A0A087WUL6_HUMAN Loading...

Cyclin Q

AlphaFold DB , UniProt , Accession A0A087WUL6, Species HUMAN (Homo sapiens, Human), Gene CCNQ, Length 39 aa.

						>A0A087WUL6_HUMAN|A0A087WUL6|CCNQ
MEAPEGGGGGPAARGPEGQPAPEARVHFRVARFIMEVSS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.7	Low	54.7	Low	240 Å²	240	124.7 Å²	124.7	100%	1.182	86%	0.86	S	S	*	*				0	95.6	0	172.1	165.8	-175.9	0	0	106.7
2	E	42.8	Very low	55	Low	201 Å²	201	121.3 Å²	121.3	94%	0.939	85%	0.845	S	S	*	*			trans	-144.5	145	171.5	-64.5	-163.5	97.1	0	0	109.2
3	A	56.7	Low	55.3	Low	84 Å²	84	119.8 Å²	119.8	69%	0.694	85%	0.846	S	S	*	*			trans	-81.5	165.6	-142.3	0	0	0	0	0	116.4	E5	A3-E5 PolarHBondContact O-N 3.04Å
4	P	62.8	Low	55.7	Low	130 Å²	130	123.2 Å²	123.2	84%	0.844	83%	0.83	S	S	*	*			trans	-79.5	104	172.2	31.9	-30.1	0	0	0	109.8	G6	P4-G6 VanDerWaalsContact C-N 3.33Å; P4-G6 PolarHBondContact O-N 3.43Å
5	E	51	Low	56.2	Low	193 Å²	193	117.7 Å²	117.7	90%	0.902	80%	0.803	S	S	*	*			trans	-80.2	86.8	172.5	-61.8	-132.7	99	0	0	109.6	A3	A3-E5 PolarHBondContact O-N 3.04Å
6	G	62.7	Low	56.6	Low	78 Å²	78	117.5 Å²	117.5	80%	0.804	80%	0.799	S	S	*	*			trans	-76.3	122.7	151.3	0	0	0	0	0	108.9	P4	P4-G6 VanDerWaalsContact C-N 3.33Å; P4-G6 PolarHBondContact O-N 3.43Å
7	G	56.8	Low	56.9	Low	81 Å²	81	121.8 Å²	121.8	84%	0.835	81%	0.805	S	S	*	*			trans	158.5	105.9	164.6	0	0	0	0	0	116.1
8	G	45.5	Very low	57.6	Low	82 Å²	82	115.4 Å²	115.4	85%	0.845	76%	0.763	S	S	*	*			trans	101.8	95	138.2	0	0	0	0	0	118.4
9	G	57.4	Low	58.7	Low	89 Å²	89	115.3 Å²	115.3	92%	0.918	75%	0.751	S	S	*	*				71.7	75.9	109.9	0	0	0	0	0	118.3
10	G	51.6	Low	59.8	Low	61 Å²	61	113.3 Å²	113.3	63%	0.629	74%	0.738	S	S	*	*			trans	175.2	135.8	154.9	0	0	0	0	0	108.8	A12	G10-A12 PolarHBondContact O-N 2.98Å
11	P	57.6	Low	61.1	Low	133 Å²	133	110.4 Å²	110.4	86%	0.864	72%	0.723	S	S	*	*			trans	-65.7	96.9	171.8	28.7	-29.3	0	0	0	105.8	A13	P11-A13 PolarHBondContact O-N 3.49Å
12	A	57.9	Low	62.7	Low	83 Å²	83	103 Å²	103	69%	0.686	69%	0.693	S	S	*	*			trans	-47.5	117.5	157.5	0	0	0	0	0	104	G10 R14	G10-A12 PolarHBondContact O-N 2.98Å; A12-R14 PolarHBondContact O-N 3.25Å
13	A	59.2	Low	65	Low	103 Å²	103	99.1 Å²	99.1	85%	0.851	68%	0.675	S	S	*	*			trans	-63.5	82.9	177.5	0	0	0	0	0	106.5	P11 G15	P11-A13 PolarHBondContact O-N 3.49Å; A13-G15 PolarHBondContact O-N 3.43Å; A13-G15 VanDerWaalsContact O-N 3.09Å
14	R	61.5	Low	66.6	Low	167 Å²	167	97.2 Å²	97.2	63%	0.63	66%	0.66	S	S	*	*			trans	-61.1	117.2	178.4	-120	-179.7	129.1	-161	11.5	103.1	A12 G18 Q19	A12-R14 PolarHBondContact O-N 3.25Å; R14-G18 VanDerWaalsContact CD-C 3.5Å; R14-G18 WeakPolarHBondContact CD-O 3.35Å; R14-G18 PolarHBondContact NE-O 3.41Å; R14-G18 VanDerWaalsContact NE-O 3.15Å; R14-G18 PolarHBondContact NH1-O 2.98Å; R14-Q19 PolarHBondContact O-NE2 3.39Å
15	G	62.6	Low	67.9	Low	41 Å²	41	97 Å²	97	42%	0.423	64%	0.642	S	S	.	*			trans	-53.6	-176.8	176	0	0	0	0	0	111.6	A13 E17 G18 Q19	A13-G15 PolarHBondContact O-N 3.43Å; A13-G15 VanDerWaalsContact O-N 3.09Å; G15-E17 PolarHBondContact O-N 3.22Å; G15-G18 WeakPolarHBondContact O-CA 3.47Å; G15-G18 PolarHBondContact O-N 2.65Å; G15-Q19 PolarHBondContact O-N 2.99Å; G15-Q19 PolarHBondContact O-NE2 2.93Å
16	P	62.5	Low	70	Confident	114 Å²	114	91.5 Å²	91.5	74%	0.74	62%	0.621	S	S	*	*	T	Hydrogen-bonded Turn	trans	-51.4	-31	177.8	20.1	-31.5	0	0	0	113.5	G18	P16-G18 PolarHBondContact O-N 2.91Å
17	E	61.3	Low	71.6	Confident	191 Å²	191	94 Å²	94	89%	0.893	61%	0.612	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.1	-11.5	174.8	-73.8	161.8	77.3	0	0	115	G15	G15-E17 PolarHBondContact O-N 3.22Å
18	G	70	Confident	73.4	Confident	6 Å²	6	96.8 Å²	96.8	6%	0.062	60%	0.601	C	S	.	*	T	Hydrogen-bonded Turn	trans	-112.4	-12.5	-178.1	0	0	0	0	0	115.1	R14 G15 P16	R14-G18 VanDerWaalsContact CD-C 3.5Å; R14-G18 WeakPolarHBondContact CD-O 3.35Å; R14-G18 PolarHBondContact NE-O 3.41Å; R14-G18 VanDerWaalsContact NE-O 3.15Å; R14-G18 PolarHBondContact NH1-O 2.98Å; G15-G18 WeakPolarHBondContact O-CA 3.47Å; G15-G18 PolarHBondContact O-N 2.65Å; P16-G18 PolarHBondContact O-N 2.91Å
19	Q	78.8	Confident	75.7	Confident	114 Å²	114	100 Å²	100	53%	0.533	59%	0.588	S	S	.	*	S	Bend	trans	-75	127.9	169.7	-70.6	159.7	82.6	0	0	107.5	R14 G15 A21	R14-Q19 PolarHBondContact O-NE2 3.39Å; G15-Q19 PolarHBondContact O-N 2.99Å; G15-Q19 PolarHBondContact O-NE2 2.93Å; Q19-A21 PolarHBondContact O-N 3.03Å
20	P	79.9	Confident	77.5	Confident	75 Å²	75	99.4 Å²	99.4	49%	0.487	57%	0.566	S	S	.	*	P	Polyproline II helix	trans	-55.5	141.8	173.6	-17.8	28.1	0	0	0	109.1	A24 R25	P20-A24 HydrophobicContact CB-CB 4Å; P20-R25 WeakPolarHBondContact O-CD 3.4Å; P20-R25 HydrophobicContact CB-CG 4.04Å; P20-R25 VanDerWaalsContact O-CD 3.31Å
21	A	88.6	Confident	79.7	Confident	52 Å²	52	99.4 Å²	99.4	43%	0.43	56%	0.56	S	S	.	*	P	Polyproline II helix	trans	-49.1	147.6	175.8	0	0	0	0	0	110.6	Q19 E23 A24 R25	Q19-A21 PolarHBondContact O-N 3.03Å; A21-E23 PolarHBondContact O-N 3.03Å; A21-E23 VanDerWaalsContact O-N 3.09Å; A21-A24 WeakPolarHBondContact O-CA 3.5Å; A21-A24 WeakPolarHBondContact O-CB 3.24Å; A21-A24 PolarHBondContact O-N 3.5Å; A21-R25 PolarHBondContact O-N 3.24Å; A21-R25 VanDerWaalsContact O-N 3.08Å
22	P	88.4	Confident	81.5	Confident	84 Å²	84	100.3 Å²	100.3	55%	0.545	55%	0.546	S	S	.	.	H	α-helix	trans	-47.2	-41.2	179.7	-29	36.1	0	0	0	113.3	R25 V26	P22-R25 WeakPolarHBondContact O-CB 3.4Å; P22-R25 PolarHBondContact O-N 3.03Å; P22-V26 PolarHBondContact O-N 3.38Å
23	E	92.1	Very high	83.2	Confident	120 Å²	120	102.4 Å²	102.4	56%	0.561	54%	0.541	S	S	*	.	H	α-helix	trans	-62.4	-48.1	177.8	-60.9	69.3	-147.6	0	0	110.8	A21 R25 V26 H27	A21-E23 PolarHBondContact O-N 3.03Å; A21-E23 VanDerWaalsContact O-N 3.09Å; E23-R25 PolarHBondContact O-N 3.43Å; E23-V26 WeakPolarHBondContact O-CA 3.33Å; E23-V26 WeakPolarHBondContact O-CB 3.46Å; E23-V26 PolarHBondContact O-N 3.04Å; E23-H27 PolarHBondContact O-CD2 2.91Å; E23-H27 PolarHBondContact O-N 3.4Å
24	A	90.5	Very high	84.9	Confident	45 Å²	45	102 Å²	102	37%	0.372	52%	0.523	S	S	.	.	H	α-helix	trans	-59.9	-34.4	177.7	0	0	0	0	0	112.1	P20 A21 V26 H27 F28	P20-A24 HydrophobicContact CB-CB 4Å; A21-A24 WeakPolarHBondContact O-CA 3.5Å; A21-A24 WeakPolarHBondContact O-CB 3.24Å; A21-A24 PolarHBondContact O-N 3.5Å; A24-V26 VanDerWaalsContact C-N 3.31Å; A24-V26 PolarHBondContact O-N 3.01Å; A24-H27 PolarHBondContact O-N 3.24Å; A24-F28 WeakPolarHBondContact O-CB 3.42Å; A24-F28 PolarHBondContact O-N 2.95Å
25	R	90.7	Very high	86.5	Confident	124 Å²	124	101.1 Å²	101.1	47%	0.468	53%	0.528	S	S	.	.	H	α-helix	trans	-69.3	-28	174.8	-61.7	167.1	61.6	-165.1	2.1	112.6	P20 A21 P22 E23 R29	P20-R25 WeakPolarHBondContact O-CD 3.4Å; P20-R25 HydrophobicContact CB-CG 4.04Å; P20-R25 VanDerWaalsContact O-CD 3.31Å; A21-R25 PolarHBondContact O-N 3.24Å; A21-R25 VanDerWaalsContact O-N 3.08Å; P22-R25 WeakPolarHBondContact O-CB 3.4Å; P22-R25 PolarHBondContact O-N 3.03Å; E23-R25 PolarHBondContact O-N 3.43Å; R25-R29 PolarHBondContact O-NE 3.5Å; R25-R29 WeakPolarHBondContact O-CG 3.38Å; R25-R29 PolarHBondContact O-N 3.07Å
26	V	94.9	Very high	88	Confident	78 Å²	78	105.1 Å²	105.1	47%	0.473	54%	0.535	S	S	.	.	H	α-helix	trans	-75.6	-50.2	173.4	174.8	0	0	0	0	109.6	P22 E23 A24 F28 R29 V30	P22-V26 PolarHBondContact O-N 3.38Å; E23-V26 WeakPolarHBondContact O-CA 3.33Å; E23-V26 WeakPolarHBondContact O-CB 3.46Å; E23-V26 PolarHBondContact O-N 3.04Å; A24-V26 VanDerWaalsContact C-N 3.31Å; A24-V26 PolarHBondContact O-N 3.01Å; V26-F28 PolarHBondContact O-N 3.17Å; V26-F28 VanDerWaalsContact C-N 3.29Å; V26-R29 PolarHBondContact O-N 3.48Å; V26-R29 VanDerWaalsContact O-N 3.07Å; V26-V30 HydrophobicContact CG1-CG2 4.24Å; V26-V30 WeakPolarHBondContact O-CG2 3.39Å; V26-V30 PolarHBondContact O-N 3.3Å
27	H	95.8	Very high	89.4	Confident	131 Å²	131	104.1 Å²	104.1	61%	0.606	53%	0.527	S	S	*	.	H	α-helix	trans	-56.2	-43.6	178.4	-70.2	-67.4	0	0	0	112.1	E23 A24 R29 V30 A31	E23-H27 PolarHBondContact O-CD2 2.91Å; E23-H27 PolarHBondContact O-N 3.4Å; A24-H27 PolarHBondContact O-N 3.24Å; H27-R29 PolarHBondContact O-N 3.45Å; H27-V30 PolarHBondContact O-N 3.49Å; H27-A31 WeakPolarHBondContact O-CB 3.42Å; H27-A31 PolarHBondContact O-N 2.94Å
28	F	94	Very high	90.2	Very high	140 Å²	140	99.7 Å²	99.7	61%	0.614	52%	0.517	S	S	*	.	H	α-helix	trans	-60.1	-43.9	176.4	-177.7	-96.4	0	0	0	112.6	A24 V26 R32	A24-F28 WeakPolarHBondContact O-CB 3.42Å; A24-F28 PolarHBondContact O-N 2.95Å; V26-F28 PolarHBondContact O-N 3.17Å; V26-F28 VanDerWaalsContact C-N 3.29Å; F28-R32 PolarHBondContact O-N 3.41Å; F28-R32 WeakPolarHBondContact O-CB 3.33Å
29	R	94.8	Very high	90	Very high	149 Å²	149	107.1 Å²	107.1	56%	0.562	57%	0.568	S	S	*	*	H	α-helix	trans	-67.4	-41.4	179.3	-77.9	-176.4	-92.5	-166.5	-0.7	112.1	R25 V26 H27 F33	R25-R29 PolarHBondContact O-NE 3.5Å; R25-R29 WeakPolarHBondContact O-CG 3.38Å; R25-R29 PolarHBondContact O-N 3.07Å; V26-R29 PolarHBondContact O-N 3.48Å; V26-R29 VanDerWaalsContact O-N 3.07Å; H27-R29 PolarHBondContact O-N 3.45Å; R29-F33 WeakPolarHBondContact O-CB 3.41Å; R29-F33 PolarHBondContact O-N 2.75Å
30	V	95.8	Very high	90.5	Very high	77 Å²	77	106.8 Å²	106.8	47%	0.467	57%	0.57	S	S	.	*	H	α-helix	trans	-64.1	-48	176.6	173	0	0	0	0	110.9	V26 H27 R32 F33 I34	V26-V30 HydrophobicContact CG1-CG2 4.24Å; V26-V30 WeakPolarHBondContact O-CG2 3.39Å; V26-V30 PolarHBondContact O-N 3.3Å; H27-V30 PolarHBondContact O-N 3.49Å; V30-R32 VanDerWaalsContact C-N 3.33Å; V30-R32 PolarHBondContact O-N 3.08Å; V30-F33 PolarHBondContact O-N 2.95Å; V30-I34 HydrophobicContact CG1-CD1 3.76Å; V30-I34 HydrophobicContact CG1-CG1 4.47Å; V30-I34 WeakPolarHBondContact O-CG1 3.31Å; V30-I34 PolarHBondContact O-N 3.09Å
31	A	95.8	Very high	91.1	Very high	61 Å²	61	108.4 Å²	108.4	50%	0.504	57%	0.574	S	S	.	*	H	α-helix	trans	-60.5	-42.9	178.9	0	0	0	0	0	112.1	H27 F33 I34 M35	H27-A31 WeakPolarHBondContact O-CB 3.42Å; H27-A31 PolarHBondContact O-N 2.94Å; A31-F33 PolarHBondContact O-N 3.01Å; A31-I34 PolarHBondContact O-N 2.78Å; A31-M35 PolarHBondContact O-N 3.09Å
32	R	95.5	Very high	91.2	Very high	151 Å²	151	111.6 Å²	111.6	57%	0.57	58%	0.582	S	S	*	*	H	α-helix	trans	-60.8	-44.7	175.7	-178.4	178	178.6	129.8	1.8	112	F28 V30 M35 E36	F28-R32 PolarHBondContact O-N 3.41Å; F28-R32 WeakPolarHBondContact O-CB 3.33Å; V30-R32 VanDerWaalsContact C-N 3.33Å; V30-R32 PolarHBondContact O-N 3.08Å; R32-M35 PolarHBondContact O-N 3.25Å; R32-E36 WeakPolarHBondContact O-CB 3.34Å; R32-E36 PolarHBondContact O-N 3.42Å
33	F	95.4	Very high	91.4	Very high	128 Å²	128	113.2 Å²	113.2	56%	0.561	58%	0.584	S	S	*	*	H	α-helix	trans	-62.2	-45.1	178.7	180	-98.7	0	0	0	111.8	R29 V30 A31 M35 E36 V37	R29-F33 WeakPolarHBondContact O-CB 3.41Å; R29-F33 PolarHBondContact O-N 2.75Å; V30-F33 PolarHBondContact O-N 2.95Å; A31-F33 PolarHBondContact O-N 3.01Å; F33-M35 VanDerWaalsContact C-N 3.33Å; F33-M35 PolarHBondContact O-N 3.32Å; F33-E36 PolarHBondContact O-N 3.21Å; F33-V37 HydrophobicContact CZ-CG2 3.67Å; F33-V37 PolarHBondContact O-N 3.15Å; F33-V37 WeakPolarHBondContact O-CG2 3.45Å; F33-V37 WeakPolarHBondContact O-CB 3.5Å; F33-V37 HydrophobicContact CG-CG2 4.39Å; F33-V37 HydrophobicContact CE2-CG2 3.72Å; F33-V37 HydrophobicContact CE1-CG2 3.98Å; F33-V37 HydrophobicContact CD2-CG2 4.09Å; F33-V37 HydrophobicContact CD1-CG2 4.33Å
34	I	95	Very high	91.4	Very high	95 Å²	95	112.8 Å²	112.8	49%	0.487	59%	0.586	S	S	.	*	H	α-helix	trans	-60.4	-45.4	177.9	-66.8	165	0	0	0	110.6	V30 A31 E36 V37 S38	V30-I34 HydrophobicContact CG1-CD1 3.76Å; V30-I34 HydrophobicContact CG1-CG1 4.47Å; V30-I34 WeakPolarHBondContact O-CG1 3.31Å; V30-I34 PolarHBondContact O-N 3.09Å; A31-I34 PolarHBondContact O-N 2.78Å; I34-E36 VanDerWaalsContact C-N 3.32Å; I34-E36 PolarHBondContact O-N 2.81Å; I34-V37 PolarHBondContact O-N 2.61Å; I34-S38 VanDerWaalsContact O-CB 3.24Å; I34-S38 WeakPolarHBondContact O-CB 2.99Å; I34-S38 PolarHBondContact O-N 3.02Å; I34-S38 PolarHBondContact O-OG 3.29Å
35	M	94.5	Very high	91.4	Very high	148 Å²	148	117.3 Å²	117.3	73%	0.729	60%	0.6	S	S	*	*	H	α-helix	trans	-60.9	-41.1	178.2	-172.5	-175.3	83.8	0	0	112.4	A31 R32 F33	A31-M35 PolarHBondContact O-N 3.09Å; R32-M35 PolarHBondContact O-N 3.25Å; F33-M35 VanDerWaalsContact C-N 3.33Å; F33-M35 PolarHBondContact O-N 3.32Å
36	E	93.5	Very high	91.5	Very high	124 Å²	124	116.8 Å²	116.8	58%	0.579	61%	0.61	S	S	*	*	H	α-helix	trans	-72.5	-37.2	-177.7	-173	172.6	85.1	0	0	112.8	R32 F33 I34	R32-E36 WeakPolarHBondContact O-CB 3.34Å; R32-E36 PolarHBondContact O-N 3.42Å; F33-E36 PolarHBondContact O-N 3.21Å; I34-E36 VanDerWaalsContact C-N 3.32Å; I34-E36 PolarHBondContact O-N 2.81Å
37	V	91.9	Very high	91.2	Very high	94 Å²	94	119.8 Å²	119.8	57%	0.57	62%	0.62	S	S	*	*	H	α-helix	trans	-84.8	-17.6	-178.1	178.1	0	0	0	0	112.7	F33 I34 S39	F33-V37 HydrophobicContact CZ-CG2 3.67Å; F33-V37 PolarHBondContact O-N 3.15Å; F33-V37 WeakPolarHBondContact O-CG2 3.45Å; F33-V37 WeakPolarHBondContact O-CB 3.5Å; F33-V37 HydrophobicContact CG-CG2 4.39Å; F33-V37 HydrophobicContact CE2-CG2 3.72Å; F33-V37 HydrophobicContact CE1-CG2 3.98Å; F33-V37 HydrophobicContact CD2-CG2 4.09Å; F33-V37 HydrophobicContact CD1-CG2 4.33Å; I34-V37 PolarHBondContact O-N 2.61Å; V37-S39 PolarHBondContact O-N 2.96Å
38	S	78.7	Confident	90.8	Very high	97 Å²	97	118.8 Å²	118.8	68%	0.678	62%	0.621	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.5	9.7	176.4	-53.1	0	0	0	0	113.4	I34	I34-S38 VanDerWaalsContact O-CB 3.24Å; I34-S38 WeakPolarHBondContact O-CB 2.99Å; I34-S38 PolarHBondContact O-N 3.02Å; I34-S38 PolarHBondContact O-OG 3.29Å
39	S	64.9	Low	90.5	Very high	162 Å²	162	116.9 Å²	116.9	100%	1.133	62%	0.622	S	S	*	*			trans	-85.9	0	178	-173.6	0	0	0	0	113.7	V37	V37-S39 PolarHBondContact O-N 2.96Å

Retrieved 39 of 39 residues in 93.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).