	-44.2	173.6	159.9	0	0	0	0	111.5	S13 V14 V20 A21	S13-V17 WeakPolarHBondContact O-CG2 3.45Å; S13-V17 PolarHBondContact O-N 2.78Å; V14-V17 PolarHBondContact O-N 3.45Å; V17-V20 PolarHBondContact O-N 3.07Å; V17-A21 PolarHBondContact O-N 3.41Å
18	V	50.1	Low	46.3	Very low	95 Å²	95	97.7 Å²	97.7	58%	0.576	61%	0.609	S	S	*	*	H	α-helix	trans	-64.6	-40.8	177.2	164.4	0	0	0	0	112	V14 V20 A21 S22	V14-V18 WeakPolarHBondContact O-CG2 3.45Å; V14-V18 PolarHBondContact O-N 3.31Å; V18-V20 VanDerWaalsContact C-N 3.33Å; V18-V20 PolarHBondContact O-N 3.22Å; V18-A21 PolarHBondContact O-N 3.15Å; V18-S22 PolarHBondContact O-N 3.41Å
19	R	46.4	Very low	46.9	Very low	212 Å²	212	99.3 Å²	99.3	80%	0.8	62%	0.618	S	S	*	*	H	α-helix	trans	-64.7	-34.3	175.9	-82.3	-88.9	-178.5	96.4	-2.4	112.7	A15 K16	A15-R19 WeakPolarHBondContact O-CB 3.16Å; A15-R19 WeakPolarHBondContact O-CG 3.12Å; A15-R19 PolarHBondContact O-N 3.07Å; K16-R19 PolarHBondContact O-N 2.89Å
20	V	46.6	Very low	47.2	Very low	116 Å²	116	102 Å²	102	70%	0.703	63%	0.626	S	S	*	*	H	α-helix	trans	-69.4	-32.9	176.3	128.9	0	0	0	0	112.2	K16 V17 V18	K16-V20 PolarHBondContact O-N 2.72Å; V17-V20 PolarHBondContact O-N 3.07Å; V18-V20 VanDerWaalsContact C-N 3.33Å; V18-V20 PolarHBondContact O-N 3.22Å
21	A	47.1	Very low	47.5	Very low	79 Å²	79	101.3 Å²	101.3	65%	0.653	62%	0.62	S	S	*	*	H	α-helix	trans	-75.5	-25.9	-179.2	0	0	0	0	0	113.5	V17 V18 G23	V17-A21 PolarHBondContact O-N 3.41Å; V18-A21 PolarHBondContact O-N 3.15Å; A21-G23 VanDerWaalsContact C-N 3.29Å; A21-G23 PolarHBondContact O-N 2.79Å
22	S	47.7	Very low	48	Very low	107 Å²	107	103.5 Å²	103.5	75%	0.748	62%	0.618	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.7	-7.6	-179.1	-167.6	0	0	0	0	114.1	V18	V18-S22 PolarHBondContact O-N 3.41Å
23	G	50	Low	48.4	Very low	64 Å²	64	104.3 Å²	104.3	66%	0.66	62%	0.618	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84	-15.9	-173.5	0	0	0	0	0	116	A21	A21-G23 VanDerWaalsContact C-N 3.29Å; A21-G23 PolarHBondContact O-N 2.79Å
24	S	40	Very low	48.9	Very low	76 Å²	76	102.8 Å²	102.8	53%	0.531	61%	0.61	S	S	.	*			trans	-112.6	72.3	-172.2	-58.6	0	0	0	0	111.7
25	A	45.6	Very low	49.6	Very low	75 Å²	75	102.3 Å²	102.3	62%	0.62	61%	0.608	S	S	*	*			trans	-57.6	132.1	147.3	0	0	0	0	0	107.1
26	V	47.6	Very low	50.1	Low	141 Å²	141	104.7 Å²	104.7	86%	0.855	62%	0.616	S	S	*	*			trans	93.3	53.1	-176.7	-165.3	0	0	0	0	115.5
27	V	44.3	Very low	51	Low	77 Å²	77	101 Å²	101	47%	0.467	61%	0.607	S	S	.	*	S	Bend	trans	-131	128.4	150	-74.7	0	0	0	0	109.7	A31	V27-A31 HydrophobicContact CB-CB 4.23Å; V27-A31 HydrophobicContact CG2-CB 4.47Å
28	L	46.7	Very low	51.7	Low	136 Å²	136	101.4 Å²	101.4	71%	0.712	61%	0.605	S	S	*	*			trans	-21.4	142.6	179.5	-117.5	59.1	0	0	0	115.8	L30 A31 R32	L28-L30 PolarHBondContact O-N 3.24Å; L28-A31 HydrophobicContact CB-CB 4.43Å; L28-A31 WeakPolarHBondContact O-CA 3.16Å; L28-A31 WeakPolarHBondContact O-CB 3.46Å; L28-A31 PolarHBondContact O-N 3.44Å; L28-R32 PolarHBondContact O-N 3.43Å
29	P	54.7	Low	52.4	Low	104 Å²	104	98.7 Å²	98.7	68%	0.675	60%	0.597	S	S	*	*	H	α-helix	trans	-52.2	-33.3	-178.3	19.6	-32.6	0	0	0	113.8	I33	P29-I33 WeakPolarHBondContact O-CD1 3.29Å; P29-I33 VanDerWaalsContact O-CG1 3.28Å; P29-I33 WeakPolarHBondContact O-CG1 3.48Å; P29-I33 PolarHBondContact O-N 2.95Å; P29-I33 VanDerWaalsContact O-N 3.12Å
30	L	51.1	Low	53	Low	133 Å²	133	90.2 Å²	90.2	70%	0.696	58%	0.575	S	S	*	*	H	α-helix	trans	-69.7	-39.4	175.9	-169.4	62.1	0	0	0	113.2	L28 I33 A34	L28-L30 PolarHBondContact O-N 3.24Å; L30-I33 PolarHBondContact O-N 3.05Å; L30-A34 PolarHBondContact O-N 3.48Å; L30-A34 VanDerWaalsContact O-N 3.09Å
31	A	52.8	Low	53.6	Low	41 Å²	41	89.3 Å²	89.3	34%	0.339	57%	0.57	S	S	.	*	H	α-helix	trans	-69.5	-36.4	176.8	0	0	0	0	0	111.5	V27 L28 A34 T35	V27-A31 HydrophobicContact CB-CB 4.23Å; V27-A31 HydrophobicContact CG2-CB 4.47Å; L28-A31 HydrophobicContact CB-CB 4.43Å; L28-A31 WeakPolarHBondContact O-CA 3.16Å; L28-A31 WeakPolarHBondContact O-CB 3.46Å; L28-A31 PolarHBondContact O-N 3.44Å; A31-A34 PolarHBondContact O-N 2.86Å; A31-T35 WeakPolarHBondContact O-CG2 3.47Å; A31-T35 PolarHBondContact O-N 3.33Å; A31-T35 PolarHBondContact O-OG1 3.31Å
32	R	55.5	Low	54.1	Low	139 Å²	139	90 Å²	90	53%	0.525	57%	0.566	S	S	.	*	H	α-helix	trans	-60.9	-48.7	171.8	-87.8	-134.8	-177.4	144	-1.9	112.2	L28 A34 T35 V36	L28-R32 PolarHBondContact O-N 3.43Å; R32-A34 VanDerWaalsContact C-N 3.3Å; R32-A34 PolarHBondContact O-N 2.76Å; R32-T35 WeakPolarHBondContact CA-OG1 3.22Å; R32-T35 PolarHBondContact O-N 3.49Å; R32-T35 VanDerWaalsContact O-N 3.16Å; R32-T35 PolarHBondContact O-OG1 2.82Å; R32-V36 VanDerWaalsContact O-CG2 3.31Å; R32-V36 WeakPolarHBondContact O-CG2 3.44Å; R32-V36 PolarHBondContact O-N 3.41Å
33	I	56.5	Low	54.6	Low	105 Å²	105	87.1 Å²	87.1	54%	0.538	55%	0.548	S	S	.	.	H	α-helix	trans	-57.7	-47.3	177.9	-66.8	162.7	0	0	0	109.9	P29 L30 T35 V36 V37	P29-I33 WeakPolarHBondContact O-CD1 3.29Å; P29-I33 VanDerWaalsContact O-CG1 3.28Å; P29-I33 WeakPolarHBondContact O-CG1 3.48Å; P29-I33 PolarHBondContact O-N 2.95Å; P29-I33 VanDerWaalsContact O-N 3.12Å; L30-I33 PolarHBondContact O-N 3.05Å; I33-T35 VanDerWaalsContact C-N 3.34Å; I33-T35 PolarHBondContact O-N 3.45Å; I33-V36 PolarHBondContact O-N 3.17Å; I33-V37 HydrophobicContact CG2-CG2 4.21Å; I33-V37 WeakPolarHBondContact O-CB 3.08Å; I33-V37 VanDerWaalsContact O-CG2 3.24Å; I33-V37 WeakPolarHBondContact O-CG2 3.35Å; I33-V37 PolarHBondContact O-N 3.49Å
34	A	57.3	Low	54.7	Low	47 Å²	47	90.3 Å²	90.3	39%	0.388	55%	0.547	S	S	.	.	H	α-helix	trans	-58	-45.1	177	0	0	0	0	0	112.1	L30 A31 R32 V36 V37 I38	L30-A34 PolarHBondContact O-N 3.48Å; L30-A34 VanDerWaalsContact O-N 3.09Å; A31-A34 PolarHBondContact O-N 2.86Å; R32-A34 VanDerWaalsContact C-N 3.3Å; R32-A34 PolarHBondContact O-N 2.76Å; A34-V36 PolarHBondContact O-N 2.86Å; A34-V37 PolarHBondContact O-N 3.43Å; A34-I38 WeakPolarHBondContact O-CB 3.43Å; A34-I38 WeakPolarHBondContact O-CD1 3.47Å; A34-I38 WeakPolarHBondContact O-CG1 3.46Å; A34-I38 PolarHBondContact O-N 3.05Å
35	T	59.3	Low	55.5	Low	82 Å²	82	89.6 Å²	89.6	50%	0.503	55%	0.546	S	S	.	.	H	α-helix	trans	-68.3	-34.5	179.1	62.2	0	0	0	0	113.6	A31 R32 I33 G39	A31-T35 WeakPolarHBondContact O-CG2 3.47Å; A31-T35 PolarHBondContact O-N 3.33Å; A31-T35 PolarHBondContact O-OG1 3.31Å; R32-T35 WeakPolarHBondContact CA-OG1 3.22Å; R32-T35 PolarHBondContact O-N 3.49Å; R32-T35 VanDerWaalsContact O-N 3.16Å; R32-T35 PolarHBondContact O-OG1 2.82Å; I33-T35 VanDerWaalsContact C-N 3.34Å; I33-T35 PolarHBondContact O-N 3.45Å; T35-G39 PolarHBondContact O-N 3.01Å
36	V	59.4	Low	56	Low	103 Å²	103	88 Å²	88	62%	0.624	53%	0.533	S	S	*	.	H	α-helix	trans	-71.8	-38.9	176.3	172.3	0	0	0	0	110.7	R32 I33 A34 G40	R32-V36 VanDerWaalsContact O-CG2 3.31Å; R32-V36 WeakPolarHBondContact O-CG2 3.44Å; R32-V36 PolarHBondContact O-N 3.41Å; I33-V36 PolarHBondContact O-N 3.17Å; A34-V36 PolarHBondContact O-N 2.86Å; V36-G40 WeakPolarHBondContact O-CA 3.49Å; V36-G40 PolarHBondContact O-N 3.42Å
37	V	63	Low	56.2	Low	86 Å²	86	84.9 Å²	84.9	52%	0.521	51%	0.514	S	S	.	.	H	α-helix	trans	-65.7	-47.9	175.1	172.8	0	0	0	0	110.2	I33 A34 G39 G40 V41	I33-V37 HydrophobicContact CG2-CG2 4.21Å; I33-V37 WeakPolarHBondContact O-CB 3.08Å; I33-V37 VanDerWaalsContact O-CG2 3.24Å; I33-V37 WeakPolarHBondContact O-CG2 3.35Å; I33-V37 PolarHBondContact O-N 3.49Å; A34-V37 PolarHBondContact O-N 3.43Å; V37-G39 PolarHBondContact O-N 3.04Å; V37-G40 PolarHBondContact O-N 3.37Å; V37-V41 VanDerWaalsContact O-CG2 3.25Å; V37-V41 WeakPolarHBondContact O-CG2 3.43Å; V37-V41 PolarHBondContact O-N 3.04Å
38	I	64.7	Low	56.6	Low	111 Å²	111	84.7 Å²	84.7	57%	0.569	52%	0.515	S	S	*	.	H	α-helix	trans	-63.2	-44.6	177.6	-65.2	163.4	0	0	0	110.4	A34 G40 V41 V42	A34-I38 WeakPolarHBondContact O-CB 3.43Å; A34-I38 WeakPolarHBondContact O-CD1 3.47Å; A34-I38 WeakPolarHBondContact O-CG1 3.46Å; A34-I38 PolarHBondContact O-N 3.05Å; I38-G40 PolarHBondContact O-N 3.31Å; I38-V41 PolarHBondContact O-N 3.07Å; I38-V42 VanDerWaalsContact O-CG2 3.26Å; I38-V42 WeakPolarHBondContact O-CG2 3.28Å; I38-V42 PolarHBondContact O-N 3.42Å
39	G	63.5	Low	57.1	Low	39 Å²	39	85 Å²	85	40%	0.402	51%	0.514	S	S	.	.	H	α-helix	trans	-64.5	-37.4	176.4	0	0	0	0	0	113.3	T35 V37 V42 A43	T35-G39 PolarHBondContact O-N 3.01Å; V37-G39 PolarHBondContact O-N 3.04Å; G39-V42 PolarHBondContact O-N 2.99Å; G39-A43 WeakPolarHBondContact O-CB 2.83Å; G39-A43 PolarHBondContact O-N 3.15Å
40	G	58.5	Low	57	Low	34 Å²	34	84.4 Å²	84.4	35%	0.351	51%	0.508	S	S	.	.	H	α-helix	trans	-69.2	-40.2	176.9	0	0	0	0	0	112.9	V36 V37 I38 A43 M44	V36-G40 WeakPolarHBondContact O-CA 3.49Å; V36-G40 PolarHBondContact O-N 3.42Å; V37-G40 PolarHBondContact O-N 3.37Å; I38-G40 PolarHBondContact O-N 3.31Å; G40-A43 PolarHBondContact O-N 3.39Å; G40-M44 PolarHBondContact O-N 2.89Å
41	V	59.9	Low	57.1	Low	96 Å²	96	82.8 Å²	82.8	58%	0.582	50%	0.5	S	S	*	.	H	α-helix	trans	-65.7	-41.7	174	173.7	0	0	0	0	110.7	V37 I38 A43 M44 A45	V37-V41 VanDerWaalsContact O-CG2 3.25Å; V37-V41 WeakPolarHBondContact O-CG2 3.43Å; V37-V41 PolarHBondContact O-N 3.04Å; I38-V41 PolarHBondContact O-N 3.07Å; V41-A43 VanDerWaalsContact C-N 3.34Å; V41-A43 PolarHBondContact O-N 2.92Å; V41-M44 PolarHBondContact O-N 2.92Å; V41-A45 PolarHBondContact O-N 3.47Å
42	V	58.8	Low	56.9	Low	94 Å²	94	82.8 Å²	82.8	57%	0.57	50%	0.497	S	S	*	.	H	α-helix	trans	-64	-39.4	174.9	171.7	0	0	0	0	111.3	I38 G39 A45 A46	I38-V42 VanDerWaalsContact O-CG2 3.26Å; I38-V42 WeakPolarHBondContact O-CG2 3.28Å; I38-V42 PolarHBondContact O-N 3.42Å; G39-V42 PolarHBondContact O-N 2.99Å; V42-A45 PolarHBondContact O-N 3.46Å; V42-A46 WeakPolarHBondContact O-CB 3.37Å; V42-A46 PolarHBondContact O-N 3.29Å
43	A	56.3	Low	56.8	Low	47 Å²	47	80.1 Å²	80.1	39%	0.388	51%	0.505	S	S	.	.	H	α-helix	trans	-64.4	-43.8	174.6	0	0	0	0	0	111.9	G39 G40 V41 A45 A46 V47	G39-A43 WeakPolarHBondContact O-CB 2.83Å; G39-A43 PolarHBondContact O-N 3.15Å; G40-A43 PolarHBondContact O-N 3.39Å; V41-A43 VanDerWaalsContact C-N 3.34Å; V41-A43 PolarHBondContact O-N 2.92Å; A43-A45 VanDerWaalsContact C-N 3.29Å; A43-A45 PolarHBondContact O-N 2.97Å; A43-A46 PolarHBondContact O-N 3.34Å; A43-A46 VanDerWaalsContact O-N 3.15Å; A43-V47 VanDerWaalsContact O-CG2 3.28Å; A43-V47 WeakPolarHBondContact O-CG2 3.38Å; A43-V47 PolarHBondContact O-N 2.93Å
44	M	53.6	Low	56.5	Low	130 Å²	130	82.7 Å²	82.7	64%	0.64	52%	0.516	S	S	*	.	H	α-helix	trans	-68.9	-22.3	176.2	-78.1	-65.4	117.3	0	0	113.9	G40 V41 V47 P48	G40-M44 PolarHBondContact O-N 2.89Å; V41-M44 PolarHBondContact O-N 2.92Å; M44-V47 HydrophobicContact CE-CG2 4.12Å; M44-P48 WeakPolarHBondContact O-CD 3.4Å; M44-P48 WeakPolarHBondContact O-CG 3.31Å
45	A	57.1	Low	56.1	Low	61 Å²	61	82.7 Å²	82.7	50%	0.504	52%	0.521	S	S	.	.	H	α-helix	trans	-81	-30.2	169.8	0	0	0	0	0	112.3	V41 V42 A43 M49	V41-A45 PolarHBondContact O-N 3.47Å; V42-A45 PolarHBondContact O-N 3.46Å; A43-A45 VanDerWaalsContact C-N 3.29Å; A43-A45 PolarHBondContact O-N 2.97Å; A45-M49 WeakPolarHBondContact O-CG 3.47Å
46	A	54.5	Low	55.6	Low	41 Å²	41	87.1 Å²	87.1	34%	0.339	53%	0.534	S	S	.	.	H	α-helix	trans	-75.7	-31.4	175.5	0	0	0	0	0	112.7	V42 A43 M49 V50	V42-A46 WeakPolarHBondContact O-CB 3.37Å; V42-A46 PolarHBondContact O-N 3.29Å; A43-A46 PolarHBondContact O-N 3.34Å; A43-A46 VanDerWaalsContact O-N 3.15Å; A46-M49 PolarHBondContact O-N 3.37Å; A46-M49 VanDerWaalsContact O-N 3.17Å; A46-V50 WeakPolarHBondContact O-CB 3.26Å; A46-V50 VanDerWaalsContact O-CG2 3.29Å; A46-V50 WeakPolarHBondContact O-CG2 3.49Å; A46-V50 PolarHBondContact O-N 2.95Å
47	V	51.7	Low	54.8	Low	77 Å²	77	86 Å²	86	47%	0.467	53%	0.528	S	S	.	.	H	α-helix	trans	-58.5	-48.8	179	166.1	0	0	0	0	112.6	A43 M44 M49 V50 L51	A43-V47 VanDerWaalsContact O-CG2 3.28Å; A43-V47 WeakPolarHBondContact O-CG2 3.38Å; A43-V47 PolarHBondContact O-N 2.93Å; M44-V47 HydrophobicContact CE-CG2 4.12Å; V47-M49 VanDerWaalsContact C-N 3.32Å; V47-M49 PolarHBondContact O-N 3.3Å; V47-V50 PolarHBondContact O-N 3.24Å; V47-L51 VanDerWaalsContact O-CB 3.22Å; V47-L51 WeakPolarHBondContact O-CB 3.18Å; V47-L51 PolarHBondContact O-N 3.28Å
48	P	54.3	Low	53.9	Low	73 Å²	73	85.7 Å²	85.7	47%	0.474	53%	0.534	S	S	.	.	H	α-helix	trans	-63.1	-34.2	173.4	-23.3	31.7	0	0	0	113.3	M44 L51 S52	M44-P48 WeakPolarHBondContact O-CD 3.4Å; M44-P48 WeakPolarHBondContact O-CG 3.31Å; P48-L51 PolarHBondContact O-N 3.43Å; P48-S52 WeakPolarHBondContact O-CB 3.46Å; P48-S52 PolarHBondContact O-N 2.91Å
49	M	55.6	Low	52.9	Low	143 Å²	143	84 Å²	84	70%	0.704	54%	0.537	S	S	*	.	H	α-helix	trans	-72.4	-39.3	179	-69.8	-74.7	-93.4	0	0	111.6	A45 A46 V47 A53	A45-M49 WeakPolarHBondContact O-CG 3.47Å; A46-M49 PolarHBondContact O-N 3.37Å; A46-M49 VanDerWaalsContact O-N 3.17Å; V47-M49 VanDerWaalsContact C-N 3.32Å; V47-M49 PolarHBondContact O-N 3.3Å; M49-A53 WeakPolarHBondContact O-CB 3.35Å; M49-A53 PolarHBondContact O-N 3.22Å
50	V	53.5	Low	52	Low	90 Å²	90	83.8 Å²	83.8	55%	0.545	53%	0.534	S	S	.	.	H	α-helix	trans	-68.8	-39.4	172.9	174.5	0	0	0	0	110.4	A46 V47 A53 M54	A46-V50 WeakPolarHBondContact O-CB 3.26Å; A46-V50 VanDerWaalsContact O-CG2 3.29Å; A46-V50 WeakPolarHBondContact O-CG2 3.49Å; A46-V50 PolarHBondContact O-N 2.95Å; V47-V50 PolarHBondContact O-N 3.24Å; V50-A53 PolarHBondContact O-N 3.3Å; V50-M54 HydrophobicContact CG1-CG 4.26Å; V50-M54 WeakPolarHBondContact O-CB 3.15Å; V50-M54 WeakPolarHBondContact O-CG 3.39Å; V50-M54 PolarHBondContact O-N 2.77Å
51	L	52.5	Low	51.5	Low	100 Å²	100	89.1 Å²	89.1	52%	0.524	55%	0.553	S	S	.	*	H	α-helix	trans	-68.5	-38.4	175.7	-171.6	61	0	0	0	112.2	V47 P48 M54 G55 F56	V47-L51 VanDerWaalsContact O-CB 3.22Å; V47-L51 WeakPolarHBondContact O-CB 3.18Å; V47-L51 PolarHBondContact O-N 3.28Å; P48-L51 PolarHBondContact O-N 3.43Å; L51-M54 CarbonylContact O-C 3.59Å; L51-M54 PolarHBondContact O-N 3.3Å; L51-G55 PolarHBondContact O-N 3.49Å; L51-F56 HydrophobicContact CG-CB 4.48Å; L51-F56 WeakPolarHBondContact O-CB 3.31Å; L51-F56 PolarHBondContact O-N 3.33Å
52	S	49.9	Very low	50.8	Low	41 Å²	41	89.1 Å²	89.1	29%	0.287	56%	0.563	S	S	.	*	I	π-helix	trans	-68.6	-39.2	174.4	-167.8	0	0	0	0	111.5	P48 G55 F56 T57	P48-S52 WeakPolarHBondContact O-CB 3.46Å; P48-S52 PolarHBondContact O-N 2.91Å; S52-G55 PolarHBondContact O-N 3.48Å; S52-F56 PolarHBondContact O-N 3.48Å; S52-T57 PolarHBondContact O-N 2.9Å; S52-T57 WeakPolarHBondContact OG-CB 3.25Å
53	A	52	Low	49.9	Very low	82 Å²	82	87.8 Å²	87.8	68%	0.678	56%	0.558	S	S	*	*	I	π-helix	trans	-70.4	-32.1	173.2	0	0	0	0	0	113.1	M49 V50 G55	M49-A53 WeakPolarHBondContact O-CB 3.35Å; M49-A53 PolarHBondContact O-N 3.22Å; V50-A53 PolarHBondContact O-N 3.3Å; A53-G55 PolarHBondContact O-N 3.02Å
54	M	50	Low	49.6	Very low	159 Å²	159	90 Å²	90	78%	0.783	57%	0.57	S	S	*	*	I	π-helix	trans	-78	15.8	173.1	-74.8	-75.3	-76.5	0	0	113.3	V50 L51	V50-M54 HydrophobicContact CG1-CG 4.26Å; V50-M54 WeakPolarHBondContact O-CB 3.15Å; V50-M54 WeakPolarHBondContact O-CG 3.39Å; V50-M54 PolarHBondContact O-N 2.77Å; L51-M54 CarbonylContact O-C 3.59Å; L51-M54 PolarHBondContact O-N 3.3Å
55	G	49.4	Very low	49.5	Very low	48 Å²	48	87.4 Å²	87.4	50%	0.495	57%	0.565	S	S	.	*	I	π-helix	trans	109	14.6	166.1	0	0	0	0	0	116.3	L51 S52 A53	L51-G55 PolarHBondContact O-N 3.49Å; S52-G55 PolarHBondContact O-N 3.48Å; A53-G55 PolarHBondContact O-N 3.02Å
56	F	48.4	Very low	49	Very low	175 Å²	175	91.1 Å²	91.1	77%	0.768	58%	0.575	S	S	*	*	I	π-helix	trans	-99.6	21	171	-118	-86.5	0	0	0	113.6	L51 S52	L51-F56 HydrophobicContact CG-CB 4.48Å; L51-F56 WeakPolarHBondContact O-CB 3.31Å; L51-F56 PolarHBondContact O-N 3.33Å; S52-F56 PolarHBondContact O-N 3.48Å
57	T	43.6	Very low	48.6	Very low	80 Å²	80	92.7 Å²	92.7	49%	0.491	59%	0.588	S	S	.	*	S	Bend	trans	-101.1	150.5	164.7	-143.3	0	0	0	0	109.9	S52 A59 G60	S52-T57 PolarHBondContact O-N 2.9Å; S52-T57 WeakPolarHBondContact OG-CB 3.25Å; T57-A59 HydrophobicContact CG2-CB 4.31Å; T57-A59 PolarHBondContact O-N 3.45Å; T57-G60 PolarHBondContact O-N 3.31Å
58	A	45.1	Very low	48.1	Very low	79 Å²	79	91.2 Å²	91.2	65%	0.653	58%	0.584	S	S	*	*	T	Hydrogen-bonded Turn	trans	-50	-8.4	-169.7	0	0	0	0	0	117.4	G60 I61 A62	A58-G60 VanDerWaalsContact C-N 3.29Å; A58-I61 PolarHBondContact O-N 2.91Å; A58-A62 PolarHBondContact O-N 3.41Å
59	A	43.5	Very low	47.6	Very low	76 Å²	76	95.1 Å²	95.1	63%	0.628	59%	0.593	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70	-20.1	167	0	0	0	0	0	113.9	T57	T57-A59 HydrophobicContact CG2-CB 4.31Å; T57-A59 PolarHBondContact O-N 3.45Å
60	G	43.9	Very low	47.1	Very low	34 Å²	34	95.4 Å²	95.4	35%	0.351	60%	0.595	S	S	.	*	T	Hydrogen-bonded Turn	trans	-74.6	-22.9	169.4	0	0	0	0	0	113.6	T57 A58 S63	T57-G60 PolarHBondContact O-N 3.31Å; A58-G60 VanDerWaalsContact C-N 3.29Å; G60-S63 CarbonylContact O-C 3.44Å; G60-S63 PolarHBondContact O-N 3.43Å
61	I	47.1	Very low	46.7	Very low	146 Å²	146	97.9 Å²	97.9	75%	0.749	60%	0.602	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.3	-26.1	175.3	-57.5	-60.1	0	0	0	111.4	A58 S63	A58-I61 PolarHBondContact O-N 2.91Å; I61-S63 PolarHBondContact O-N 3.33Å
62	A	45	Very low	46.1	Very low	95 Å²	95	96.4 Å²	96.4	79%	0.785	60%	0.601	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.7	-12.1	166.3	0	0	0	0	0	112.8	A58	A58-A62 PolarHBondContact O-N 3.41Å
63	S	40.8	Very low	45.7	Very low	67 Å²	67	98 Å²	98	47%	0.469	62%	0.616	S	S	.	*	T	Hydrogen-bonded Turn	trans	-105.3	57.5	169.6	-166.2	0	0	0	0	111.7	G60 I61 S65	G60-S63 CarbonylContact O-C 3.44Å; G60-S63 PolarHBondContact O-N 3.43Å; I61-S63 PolarHBondContact O-N 3.33Å; S63-S65 PolarHBondContact O-N 3.3Å
64	S	50.4	Low	45.5	Very low	92 Å²	92	97.1 Å²	97.1	64%	0.643	61%	0.609	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.7	36.9	159.1	-166.3	0	0	0	0	112.4
65	S	50.6	Low	45.4	Very low	77 Å²	77	92.5 Å²	92.5	54%	0.538	60%	0.596	S	S	.	*	T	Hydrogen-bonded Turn	trans	-153.7	27	-173.1	-127.9	0	0	0	0	118.3	S63	S63-S65 PolarHBondContact O-N 3.3Å
66	I	46.8	Very low	45.4	Very low	138 Å²	138	96.7 Å²	96.7	71%	0.708	61%	0.606	S	S	*	*	T	Hydrogen-bonded Turn	trans	-129.6	-32.4	155.7	-105.8	166.9	0	0	0	112.6
67	A	45.8	Very low	45.4	Very low	74 Å²	74	92.2 Å²	92.2	61%	0.612	60%	0.601	S	S	*	*	S	Bend	trans	-79.8	-34.9	171.3	0	0	0	0	0	113	K69 M70 M71	A67-K69 PolarHBondContact O-N 3.26Å; A67-M70 PolarHBondContact O-N 3.38Å; A67-M71 PolarHBondContact O-N 3.18Å
68	A	41.5	Very low	45.6	Very low	46 Å²	46	95.3 Å²	95.3	38%	0.38	61%	0.614	S	S	.	*	H	α-helix	trans	-67.7	-30.6	175	0	0	0	0	0	113.2	S72	A68-S72 WeakPolarHBondContact O-CB 3.45Å; A68-S72 PolarHBondContact O-N 3.26Å
69	K	44.1	Very low	45.7	Very low	155 Å²	155	94.3 Å²	94.3	67%	0.674	61%	0.612	S	S	*	*	H	α-helix	trans	-80.4	-14.2	175.8	-78	178.3	83.6	-90.7	0	114.2	A67	A67-K69 PolarHBondContact O-N 3.26Å
70	M	46.1	Very low	46.3	Very low	150 Å²	150	95.3 Å²	95.3	74%	0.739	63%	0.629	S	S	*	*	H	α-helix	trans	-100.2	-27.4	173.5	-76.7	-115.8	87.9	0	0	113.1	A67	A67-M70 PolarHBondContact O-N 3.38Å
71	M	44.6	Very low	46.6	Very low	141 Å²	141	97 Å²	97	70%	0.695	65%	0.647	S	S	*	*	H	α-helix	trans	-90.7	-25.1	175.7	-161.6	170.4	-179.2	0	0	113.6	A67 A73 A74 A75	A67-M71 PolarHBondContact O-N 3.18Å; M71-A73 VanDerWaalsContact C-N 3.3Å; M71-A73 PolarHBondContact O-N 2.88Å; M71-A74 PolarHBondContact O-N 3.5Å; M71-A75 PolarHBondContact O-N 2.79Å
72	S	38.5	Very low	46.7	Very low	70 Å²	70	96.8 Å²	96.8	49%	0.49	65%	0.652	S	S	.	*	H	α-helix	trans	-68.8	-26.2	172.4	-172.4	0	0	0	0	113	A68 I76	A68-S72 WeakPolarHBondContact O-CB 3.45Å; A68-S72 PolarHBondContact O-N 3.26Å; S72-I76 WeakPolarHBondContact O-CD1 3.24Å; S72-I76 WeakPolarHBondContact O-CG1 3.47Å
73	A	42.9	Very low	47.3	Very low	73 Å²	73	96.7 Å²	96.7	60%	0.603	65%	0.651	S	S	*	*	H	α-helix	trans	-83.5	-24.4	176	0	0	0	0	0	114	M71	M71-A73 VanDerWaalsContact C-N 3.3Å; M71-A73 PolarHBondContact O-N 2.88Å
74	A	46.6	Very low	47.7	Very low	64 Å²	64	99.8 Å²	99.8	53%	0.529	67%	0.673	S	S	.	*	H	α-helix	trans	-96.3	-22.9	-175.6	0	0	0	0	0	114.2	M71	M71-A74 PolarHBondContact O-N 3.5Å
75	A	49	Very low	48.1	Very low	62 Å²	62	99.3 Å²	99.3	51%	0.512	68%	0.682	S	S	.	*	H	α-helix	trans	-95.8	-29.2	-178.6	0	0	0	0	0	114.4	M71 A77	M71-A75 PolarHBondContact O-N 2.79Å; A75-A77 VanDerWaalsContact C-N 3.3Å; A75-A77 PolarHBondContact O-N 3.28Å
76	I	49.3	Very low	48.2	Very low	137 Å²	137	98.9 Å²	98.9	70%	0.703	68%	0.68	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.9	-22.8	177.9	-59.6	175.6	0	0	0	111.4	S72	S72-I76 WeakPolarHBondContact O-CD1 3.24Å; S72-I76 WeakPolarHBondContact O-CG1 3.47Å
77	A	47.5	Very low	48.6	Very low	80 Å²	80	98.8 Å²	98.8	66%	0.661	68%	0.68	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84	-10.2	179.6	0	0	0	0	0	115.2	A75	A75-A77 VanDerWaalsContact C-N 3.3Å; A75-A77 PolarHBondContact O-N 3.28Å
78	N	48.4	Very low	48.9	Very low	145 Å²	145	100.8 Å²	100.8	78%	0.775	68%	0.684	S	S	*	*	S	Bend	trans	-122.5	18.1	-173.1	-97.4	-47.6	0	0	0	116.1
79	G	46.5	Very low	49.4	Very low	59 Å²	59	101.4 Å²	101.4	61%	0.608	69%	0.689	S	S	*	*			trans	69.2	114.1	161.9	0	0	0	0	0	115.1	G81	G79-G81 PolarHBondContact O-N 2.83Å
80	G	56	Low	50	Low	96 Å²	96	97.2 Å²	97.2	99%	0.99	68%	0.677	S	S	*	*	S	Bend	trans	-49.5	116.2	175.6	0	0	0	0	0	113.2
81	G	51.7	Low	50.3	Low	70 Å²	70	95.8 Å²	95.8	72%	0.722	67%	0.671	S	S	*	*			trans	176.7	85.6	179.7	0	0	0	0	0	112	G79	G79-G81 PolarHBondContact O-N 2.83Å
82	V	49.2	Very low	50.9	Low	141 Å²	141	95.9 Å²	95.9	86%	0.855	67%	0.67	S	S	*	*			trans	12.4	124.6	157.4	-168	0	0	0	0	119.3
83	A	56.1	Low	51.3	Low	94 Å²	94	97 Å²	97	78%	0.777	68%	0.678	S	S	*	*			trans	33.8	117.2	145.8	0	0	0	0	0	120.7
84	S	50.7	Low	51.7	Low	132 Å²	132	100.4 Å²	100.4	92%	0.923	69%	0.685	S	S	*	*			trans	-148	99.5	157.6	-166.9	0	0	0	0	110.9
85	G	57.4	Low	52.1	Low	81 Å²	81	100.7 Å²	100.7	84%	0.835	70%	0.695	S	S	*	*	S	Bend	trans	89.6	70.7	167.7	0	0	0	0	0	116.9
86	S	53.9	Low	52	Low	69 Å²	69	104.8 Å²	104.8	48%	0.483	73%	0.729	S	S	.	*	S	Bend		178.1	76.9	81.8	179.7	0	0	0	0	110.8	T90	S86-T90 PolarHBondContact O-OG1 2.94Å; S86-T90 PolarHBondContact OG-OG1 2.89Å; S86-T90 VanDerWaalsContact OG-OG1 3.05Å
87	L	53.7	Low	52.1	Low	135 Å²	135	103.2 Å²	103.2	71%	0.707	73%	0.73	S	S	*	*	S	Bend	trans	-96.3	-40.2	161.5	-177.7	54.8	0	0	0	110.5	L91	L87-L91 HydrophobicContact CD1-CD1 4.29Å; L87-L91 PolarHBondContact O-N 3.41Å
88	V	52.3	Low	52.3	Low	117 Å²	117	104.4 Å²	104.4	71%	0.709	73%	0.734	S	S	*	*	H	α-helix	trans	-73.4	-41.4	-178.7	-177.4	0	0	0	0	111.9	T90 L91 Q92	V88-T90 VanDerWaalsContact C-N 3.33Å; V88-T90 PolarHBondContact O-N 2.91Å; V88-L91 PolarHBondContact O-N 3.38Å; V88-Q92 WeakPolarHBondContact O-CB 3.45Å; V88-Q92 PolarHBondContact O-N 3.12Å
89	A	53.7	Low	52.6	Low	58 Å²	58	102.2 Å²	102.2	48%	0.479	73%	0.731	S	S	.	*	H	α-helix	trans	-68.3	-31.6	178.4	0	0	0	0	0	112.7	Q92 S93	A89-Q92 PolarHBondContact O-N 3.42Å; A89-S93 WeakPolarHBondContact O-CB 3.46Å; A89-S93 PolarHBondContact O-N 3.49Å
90	T	56.4	Low	52.9	Low	68 Å²	68	104.7 Å²	104.7	42%	0.417	74%	0.738	S	S	.	*	H	α-helix	trans	-68.9	-40.3	173.8	-46.4	0	0	0	0	111.6	S86 V88 S93 L94	S86-T90 PolarHBondContact O-OG1 2.94Å; S86-T90 PolarHBondContact OG-OG1 2.89Å; S86-T90 VanDerWaalsContact OG-OG1 3.05Å; V88-T90 VanDerWaalsContact C-N 3.33Å; V88-T90 PolarHBondContact O-N 2.91Å; T90-S93 PolarHBondContact O-N 3.16Å; T90-L94 VanDerWaalsContact O-CG 3.31Å; T90-L94 WeakPolarHBondContact O-CG 3.28Å; T90-L94 PolarHBondContact O-N 3.04Å
91	L	51.1	Low	52.7	Low	119 Å²	119	105.3 Å²	105.3	62%	0.623	72%	0.723	S	S	*	*	H	α-helix	trans	-68.6	-35.5	174.6	-104.7	70.8	0	0	0	112.4	L87 V88 L94 G95	L87-L91 HydrophobicContact CD1-CD1 4.29Å; L87-L91 PolarHBondContact O-N 3.41Å; V88-L91 PolarHBondContact O-N 3.38Å; L91-L94 PolarHBondContact O-N 3.4Å; L91-G95 PolarHBondContact O-N 2.86Å
92	Q	56.9	Low	52.8	Low	143 Å²	143	107.6 Å²	107.6	67%	0.668	72%	0.723	S	S	*	*	H	α-helix	trans	-70.1	-34.7	175.7	-156.1	176.8	-6.7	0	0	111.8	V88 A89 L94 G95 A96	V88-Q92 WeakPolarHBondContact O-CB 3.45Å; V88-Q92 PolarHBondContact O-N 3.12Å; A89-Q92 PolarHBondContact O-N 3.42Å; Q92-L94 PolarHBondContact O-N 3.09Å; Q92-G95 PolarHBondContact O-N 3Å; Q92-A96 PolarHBondContact O-N 3.45Å
93	S	47.9	Very low	53.1	Low	94 Å²	94	105.2 Å²	105.2	66%	0.657	71%	0.713	S	S	*	*	H	α-helix	trans	-68.7	-17.3	173.6	-172.3	0	0	0	0	114	A89 T90	A89-S93 WeakPolarHBondContact O-CB 3.46Å; A89-S93 PolarHBondContact O-N 3.49Å; T90-S93 PolarHBondContact O-N 3.16Å
94	L	51.6	Low	52.8	Low	144 Å²	144	106.1 Å²	106.1	75%	0.754	71%	0.709	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.1	-8.3	176.3	-66.5	171	0	0	0	112.8	T90 L91 Q92	T90-L94 VanDerWaalsContact O-CG 3.31Å; T90-L94 WeakPolarHBondContact O-CG 3.28Å; T90-L94 PolarHBondContact O-N 3.04Å; L91-L94 PolarHBondContact O-N 3.4Å; Q92-L94 PolarHBondContact O-N 3.09Å
95	G	54.8	Low	53	Low	71 Å²	71	103.9 Å²	103.9	73%	0.732	69%	0.691	S	S	*	*	T	Hydrogen-bonded Turn	trans	-116.6	-6.5	-177.8	0	0	0	0	0	115.6	L91 Q92	L91-G95 PolarHBondContact O-N 2.86Å; Q92-G95 PolarHBondContact O-N 3Å
96	A	46.3	Very low	52.6	Low	148 Å²	148	106 Å²	106	100%	1.223	68%	0.678	S	S	*	*			trans	-89	0	168.9	0	0	0	0	0	111.4	Q92	Q92-A96 PolarHBondContact O-N 3.45Å

Retrieved 96 of 96 residues in 44.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).