A0A087WUN7_HUMAN Loading...

SRA stem-loop-interacting RNA-binding protein, mitochondrial

RNA-binding protein that acts as a nuclear receptor corepressor. Probably acts by binding the SRA RNA, and repressing the SRA-mediated nuclear receptor coactivation. Binds the STR7 loop of SRA RNA. Also able to repress glucocorticoid (GR), androgen (AR), thyroid (TR) and VDR-mediated transactivation.

AlphaFold DB , UniProt , Accession A0A087WUN7, Species HUMAN (Homo sapiens, Human), Gene SLIRP, Length 92 aa.

						>A0A087WUN7_HUMAN|A0A087WUN7|SLIRP
MAASAARGAAALRRSINQPVAFVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSEEGLRNALQQENHIIDGVKCLFF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.3	Very low	47.5	Very low	252 Å²	252	111.7 Å²	111.7	100%	1.241	76%	0.755	S	S	*	*				0	65.6	0	-71.4	-82.1	-173.1	0	0	109.5
2	A	41.2	Very low	47.7	Very low	105 Å²	105	115.6 Å²	115.6	87%	0.868	76%	0.761	S	S	*	*			trans	-117.6	94.4	-174.5	0	0	0	0	0	109.8
3	A	44.2	Very low	47.7	Very low	94 Å²	94	124.6 Å²	124.6	78%	0.777	77%	0.77	S	S	*	*			trans	-166	65	170.3	0	0	0	0	0	112.1
4	S	52.3	Low	48.3	Very low	112 Å²	112	127.7 Å²	127.7	78%	0.783	76%	0.761	S	S	*	*	S	Bend	trans	-151	-1.4	166.6	-159.9	0	0	0	0	117.4
5	A	51.4	Low	48.9	Very low	93 Å²	93	124.7 Å²	124.7	77%	0.769	75%	0.748	S	S	*	*	S	Bend	trans	-100.9	-7.4	-177.8	0	0	0	0	0	114.7
6	A	45	Very low	49.4	Very low	88 Å²	88	127.7 Å²	127.7	73%	0.727	76%	0.757	S	S	*	*	H	α-helix	trans	-84	-11.8	-173.9	0	0	0	0	0	114.9
7	R	52.9	Low	50.4	Low	214 Å²	214	128.2 Å²	128.2	81%	0.808	76%	0.755	S	S	*	*	H	α-helix	trans	-86.3	-16.5	-177.1	-59.4	-171	-148.2	177.5	8.3	114.1
8	G	47.3	Very low	52.1	Low	47 Å²	47	123.9 Å²	123.9	49%	0.485	73%	0.726	S	S	.	*	H	α-helix	trans	-78.7	-44.2	-175.8	0	0	0	0	0	113.8
9	A	48.5	Very low	54.1	Low	79 Å²	79	118 Å²	118	65%	0.653	69%	0.692	S	S	*	*	H	α-helix	trans	-82.2	-27.8	-174.1	0	0	0	0	0	114	A11	A9-A11 VanDerWaalsContact C-N 3.33Å
10	A	46.6	Very low	56	Low	70 Å²	70	114.7 Å²	114.7	58%	0.579	67%	0.673	S	S	*	*	H	α-helix	trans	-73.2	-24.6	176.1	0	0	0	0	0	113.1
11	A	50.4	Low	57.8	Low	75 Å²	75	109.3 Å²	109.3	62%	0.62	64%	0.642	S	S	*	*	H	α-helix	trans	-76.2	-30.2	178.8	0	0	0	0	0	112.8	A9	A9-A11 VanDerWaalsContact C-N 3.33Å
12	L	49.8	Very low	60.1	Low	158 Å²	158	99.9 Å²	99.9	83%	0.827	59%	0.594	S	S	*	*	H	α-helix	trans	-84	-18.7	-178.5	-73.2	164.8	0	0	0	113.4
13	R	47.5	Very low	62.6	Low	233 Å²	233	94.9 Å²	94.9	88%	0.879	55%	0.553	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.2	1	-179.4	-148.8	175.7	-175.2	-137.1	1	114.3
14	R	56.4	Low	65	Low	168 Å²	168	96.5 Å²	96.5	63%	0.634	54%	0.539	S	S	*	.	S	Bend	trans	-108.8	56.6	-167.5	-153.8	-170.9	-164.6	172.6	5.7	113.7	Q18	R14-Q18 WeakPolarHBondContact O-CG 3.45Å
15	S	56.4	Low	67	Low	82 Å²	82	98 Å²	98	57%	0.573	53%	0.527	S	S	*	.			trans	175.5	71.3	153.9	53.3	0	0	0	0	114.4
16	I	56.7	Low	69	Low	173 Å²	173	94 Å²	94	89%	0.887	49%	0.493	S	S	*	.	S	Bend	trans	-88.9	-20.2	146.6	-58.1	174.1	0	0	0	109.3
17	N	67.4	Low	71.3	Confident	137 Å²	137	90.4 Å²	90.4	73%	0.733	46%	0.462	S	S	*	.	S	Bend	trans	-124.9	38.5	179.5	-60.9	-32.4	0	0	0	113.2
18	Q	80.1	Confident	73.1	Confident	50 Å²	50	88 Å²	88	23%	0.234	45%	0.453	C	S	.	.			trans	-93.8	135	168.2	-71.4	-67.5	-56	0	0	108.6	R14 V20	R14-Q18 WeakPolarHBondContact O-CG 3.45Å; Q18-V20 VanDerWaalsContact C-N 3.28Å; Q18-V20 HydrophobicContact CB-CG2 3.88Å; Q18-V20 PolarHBondContact O-N 3.15Å
19	P	91.3	Very high	75.2	Confident	12 Å²	12	89.3 Å²	89.3	8%	0.078	45%	0.452	C	S	.	.			trans	-74.7	85.3	179.8	31.5	-34.6	0	0	0	109.4	F67 S69 E70 L73	P19-F67 HydrophobicContact CB-CB 4.3Å; P19-F67 HydrophobicContact CG-CB 4.25Å; P19-F67 WeakPolarHBondContact CG-O 3.33Å; P19-F67 PolarHBondContact O-N 3.26Å; P19-S69 VanDerWaalsContact CB-O 3.29Å; P19-S69 WeakPolarHBondContact CB-O 3.41Å; P19-S69 WeakPolarHBondContact CG-O 3.41Å; P19-E70 HydrophobicContact CB-CG 4.33Å; P19-L73 HydrophobicContact CB-CB 3.85Å; P19-L73 HydrophobicContact CB-CD2 4.08Å
20	V	92.1	Very high	77.3	Confident	52 Å²	52	85.7 Å²	85.7	32%	0.315	42%	0.422	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.6	125.8	-177.4	-178.7	0	0	0	0	109.3	Q18 W64 V65 Q66	Q18-V20 VanDerWaalsContact C-N 3.28Å; Q18-V20 HydrophobicContact CB-CG2 3.88Å; Q18-V20 PolarHBondContact O-N 3.15Å; V20-W64 HydrophobicContact CG1-CB 3.89Å; V20-W64 HydrophobicContact CG1-CG 4.29Å; V20-V65 CarbonylContact C-O 3.57Å; V20-V65 WeakPolarHBondContact CA-O 3.38Å; V20-Q66 HydrophobicContact CG2-CB 4.11Å; V20-Q66 HydrophobicContact CG2-CG 4.03Å
21	A	92.4	Very high	79.4	Confident	1 Å²	1	84.2 Å²	84.2	1%	0.008	41%	0.409	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.9	135.1	169	0	0	0	0	0	109.7	W64 V65 F67 L73	A21-W64 WeakPolarHBondContact O-CA 3.45Å; A21-V65 HydrophobicContact CB-CB 4.44Å; A21-V65 PolarHBondContact N-O 3.27Å; A21-V65 PolarHBondContact O-N 3.33Å; A21-F67 HydrophobicContact CB-CE2 4.19Å; A21-L73 HydrophobicContact CB-CD1 3.55Å
22	F	93.3	Very high	81.4	Confident	55 Å²	55	83.1 Å²	83.1	24%	0.241	40%	0.397	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.9	127.3	166.9	-178	-123.1	0	0	0	109.9	R24 L62 G63 W64 F91 F92	F22-R24 HydrophobicContact CD1-CG 4.01Å; F22-R24 HydrophobicContact CE1-CG 3.38Å; F22-R24 HydrophobicContact CZ-CG 3.72Å; F22-L62 HydrophobicContact CE2-CB 4.31Å; F22-L62 HydrophobicContact CE2-CD1 4.28Å; F22-L62 HydrophobicContact CZ-CB 4.3Å; F22-G63 WeakPolarHBondContact CD2-O 2.97Å; F22-W64 AromaticContact CD2-CD1 3.81Å; F22-W64 HydrophobicContact CD2-CD2 4.22Å; F22-W64 AromaticContact CD2-CE2 3.63Å; F22-W64 HydrophobicContact CD2-CG 4.33Å; F22-W64 HydrophobicContact CD2-CZ2 4.06Å; F22-W64 AromaticContact CD2-NE1 3.35Å; F22-W64 HydrophobicContact CE2-CD2 4.47Å; F22-W64 AromaticContact CE2-CE2 3.77Å; F22-W64 HydrophobicContact CE2-CH2 4.38Å; F22-W64 AromaticContact CE2-CZ2 3.72Å; F22-W64 HydrophobicContact CE2-CZ2 3.72Å; F22-W64 AromaticContact CE2-NE1 3.95Å; F22-F91 WeakPolarHBondContact O-CA 3.43Å; F22-F92 HydrophobicContact CD1-CB 4.13Å; F22-F92 HydrophobicContact CD1-CD2 4.14Å; F22-F92 HydrophobicContact CD1-CG 4.49Å; F22-F92 PolarHBondContact N-O 2.87Å; F22-F92 PolarHBondContact O-N 3.48Å; F22-F92 VanDerWaalsContact O-N 3.09Å
23	V	93.6	Very high	83.5	Confident	0 Å²	0	78.5 Å²	78.5	0%	0	38%	0.378	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.1	132.5	-176	-168.2	0	0	0	0	109.2	I26 F39 L62 G63 V65 C89 L90 F91	V23-I26 HydrophobicContact CB-CD1 4.09Å; V23-I26 HydrophobicContact CB-CG1 4.37Å; V23-I26 HydrophobicContact CG1-CD1 4.02Å; V23-I26 HydrophobicContact CG1-CG1 3.77Å; V23-F39 HydrophobicContact CG1-CZ 4.49Å; V23-F39 HydrophobicContact CG2-CE2 4.27Å; V23-F39 HydrophobicContact CG2-CZ 3.99Å; V23-L62 CarbonylContact O-C 3.44Å; V23-L62 WeakPolarHBondContact O-CA 3.43Å; V23-G63 PolarHBondContact N-O 2.82Å; V23-G63 PolarHBondContact O-N 3.45Å; V23-V65 HydrophobicContact CG2-CG2 3.92Å; V23-C89 HydrophobicContact CG1-CB 3.95Å; V23-L90 CarbonylContact C-O 3.47Å; V23-L90 WeakPolarHBondContact CA-O 3.34Å; V23-F91 HydrophobicContact CB-CE1 4.4Å; V23-F91 HydrophobicContact CG1-CE1 4.08Å; V23-F91 HydrophobicContact CG1-CE2 4.35Å; V23-F91 HydrophobicContact CG1-CZ 3.89Å; V23-F91 HydrophobicContact CG2-CD1 4.03Å; V23-F91 HydrophobicContact CG2-CE1 3.59Å; V23-F91 HydrophobicContact CG2-CZ 4.24Å
24	R	93.8	Very high	85.6	Confident	127 Å²	127	70.3 Å²	70.3	48%	0.479	35%	0.35	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.4	167.8	175.2	-61.3	-174	80.2	-173.5	-1.2	110.7	F22 I26 G61 L90 F92	F22-R24 HydrophobicContact CD1-CG 4.01Å; F22-R24 HydrophobicContact CE1-CG 3.38Å; F22-R24 HydrophobicContact CZ-CG 3.72Å; R24-I26 PolarHBondContact O-N 2.94Å; R24-G61 CarbonylContact C-O 3.55Å; R24-L90 HydrophobicContact CB-CB 4.31Å; R24-L90 PolarHBondContact N-O 3.4Å; R24-L90 PolarHBondContact O-N 2.87Å; R24-F92 HydrophobicContact CG-CD2 4.32Å; R24-F92 HydrophobicContact CG-CE2 4.24Å
25	R	94.1	Very high	87.4	Confident	145 Å²	145	62.4 Å²	62.4	55%	0.547	32%	0.32	S	S	.	.			trans	60.6	35.7	180	-159	176.4	-178.1	-98.2	-0.1	112	G61 V87 K88 L90	R25-G61 PolarHBondContact N-O 2.83Å; R25-V87 HydrophobicContact CG-CG1 4.38Å; R25-V87 WeakPolarHBondContact O-CG1 3.3Å; R25-K88 PolarHBondContact NH1-O 3.29Å; R25-L90 HydrophobicContact CB-CD1 4.49Å; R25-L90 HydrophobicContact CB-CG 4.33Å
26	I	94.2	Very high	89.2	Confident	7 Å²	7	63.4 Å²	63.4	4%	0.036	31%	0.314	C	S	.	.			trans	-73.2	128.1	175.1	-55.4	167.7	0	0	0	107.3	V23 R24 W28 A30 L35 L50 G61 L62	V23-I26 HydrophobicContact CB-CD1 4.09Å; V23-I26 HydrophobicContact CB-CG1 4.37Å; V23-I26 HydrophobicContact CG1-CD1 4.02Å; V23-I26 HydrophobicContact CG1-CG1 3.77Å; R24-I26 PolarHBondContact O-N 2.94Å; I26-W28 PolarHBondContact O-N 3.4Å; I26-A30 HydrophobicContact CG2-CB 4.01Å; I26-L35 HydrophobicContact CD1-CD2 3.86Å; I26-L35 HydrophobicContact CG2-CD1 3.89Å; I26-L50 HydrophobicContact CD1-CD2 3.49Å; I26-L50 VanDerWaalsContact CD1-CD2 3.49Å; I26-L50 HydrophobicContact CG2-CD2 4.39Å; I26-G61 PolarHBondContact N-O 3.5Å; I26-G61 WeakPolarHBondContact O-CA 3.24Å; I26-L62 VanDerWaalsContact CD1-C 3.45Å
27	P	93.3	Very high	91	Very high	13 Å²	13	62 Å²	62	8%	0.084	30%	0.304	C	S	.	.			trans	-60.4	138.2	176.5	24.8	-32.1	0	0	0	109.9	T29 A30 H59 I84 D85 V87	P27-T29 PolarHBondContact O-N 3.34Å; P27-T29 VanDerWaalsContact O-N 3.07Å; P27-A30 HydrophobicContact CG-CB 3.78Å; P27-A30 WeakPolarHBondContact O-CB 3.31Å; P27-A30 PolarHBondContact O-N 3.21Å; P27-H59 PolarHBondContact O-CE1 3.05Å; P27-H59 PolarHBondContact O-NE2 3.4Å; P27-I84 HydrophobicContact CG-CB 4.45Å; P27-I84 HydrophobicContact CG-CG2 4.28Å; P27-I84 WeakPolarHBondContact CG-O 3.47Å; P27-D85 HydrophobicContact CG-CB 4.14Å; P27-V87 HydrophobicContact CB-CB 4.11Å; P27-V87 HydrophobicContact CB-CG2 3.87Å; P27-V87 HydrophobicContact CG-CB 4.11Å; P27-V87 HydrophobicContact CG-CG2 4.34Å
28	W	90.3	Very high	92.3	Very high	164 Å²	164	57.5 Å²	57.5	62%	0.621	28%	0.279	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.5	-16	-176.8	60.8	-91	0	0	0	113.9	I26 A30 F58 H59	I26-W28 PolarHBondContact O-N 3.4Å; W28-A30 VanDerWaalsContact C-N 3.33Å; W28-F58 AromaticContact CE3-CD1 3.79Å; W28-F58 HydrophobicContact CE3-CD1 3.79Å; W28-F58 AromaticContact CE3-CE1 3.52Å; W28-F58 HydrophobicContact CE3-CE1 3.52Å; W28-F58 HydrophobicContact CE3-CG 4.47Å; W28-F58 AromaticContact CE3-CZ 3.98Å; W28-F58 HydrophobicContact CE3-CZ 3.98Å; W28-F58 HydrophobicContact CZ3-CD1 4.44Å; W28-F58 AromaticContact CZ3-CE1 3.71Å; W28-F58 HydrophobicContact CZ3-CE1 3.71Å; W28-F58 AromaticContact CZ3-CZ 3.93Å; W28-F58 HydrophobicContact CZ3-CZ 3.93Å; W28-H59 WeakPolarHBondContact CA-NE2 3.37Å; W28-H59 PolarHBondContact O-NE2 3.1Å
29	T	90.8	Very high	93	Very high	75 Å²	75	55.1 Å²	55.1	46%	0.46	27%	0.267	S	S	.	.	T	Hydrogen-bonded Turn	trans	-77.9	-17.4	173.6	55.2	0	0	0	0	112.9	P27 D85	P27-T29 PolarHBondContact O-N 3.34Å; P27-T29 VanDerWaalsContact O-N 3.07Å; T29-D85 PolarHBondContact OG1-OD2 2.9Å
30	A	92.6	Very high	93.2	Very high	2 Å²	2	57.2 Å²	57.2	2%	0.017	29%	0.286	C	S	.	.			trans	-86.9	126.8	-172.2	0	0	0	0	0	113.4	I26 P27 W28 L35 H59 I84	I26-A30 HydrophobicContact CG2-CB 4.01Å; P27-A30 HydrophobicContact CG-CB 3.78Å; P27-A30 WeakPolarHBondContact O-CB 3.31Å; P27-A30 PolarHBondContact O-N 3.21Å; W28-A30 VanDerWaalsContact C-N 3.33Å; A30-L35 HydrophobicContact CB-CD1 4.13Å; A30-H59 PolarHBondContact O-CD2 3.41Å; A30-H59 VanDerWaalsContact O-CD2 3.25Å; A30-H59 PolarHBondContact O-NE2 3.22Å; A30-I84 HydrophobicContact CB-CG2 3.82Å
31	A	91.8	Very high	93.4	Very high	39 Å²	39	60.9 Å²	60.9	32%	0.322	30%	0.299	S	S	.	.			trans	-89.1	166.4	175	0	0	0	0	0	112.7	S33 Q34 L35	A31-S33 PolarHBondContact O-N 3.41Å; A31-Q34 PolarHBondContact O-N 2.83Å; A31-L35 WeakPolarHBondContact O-CD1 3.31Å; A31-L35 PolarHBondContact O-N 3.16Å
32	S	91.7	Very high	93.5	Very high	53 Å²	53	62.2 Å²	62.2	37%	0.371	31%	0.305	S	S	.	.	H	α-helix	trans	-62.8	-26.5	177.1	56.2	0	0	0	0	112.7	K36 L50	S32-K36 WeakPolarHBondContact O-CB 3.41Å; S32-K36 PolarHBondContact O-N 3.09Å; S32-L50 VanDerWaalsContact CA-CD1 3.45Å
33	S	92.8	Very high	93.6	Very high	61 Å²	61	60.5 Å²	60.5	43%	0.427	30%	0.303	S	S	.	.	H	α-helix	trans	-64.5	-49.3	172.9	48.7	0	0	0	0	111.8	A31 L35 K36 E37	A31-S33 PolarHBondContact O-N 3.41Å; S33-L35 VanDerWaalsContact C-N 3.32Å; S33-L35 PolarHBondContact O-N 3.35Å; S33-K36 WeakPolarHBondContact O-CA 3.03Å; S33-K36 WeakPolarHBondContact O-CB 3.41Å; S33-K36 PolarHBondContact O-N 2.84Å; S33-E37 WeakPolarHBondContact O-CG 3.43Å; S33-E37 PolarHBondContact O-N 3.48Å
34	Q	93.6	Very high	93.7	Very high	61 Å²	61	67 Å²	67	29%	0.285	33%	0.333	S	S	.	.	H	α-helix	trans	-62	-40	177.4	-72.7	167.2	-64.6	0	0	111.5	A31 E37 H38 D85	A31-Q34 PolarHBondContact O-N 2.83Å; Q34-E37 PolarHBondContact O-N 3.47Å; Q34-H38 VanDerWaalsContact O-CB 3.31Å; Q34-H38 WeakPolarHBondContact O-CB 3.37Å; Q34-H38 PolarHBondContact O-N 3.4Å; Q34-D85 PolarHBondContact NE2-OD1 2.97Å
35	L	93.1	Very high	93.8	Very high	1 Å²	1	61.1 Å²	61.1	1%	0.005	31%	0.312	C	S	.	.	H	α-helix	trans	-60.1	-48.5	171.4	-89.5	75.2	0	0	0	110.7	I26 A30 A31 S33 E37 H38 F39 L50 V65 I84	I26-L35 HydrophobicContact CD1-CD2 3.86Å; I26-L35 HydrophobicContact CG2-CD1 3.89Å; A30-L35 HydrophobicContact CB-CD1 4.13Å; A31-L35 WeakPolarHBondContact O-CD1 3.31Å; A31-L35 PolarHBondContact O-N 3.16Å; S33-L35 VanDerWaalsContact C-N 3.32Å; S33-L35 PolarHBondContact O-N 3.35Å; L35-E37 VanDerWaalsContact C-N 3.32Å; L35-E37 PolarHBondContact O-N 3.5Å; L35-H38 PolarHBondContact O-N 3Å; L35-F39 HydrophobicContact CB-CD2 4.15Å; L35-F39 HydrophobicContact CB-CE2 4.11Å; L35-F39 HydrophobicContact CD2-CE2 4.18Å; L35-F39 HydrophobicContact CG-CE2 4Å; L35-F39 WeakPolarHBondContact O-CB 3.48Å; L35-F39 WeakPolarHBondContact O-CD2 2.94Å; L35-F39 PolarHBondContact O-N 3.32Å; L35-L50 HydrophobicContact CD1-CD1 4.36Å; L35-L50 HydrophobicContact CD2-CD2 4.1Å; L35-V65 HydrophobicContact CD2-CG2 4.33Å; L35-I84 HydrophobicContact CD1-CD1 4.07Å; L35-I84 HydrophobicContact CG-CD1 3.98Å
36	K	94.4	Very high	93.8	Very high	104 Å²	104	60.5 Å²	60.5	45%	0.452	31%	0.309	S	S	.	.	H	α-helix	trans	-58.9	-44.9	-179.4	-171.9	-177.9	179.2	-175.4	0	111.7	S32 S33 F39 A40 V45	S32-K36 WeakPolarHBondContact O-CB 3.41Å; S32-K36 PolarHBondContact O-N 3.09Å; S33-K36 WeakPolarHBondContact O-CA 3.03Å; S33-K36 WeakPolarHBondContact O-CB 3.41Å; S33-K36 PolarHBondContact O-N 2.84Å; K36-F39 PolarHBondContact O-N 2.85Å; K36-A40 WeakPolarHBondContact O-CB 3.3Å; K36-A40 PolarHBondContact O-N 3.29Å; K36-V45 HydrophobicContact CG-CB 3.99Å; K36-V45 HydrophobicContact CG-CG1 3.96Å
37	E	95.3	Very high	93.6	Very high	142 Å²	142	67.4 Å²	67.4	66%	0.664	34%	0.335	S	S	*	.	H	α-helix	trans	-62.7	-48.1	176.9	-74.7	167.4	-161.9	0	0	111.2	S33 Q34 L35 F39 A40	S33-E37 WeakPolarHBondContact O-CG 3.43Å; S33-E37 PolarHBondContact O-N 3.48Å; Q34-E37 PolarHBondContact O-N 3.47Å; L35-E37 VanDerWaalsContact C-N 3.32Å; L35-E37 PolarHBondContact O-N 3.5Å; E37-F39 VanDerWaalsContact C-N 3.34Å; E37-F39 PolarHBondContact O-N 2.76Å; E37-A40 WeakPolarHBondContact O-CB 3.44Å; E37-A40 PolarHBondContact O-N 3.46Å
38	H	94.6	Very high	93.6	Very high	44 Å²	44	67.9 Å²	67.9	20%	0.204	34%	0.338	C	S	.	.	H	α-helix	trans	-59	-44.6	176.6	-175.9	73.5	0	0	0	111.9	Q34 L35 Q41 H82 I84	Q34-H38 VanDerWaalsContact O-CB 3.31Å; Q34-H38 WeakPolarHBondContact O-CB 3.37Å; Q34-H38 PolarHBondContact O-N 3.4Å; L35-H38 PolarHBondContact O-N 3Å; H38-Q41 PolarHBondContact CE1-NE2 3.41Å; H38-Q41 PolarHBondContact ND1-NE2 2.94Å; H38-Q41 VanDerWaalsContact O-CG 3.24Å; H38-Q41 WeakPolarHBondContact O-CG 3.35Å; H38-Q41 PolarHBondContact O-NE2 3.05Å; H38-H82 AromaticContact NE2-CG 3.87Å; H38-H82 AromaticContact NE2-ND1 3.4Å; H38-H82 PolarHBondContact NE2-ND1 3.17Å; H38-I84 HydrophobicContact CB-CD1 4.47Å
39	F	94.8	Very high	93.7	Very high	0 Å²	0	63.4 Å²	63.4	0%	0	33%	0.325	C	S	.	.	H	α-helix	trans	-80.8	-15.2	-177.2	-68.6	-63.8	0	0	0	114.1	V23 L35 K36 E37 Q41 F42 G43 V45 V65 F67 A76 H82 I84 F91	V23-F39 HydrophobicContact CG1-CZ 4.49Å; V23-F39 HydrophobicContact CG2-CE2 4.27Å; V23-F39 HydrophobicContact CG2-CZ 3.99Å; L35-F39 HydrophobicContact CB-CD2 4.15Å; L35-F39 HydrophobicContact CB-CE2 4.11Å; L35-F39 HydrophobicContact CD2-CE2 4.18Å; L35-F39 HydrophobicContact CG-CE2 4Å; L35-F39 WeakPolarHBondContact O-CB 3.48Å; L35-F39 WeakPolarHBondContact O-CD2 2.94Å; L35-F39 PolarHBondContact O-N 3.32Å; K36-F39 PolarHBondContact O-N 2.85Å; E37-F39 VanDerWaalsContact C-N 3.34Å; E37-F39 PolarHBondContact O-N 2.76Å; F39-Q41 PolarHBondContact O-N 3.46Å; F39-Q41 VanDerWaalsContact O-N 3.15Å; F39-F42 AromaticContact CD1-CD2 3.91Å; F39-F42 HydrophobicContact CD1-CD2 3.91Å; F39-F42 HydrophobicContact CD1-CE2 4.07Å; F39-F42 PolarHBondContact O-N 3.22Å; F39-G43 PolarHBondContact O-N 2.9Å; F39-V45 HydrophobicContact CB-CG2 3.63Å; F39-V65 HydrophobicContact CB-CG1 3.94Å; F39-V65 HydrophobicContact CD2-CB 4.23Å; F39-V65 HydrophobicContact CD2-CG1 3.82Å; F39-V65 HydrophobicContact CD2-CG2 3.55Å; F39-V65 HydrophobicContact CE2-CG2 3.6Å; F39-V65 HydrophobicContact CG-CG1 3.93Å; F39-V65 HydrophobicContact CG-CG2 4.37Å; F39-V65 HydrophobicContact CZ-CG2 4.4Å; F39-F67 HydrophobicContact CB-CE1 4.14Å; F39-F67 HydrophobicContact CB-CZ 3.87Å; F39-F67 HydrophobicContact CD1-CZ 4.16Å; F39-F67 HydrophobicContact CG-CZ 4.24Å; F39-A76 HydrophobicContact CD1-CB 4.47Å; F39-H82 AromaticContact CE1-CE1 3.94Å; F39-H82 AromaticContact CE1-ND1 3.68Å; F39-I84 HydrophobicContact CE2-CD1 4.49Å; F39-F91 AromaticContact CE1-CE1 3.31Å; F39-F91 HydrophobicContact CE1-CE1 3.31Å; F39-F91 AromaticContact CE1-CZ 3.53Å; F39-F91 HydrophobicContact CE1-CZ 3.53Å; F39-F91 AromaticContact CZ-CE1 3.38Å; F39-F91 HydrophobicContact CZ-CE1 3.38Å; F39-F91 AromaticContact CZ-CZ 3.42Å; F39-F91 HydrophobicContact CZ-CZ 3.42Å; F39-F91 VanDerWaalsContact CZ-CZ 3.42Å
40	A	95.3	Very high	93.8	Very high	56 Å²	56	60.4 Å²	60.4	46%	0.463	31%	0.307	S	S	.	.	H	α-helix	trans	-60.1	-24.1	176.7	0	0	0	0	0	112.9	K36 E37 F42 G43	K36-A40 WeakPolarHBondContact O-CB 3.3Å; K36-A40 PolarHBondContact O-N 3.29Å; E37-A40 WeakPolarHBondContact O-CB 3.44Å; E37-A40 PolarHBondContact O-N 3.46Å; A40-F42 VanDerWaalsContact C-N 3.27Å; A40-F42 PolarHBondContact O-N 2.84Å; A40-G43 WeakPolarHBondContact CA-O 3.47Å; A40-G43 PolarHBondContact O-N 3.4Å
41	Q	95.6	Very high	93.7	Very high	129 Å²	129	62 Å²	62	60%	0.603	32%	0.317	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.3	-24.9	176.1	77.5	-169.6	-58.4	0	0	113.5	H38 F39	H38-Q41 PolarHBondContact CE1-NE2 3.41Å; H38-Q41 PolarHBondContact ND1-NE2 2.94Å; H38-Q41 VanDerWaalsContact O-CG 3.24Å; H38-Q41 WeakPolarHBondContact O-CG 3.35Å; H38-Q41 PolarHBondContact O-NE2 3.05Å; F39-Q41 PolarHBondContact O-N 3.46Å; F39-Q41 VanDerWaalsContact O-N 3.15Å
42	F	95.5	Very high	93.6	Very high	28 Å²	28	66.2 Å²	66.2	12%	0.123	33%	0.328	C	S	.	.	T	Hydrogen-bonded Turn	trans	-92.3	-23.5	-179.9	-53.5	-69.8	0	0	0	112	F39 A40 F67 G72 N75 A76 Q79 H82	F39-F42 AromaticContact CD1-CD2 3.91Å; F39-F42 HydrophobicContact CD1-CD2 3.91Å; F39-F42 HydrophobicContact CD1-CE2 4.07Å; F39-F42 PolarHBondContact O-N 3.22Å; A40-F42 VanDerWaalsContact C-N 3.27Å; A40-F42 PolarHBondContact O-N 2.84Å; F42-F67 HydrophobicContact CB-CE1 4.26Å; F42-G72 VanDerWaalsContact O-CA 3.31Å; F42-G72 WeakPolarHBondContact O-CA 3.41Å; F42-N75 HydrophobicContact CB-CB 3.93Å; F42-N75 HydrophobicContact CD1-CB 4.29Å; F42-N75 PolarHBondContact O-ND2 3.17Å; F42-A76 HydrophobicContact CB-CB 4.07Å; F42-A76 HydrophobicContact CD2-CB 4.02Å; F42-A76 HydrophobicContact CG-CB 3.99Å; F42-Q79 HydrophobicContact CE1-CB 3.95Å; F42-Q79 HydrophobicContact CE1-CG 4.15Å; F42-Q79 HydrophobicContact CZ-CB 4.16Å; F42-Q79 HydrophobicContact CZ-CG 4.02Å; F42-H82 AromaticContact CE2-CE1 3.51Å; F42-H82 AromaticContact CE2-ND1 3.54Å; F42-H82 AromaticContact CZ-CE1 3.57Å; F42-H82 AromaticContact CZ-ND1 3.69Å
43	G	95.2	Very high	93.6	Very high	20 Å²	20	66.1 Å²	66.1	21%	0.206	32%	0.323	C	S	.	.	S	Bend	trans	166.6	175.7	176	0	0	0	0	0	112.7	F39 A40 V45	F39-G43 PolarHBondContact O-N 2.9Å; A40-G43 WeakPolarHBondContact CA-O 3.47Å; A40-G43 PolarHBondContact O-N 3.4Å; G43-V45 PolarHBondContact O-N 2.85Å; G43-V45 VanDerWaalsContact O-N 3.1Å
44	H	96	Very high	93.5	Very high	137 Å²	137	73 Å²	73	63%	0.634	35%	0.346	S	S	*	.			trans	-68.3	111.9	-178.4	-173.7	58.4	0	0	0	112.1	F67 S68	H44-F67 CarbonylContact O-C 3.59Å; H44-S68 PolarHBondContact CD2-OG 3.01Å; H44-S68 WeakPolarHBondContact O-CB 3.35Å; H44-S68 PolarHBondContact O-N 3.18Å; H44-S68 PolarHBondContact O-OG 2.69Å
45	V	95.5	Very high	93.4	Very high	3 Å²	3	79 Å²	79	2%	0.018	37%	0.373	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.5	117.5	178.1	-178.5	0	0	0	0	110.8	K36 F39 G43 C48 V65 Q66 F67	K36-V45 HydrophobicContact CG-CB 3.99Å; K36-V45 HydrophobicContact CG-CG1 3.96Å; F39-V45 HydrophobicContact CB-CG2 3.63Å; G43-V45 PolarHBondContact O-N 2.85Å; G43-V45 VanDerWaalsContact O-N 3.1Å; V45-C48 VanDerWaalsContact CG1-SG 3.58Å; V45-V65 HydrophobicContact CG1-CG1 3.79Å; V45-V65 HydrophobicContact CG2-CG1 4.16Å; V45-Q66 CarbonylContact C-O 3.59Å; V45-F67 HydrophobicContact CG2-CD1 4.16Å; V45-F67 HydrophobicContact CG2-CE1 3.88Å
46	R	93.7	Very high	93.2	Very high	132 Å²	132	82.8 Å²	82.8	50%	0.498	40%	0.397	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.8	-44.8	176.8	-59.7	-170.5	79.4	171.4	9.5	112	Q66 S68	R46-Q66 HydrophobicContact CB-CG 4.29Å; R46-Q66 PolarHBondContact N-O 2.99Å; R46-S68 WeakPolarHBondContact CG-OG 3.32Å
47	R	89.9	Confident	92.9	Very high	152 Å²	152	80.2 Å²	80.2	57%	0.574	40%	0.4	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-155.6	138.6	-171.3	-167.9	175.7	-178.2	177.8	0.1	111.2	I49 Q66	R47-I49 HydrophobicContact CG-CG1 4.05Å; R47-Q66 HydrophobicContact CB-CB 4.23Å; R47-Q66 PolarHBondContact N-O 3.24Å; R47-Q66 PolarHBondContact O-N 2.86Å
48	C	93	Very high	92.6	Very high	22 Å²	22	78.1 Å²	78.1	15%	0.149	39%	0.389	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115	134.4	166	-64.6	0	0	0	0	108.7	V45 W64	V45-C48 VanDerWaalsContact CG1-SG 3.58Å; C48-W64 CarbonylContact C-O 3.55Å; C48-W64 WeakPolarHBondContact CA-O 3.46Å
49	I	91.9	Very high	92.5	Very high	70 Å²	70	76.6 Å²	76.6	36%	0.359	38%	0.382	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.2	119.6	177.3	-55.9	175.9	0	0	0	108.3	R47 G63 W64	R47-I49 HydrophobicContact CG-CG1 4.05Å; I49-G63 CarbonylContact O-C 3.47Å; I49-G63 WeakPolarHBondContact O-CA 3.36Å; I49-W64 HydrophobicContact CB-CE3 4.37Å; I49-W64 HydrophobicContact CG2-CE3 4.26Å; I49-W64 PolarHBondContact N-O 3.11Å; I49-W64 PolarHBondContact O-N 3.16Å
50	L	93.4	Very high	92.3	Very high	13 Å²	13	84.6 Å²	84.6	7%	0.068	41%	0.412	C	S	.	.			trans	-119.2	107.1	173.2	-74.1	166.1	0	0	0	107.6	I26 S32 L35 F52 H59 L62	I26-L50 HydrophobicContact CD1-CD2 3.49Å; I26-L50 VanDerWaalsContact CD1-CD2 3.49Å; I26-L50 HydrophobicContact CG2-CD2 4.39Å; S32-L50 VanDerWaalsContact CA-CD1 3.45Å; L35-L50 HydrophobicContact CD1-CD1 4.36Å; L35-L50 HydrophobicContact CD2-CD2 4.1Å; L50-F52 HydrophobicContact CB-CE2 4.33Å; L50-F52 WeakPolarHBondContact O-CD2 3.47Å; L50-F52 VanDerWaalsContact O-CE2 3.31Å; L50-F52 WeakPolarHBondContact O-CE2 3.46Å; L50-F52 PolarHBondContact O-N 3.22Å; L50-H59 HydrophobicContact CB-CB 4.06Å; L50-L62 WeakPolarHBondContact CD2-O 3.36Å
51	P	90.6	Very high	92.2	Very high	36 Å²	36	82.8 Å²	82.8	23%	0.234	40%	0.399	C	S	.	.	P	Polyproline II helix	trans	-67.4	125.8	174.6	25.2	-31.9	0	0	0	110.3	H59 R60 L62 W64	P51-H59 VanDerWaalsContact O-CA 3.3Å; P51-H59 WeakPolarHBondContact O-CA 3.43Å; P51-R60 PolarHBondContact O-N 3.35Å; P51-L62 WeakPolarHBondContact CD-O 3.21Å; P51-L62 HydrophobicContact CG-CD1 3.36Å; P51-L62 HydrophobicContact CG-CG 4.22Å; P51-W64 HydrophobicContact CG-CZ3 3.93Å
52	F	90.6	Very high	92.1	Very high	126 Å²	126	78.3 Å²	78.3	55%	0.553	38%	0.379	S	S	*	.	B	Isolated β-bridge	trans	-87	141.5	175.1	-70.5	-93.5	0	0	0	111.4	L50 G57 H59	L50-F52 HydrophobicContact CB-CE2 4.33Å; L50-F52 WeakPolarHBondContact O-CD2 3.47Å; L50-F52 VanDerWaalsContact O-CE2 3.31Å; L50-F52 WeakPolarHBondContact O-CE2 3.46Å; L50-F52 PolarHBondContact O-N 3.22Å; F52-G57 WeakPolarHBondContact CD1-O 3.48Å; F52-H59 HydrophobicContact CD1-CB 4.21Å; F52-H59 HydrophobicContact CE1-CB 4.19Å; F52-H59 HydrophobicContact CZ-CB 4.49Å
53	D	90.1	Very high	92	Very high	51 Å²	51	77 Å²	77	27%	0.273	37%	0.373	S	S	.	.	P	Polyproline II helix	trans	-80.7	127.2	163.9	-169.9	-40.4	0	0	0	108.4	E55 T56 G57 F58 R60	D53-E55 VanDerWaalsContact C-N 3.33Å; D53-E55 PolarHBondContact OD1-N 3.41Å; D53-T56 WeakPolarHBondContact CB-OG1 3.29Å; D53-T56 PolarHBondContact OD1-N 2.87Å; D53-G57 WeakPolarHBondContact O-CA 3.41Å; D53-G57 PolarHBondContact O-N 3.34Å; D53-F58 WeakPolarHBondContact CB-O 3.39Å; D53-F58 PolarHBondContact N-O 3.17Å; D53-R60 HydrophobicContact CB-CG 4.27Å
54	K	90.8	Very high	92	Very high	207 Å²	207	81 Å²	81	90%	0.9	38%	0.382	S	S	*	.	T	Hydrogen-bonded Turn	trans	-75.5	-23.8	-176.2	-66	-175.8	179.2	-176.6	0	112.7
55	E	91.5	Very high	91.9	Very high	185 Å²	185	74.5 Å²	74.5	86%	0.864	35%	0.352	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.4	-44.3	-178.1	-59.2	-172.4	126.6	0	0	110.5	D53	D53-E55 VanDerWaalsContact C-N 3.33Å; D53-E55 PolarHBondContact OD1-N 3.41Å
56	T	89.5	Confident	91.8	Very high	81 Å²	81	76.4 Å²	76.4	50%	0.497	36%	0.361	S	S	.	.	T	Hydrogen-bonded Turn	trans	-89.8	-21	-177.7	70.1	0	0	0	0	113.3	D53 F58	D53-T56 WeakPolarHBondContact CB-OG1 3.29Å; D53-T56 PolarHBondContact OD1-N 2.87Å; T56-F58 WeakPolarHBondContact O-CD2 3.17Å; T56-F58 PolarHBondContact O-N 3.17Å; T56-F58 PolarHBondContact OG1-N 3.47Å
57	G	88.4	Confident	91.9	Very high	50 Å²	50	70.2 Å²	70.2	52%	0.515	34%	0.338	S	S	.	.	S	Bend	trans	75.6	-2.5	-173.2	0	0	0	0	0	114.3	F52 D53	F52-G57 WeakPolarHBondContact CD1-O 3.48Å; D53-G57 WeakPolarHBondContact O-CA 3.41Å; D53-G57 PolarHBondContact O-N 3.34Å
58	F	89.5	Confident	92	Very high	98 Å²	98	65.7 Å²	65.7	43%	0.43	33%	0.329	S	S	.	.	S	Bend	trans	-98.2	158.3	179	-62.8	-68.1	0	0	0	112	W28 D53 T56	W28-F58 AromaticContact CE3-CD1 3.79Å; W28-F58 HydrophobicContact CE3-CD1 3.79Å; W28-F58 AromaticContact CE3-CE1 3.52Å; W28-F58 HydrophobicContact CE3-CE1 3.52Å; W28-F58 HydrophobicContact CE3-CG 4.47Å; W28-F58 AromaticContact CE3-CZ 3.98Å; W28-F58 HydrophobicContact CE3-CZ 3.98Å; W28-F58 HydrophobicContact CZ3-CD1 4.44Å; W28-F58 AromaticContact CZ3-CE1 3.71Å; W28-F58 HydrophobicContact CZ3-CE1 3.71Å; W28-F58 AromaticContact CZ3-CZ 3.93Å; W28-F58 HydrophobicContact CZ3-CZ 3.93Å; D53-F58 WeakPolarHBondContact CB-O 3.39Å; D53-F58 PolarHBondContact N-O 3.17Å; T56-F58 WeakPolarHBondContact O-CD2 3.17Å; T56-F58 PolarHBondContact O-N 3.17Å; T56-F58 PolarHBondContact OG1-N 3.47Å
59	H	92.4	Very high	92.1	Very high	13 Å²	13	67 Å²	67	6%	0.06	34%	0.338	C	S	.	.	B	Isolated β-bridge	trans	-74.1	154.6	172.5	67.4	80.4	0	0	0	111.9	P27 W28 A30 L50 P51 F52 G61	P27-H59 PolarHBondContact O-CE1 3.05Å; P27-H59 PolarHBondContact O-NE2 3.4Å; W28-H59 WeakPolarHBondContact CA-NE2 3.37Å; W28-H59 PolarHBondContact O-NE2 3.1Å; A30-H59 PolarHBondContact O-CD2 3.41Å; A30-H59 VanDerWaalsContact O-CD2 3.25Å; A30-H59 PolarHBondContact O-NE2 3.22Å; L50-H59 HydrophobicContact CB-CB 4.06Å; P51-H59 VanDerWaalsContact O-CA 3.3Å; P51-H59 WeakPolarHBondContact O-CA 3.43Å; F52-H59 HydrophobicContact CD1-CB 4.21Å; F52-H59 HydrophobicContact CE1-CB 4.19Å; F52-H59 HydrophobicContact CZ-CB 4.49Å; H59-G61 PolarHBondContact ND1-N 2.84Å; H59-G61 PolarHBondContact O-N 3.48Å
60	R	90.9	Very high	92.2	Very high	167 Å²	167	68.4 Å²	68.4	63%	0.63	34%	0.344	S	S	*	.			trans	-76.4	22.7	-173.2	-60.4	178.9	71.5	-168	3.3	114.5	P51 D53 L62	P51-R60 PolarHBondContact O-N 3.35Å; D53-R60 HydrophobicContact CB-CG 4.27Å; R60-L62 HydrophobicContact CB-CD2 4.14Å; R60-L62 HydrophobicContact CB-CG 4.12Å; R60-L62 PolarHBondContact O-N 2.77Å; R60-L62 VanDerWaalsContact O-N 3.12Å
61	G	92.1	Very high	92.2	Very high	19 Å²	19	74.2 Å²	74.2	20%	0.196	37%	0.371	C	S	.	.	S	Bend	trans	61.2	18.5	-176.4	0	0	0	0	0	115.2	R24 R25 I26 H59	R24-G61 CarbonylContact C-O 3.55Å; R25-G61 PolarHBondContact N-O 2.83Å; I26-G61 PolarHBondContact N-O 3.5Å; I26-G61 WeakPolarHBondContact O-CA 3.24Å; H59-G61 PolarHBondContact ND1-N 2.84Å; H59-G61 PolarHBondContact O-N 3.48Å
62	L	93.6	Very high	92.4	Very high	35 Å²	35	72.6 Å²	72.6	18%	0.183	36%	0.36	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.3	156.9	-180	63.8	91.1	0	0	0	110.4	F22 V23 I26 L50 P51 R60 W64	F22-L62 HydrophobicContact CE2-CB 4.31Å; F22-L62 HydrophobicContact CE2-CD1 4.28Å; F22-L62 HydrophobicContact CZ-CB 4.3Å; V23-L62 CarbonylContact O-C 3.44Å; V23-L62 WeakPolarHBondContact O-CA 3.43Å; I26-L62 VanDerWaalsContact CD1-C 3.45Å; L50-L62 WeakPolarHBondContact CD2-O 3.36Å; P51-L62 WeakPolarHBondContact CD-O 3.21Å; P51-L62 HydrophobicContact CG-CD1 3.36Å; P51-L62 HydrophobicContact CG-CG 4.22Å; R60-L62 HydrophobicContact CB-CD2 4.14Å; R60-L62 HydrophobicContact CB-CG 4.12Å; R60-L62 PolarHBondContact O-N 2.77Å; R60-L62 VanDerWaalsContact O-N 3.12Å; L62-W64 HydrophobicContact CD1-CH2 3.79Å; L62-W64 HydrophobicContact CD1-CZ3 3.91Å
63	G	93.1	Very high	92.6	Very high	0 Å²	0	68 Å²	68	0%	0	34%	0.341	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-171.7	173.8	-179.8	0	0	0	0	0	114.2	F22 V23 I49	F22-G63 WeakPolarHBondContact CD2-O 2.97Å; V23-G63 PolarHBondContact N-O 2.82Å; V23-G63 PolarHBondContact O-N 3.45Å; I49-G63 CarbonylContact O-C 3.47Å; I49-G63 WeakPolarHBondContact O-CA 3.36Å
64	W	94.6	Very high	92.8	Very high	104 Å²	104	72.6 Å²	72.6	39%	0.394	36%	0.355	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.8	134.5	178	-64.6	-91	0	0	0	110.6	V20 A21 F22 C48 I49 P51 L62	V20-W64 HydrophobicContact CG1-CB 3.89Å; V20-W64 HydrophobicContact CG1-CG 4.29Å; A21-W64 WeakPolarHBondContact O-CA 3.45Å; F22-W64 AromaticContact CD2-CD1 3.81Å; F22-W64 HydrophobicContact CD2-CD2 4.22Å; F22-W64 AromaticContact CD2-CE2 3.63Å; F22-W64 HydrophobicContact CD2-CG 4.33Å; F22-W64 HydrophobicContact CD2-CZ2 4.06Å; F22-W64 AromaticContact CD2-NE1 3.35Å; F22-W64 HydrophobicContact CE2-CD2 4.47Å; F22-W64 AromaticContact CE2-CE2 3.77Å; F22-W64 HydrophobicContact CE2-CH2 4.38Å; F22-W64 AromaticContact CE2-CZ2 3.72Å; F22-W64 HydrophobicContact CE2-CZ2 3.72Å; F22-W64 AromaticContact CE2-NE1 3.95Å; C48-W64 CarbonylContact C-O 3.55Å; C48-W64 WeakPolarHBondContact CA-O 3.46Å; I49-W64 HydrophobicContact CB-CE3 4.37Å; I49-W64 HydrophobicContact CG2-CE3 4.26Å; I49-W64 PolarHBondContact N-O 3.11Å; I49-W64 PolarHBondContact O-N 3.16Å; P51-W64 HydrophobicContact CG-CZ3 3.93Å; L62-W64 HydrophobicContact CD1-CH2 3.79Å; L62-W64 HydrophobicContact CD1-CZ3 3.91Å
65	V	94.6	Very high	93	Very high	0 Å²	0	65.5 Å²	65.5	0%	0	33%	0.327	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.6	110.3	178.4	-177.4	0	0	0	0	108.2	V20 A21 V23 L35 F39 V45 F67	V20-V65 CarbonylContact C-O 3.57Å; V20-V65 WeakPolarHBondContact CA-O 3.38Å; A21-V65 HydrophobicContact CB-CB 4.44Å; A21-V65 PolarHBondContact N-O 3.27Å; A21-V65 PolarHBondContact O-N 3.33Å; V23-V65 HydrophobicContact CG2-CG2 3.92Å; L35-V65 HydrophobicContact CD2-CG2 4.33Å; F39-V65 HydrophobicContact CB-CG1 3.94Å; F39-V65 HydrophobicContact CD2-CB 4.23Å; F39-V65 HydrophobicContact CD2-CG1 3.82Å; F39-V65 HydrophobicContact CD2-CG2 3.55Å; F39-V65 HydrophobicContact CE2-CG2 3.6Å; F39-V65 HydrophobicContact CG-CG1 3.93Å; F39-V65 HydrophobicContact CG-CG2 4.37Å; F39-V65 HydrophobicContact CZ-CG2 4.4Å; V45-V65 HydrophobicContact CG1-CG1 3.79Å; V45-V65 HydrophobicContact CG2-CG1 4.16Å; V65-F67 HydrophobicContact CB-CE2 4.34Å; V65-F67 HydrophobicContact CG1-CD2 4.34Å; V65-F67 HydrophobicContact CG1-CE2 3.78Å; V65-F67 HydrophobicContact CG1-CZ 3.95Å
66	Q	93.6	Very high	93.1	Very high	44 Å²	44	56.7 Å²	56.7	21%	0.206	29%	0.286	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.4	116.8	178.3	-175.9	177.2	22.6	0	0	109.7	V20 V45 R46 R47	V20-Q66 HydrophobicContact CG2-CB 4.11Å; V20-Q66 HydrophobicContact CG2-CG 4.03Å; V45-Q66 CarbonylContact C-O 3.59Å; R46-Q66 HydrophobicContact CB-CG 4.29Å; R46-Q66 PolarHBondContact N-O 2.99Å; R47-Q66 HydrophobicContact CB-CB 4.23Å; R47-Q66 PolarHBondContact N-O 3.24Å; R47-Q66 PolarHBondContact O-N 2.86Å
67	F	95	Very high	93.2	Very high	1 Å²	1	56.7 Å²	56.7	0%	0.004	28%	0.282	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.2	166.7	171.9	-68.4	-88.3	0	0	0	111.4	P19 A21 F39 F42 H44 V45 V65 S69 L73 A76	P19-F67 HydrophobicContact CB-CB 4.3Å; P19-F67 HydrophobicContact CG-CB 4.25Å; P19-F67 WeakPolarHBondContact CG-O 3.33Å; P19-F67 PolarHBondContact O-N 3.26Å; A21-F67 HydrophobicContact CB-CE2 4.19Å; F39-F67 HydrophobicContact CB-CE1 4.14Å; F39-F67 HydrophobicContact CB-CZ 3.87Å; F39-F67 HydrophobicContact CD1-CZ 4.16Å; F39-F67 HydrophobicContact CG-CZ 4.24Å; F42-F67 HydrophobicContact CB-CE1 4.26Å; H44-F67 CarbonylContact O-C 3.59Å; V45-F67 HydrophobicContact CG2-CD1 4.16Å; V45-F67 HydrophobicContact CG2-CE1 3.88Å; V65-F67 HydrophobicContact CB-CE2 4.34Å; V65-F67 HydrophobicContact CG1-CD2 4.34Å; V65-F67 HydrophobicContact CG1-CE2 3.78Å; V65-F67 HydrophobicContact CG1-CZ 3.95Å; F67-S69 WeakPolarHBondContact CB-O 3.39Å; F67-L73 HydrophobicContact CD2-CB 4.06Å; F67-L73 HydrophobicContact CD2-CD1 4.37Å; F67-L73 HydrophobicContact CE2-CD1 4.46Å; F67-A76 HydrophobicContact CE2-CB 4.11Å; F67-A76 HydrophobicContact CZ-CB 3.78Å
68	S	93.6	Very high	93.5	Very high	57 Å²	57	61.6 Å²	61.6	40%	0.399	29%	0.292	S	S	.	.	S	Bend	trans	-86.5	-22.1	173.5	-55.1	0	0	0	0	113	H44 R46	H44-S68 PolarHBondContact CD2-OG 3.01Å; H44-S68 WeakPolarHBondContact O-CB 3.35Å; H44-S68 PolarHBondContact O-N 3.18Å; H44-S68 PolarHBondContact O-OG 2.69Å; R46-S68 WeakPolarHBondContact CG-OG 3.32Å
69	S	93.8	Very high	93.6	Very high	49 Å²	49	61.2 Å²	61.2	34%	0.343	29%	0.291	S	S	.	.	S	Bend	trans	-134.5	153.5	-178.4	60.6	0	0	0	0	110.7	P19 F67 E71 G72 L73	P19-S69 VanDerWaalsContact CB-O 3.29Å; P19-S69 WeakPolarHBondContact CB-O 3.41Å; P19-S69 WeakPolarHBondContact CG-O 3.41Å; F67-S69 WeakPolarHBondContact CB-O 3.39Å; S69-E71 VanDerWaalsContact C-N 3.25Å; S69-E71 PolarHBondContact O-N 3.34Å; S69-G72 PolarHBondContact O-N 2.84Å; S69-G72 PolarHBondContact OG-N 2.88Å; S69-L73 PolarHBondContact O-N 2.95Å
70	E	93.7	Very high	93.3	Very high	101 Å²	101	68.1 Å²	68.1	47%	0.472	32%	0.323	S	S	.	.	H	α-helix	trans	-62.9	-34.3	170.5	-72.8	-170.7	-170.2	0	0	112.3	P19 G72 L73 R74	P19-E70 HydrophobicContact CB-CG 4.33Å; E70-G72 VanDerWaalsContact C-N 3.29Å; E70-G72 PolarHBondContact O-N 2.86Å; E70-L73 WeakPolarHBondContact O-CB 3.35Å; E70-L73 PolarHBondContact O-N 2.85Å; E70-L73 VanDerWaalsContact O-N 3.17Å; E70-R74 WeakPolarHBondContact O-CG 3.45Å; E70-R74 PolarHBondContact O-N 2.8Å; E70-R74 IonicContact OE2-CZ 3.7Å; E70-R74 IonicContact OE2-NE 3.99Å; E70-R74 IonicContact OE2-NH2 2.82Å; E70-R74 PolarHBondContact OE2-NH2 2.87Å
71	E	94.9	Very high	93.2	Very high	135 Å²	135	63.1 Å²	63.1	63%	0.631	31%	0.309	S	S	*	.	H	α-helix	trans	-57.5	-43.8	175.5	-173.1	179.6	-178.3	0	0	111.3	S69 L73 R74 N75	S69-E71 VanDerWaalsContact C-N 3.25Å; S69-E71 PolarHBondContact O-N 3.34Å; E71-L73 VanDerWaalsContact C-N 3.3Å; E71-L73 PolarHBondContact O-N 3.48Å; E71-R74 PolarHBondContact O-N 3.01Å; E71-R74 VanDerWaalsContact O-N 3.16Å; E71-N75 WeakPolarHBondContact O-CB 3.22Å; E71-N75 PolarHBondContact O-N 3.25Å; E71-N75 PolarHBondContact O-ND2 2.91Å; E71-N75 PolarHBondContact O-OD1 3.07Å
72	G	95.1	Very high	93.2	Very high	2 Å²	2	62.3 Å²	62.3	2%	0.021	30%	0.3	C	S	.	.	H	α-helix	trans	-61.9	-38.4	177.1	0	0	0	0	0	113.4	F42 S69 E70 A76	F42-G72 VanDerWaalsContact O-CA 3.31Å; F42-G72 WeakPolarHBondContact O-CA 3.41Å; S69-G72 PolarHBondContact O-N 2.84Å; S69-G72 PolarHBondContact OG-N 2.88Å; E70-G72 VanDerWaalsContact C-N 3.29Å; E70-G72 PolarHBondContact O-N 2.86Å; G72-A76 PolarHBondContact O-N 3.45Å; G72-A76 VanDerWaalsContact O-N 3.16Å
73	L	94.2	Very high	93.2	Very high	29 Å²	29	65.4 Å²	65.4	15%	0.152	32%	0.316	C	S	.	.	H	α-helix	trans	-65.9	-47.1	172.7	173	63.4	0	0	0	111.5	P19 A21 F67 S69 E70 E71 N75 A76 L77	P19-L73 HydrophobicContact CB-CB 3.85Å; P19-L73 HydrophobicContact CB-CD2 4.08Å; A21-L73 HydrophobicContact CB-CD1 3.55Å; F67-L73 HydrophobicContact CD2-CB 4.06Å; F67-L73 HydrophobicContact CD2-CD1 4.37Å; F67-L73 HydrophobicContact CE2-CD1 4.46Å; S69-L73 PolarHBondContact O-N 2.95Å; E70-L73 WeakPolarHBondContact O-CB 3.35Å; E70-L73 PolarHBondContact O-N 2.85Å; E70-L73 VanDerWaalsContact O-N 3.17Å; E71-L73 VanDerWaalsContact C-N 3.3Å; E71-L73 PolarHBondContact O-N 3.48Å; L73-N75 PolarHBondContact O-N 2.91Å; L73-A76 PolarHBondContact O-N 3.49Å; L73-L77 HydrophobicContact CD1-CD1 3.88Å; L73-L77 HydrophobicContact CD1-CG 3.98Å; L73-L77 HydrophobicContact CD2-CD1 4.46Å; L73-L77 HydrophobicContact CG-CD1 3.87Å; L73-L77 HydrophobicContact CG-CG 4.36Å; L73-L77 WeakPolarHBondContact O-CG 3.41Å; L73-L77 PolarHBondContact O-N 2.96Å
74	R	94.1	Very high	93.2	Very high	147 Å²	147	65.8 Å²	65.8	56%	0.555	32%	0.318	S	S	*	.	H	α-helix	trans	-62.1	-43.5	-179.6	-70.8	178.1	-167.6	178.1	6.9	111.5	E70 E71 A76 L77 Q78	E70-R74 WeakPolarHBondContact O-CG 3.45Å; E70-R74 PolarHBondContact O-N 2.8Å; E70-R74 IonicContact OE2-CZ 3.7Å; E70-R74 IonicContact OE2-NE 3.99Å; E70-R74 IonicContact OE2-NH2 2.82Å; E70-R74 PolarHBondContact OE2-NH2 2.87Å; E71-R74 PolarHBondContact O-N 3.01Å; E71-R74 VanDerWaalsContact O-N 3.16Å; R74-A76 VanDerWaalsContact C-N 3.29Å; R74-A76 PolarHBondContact O-N 3.1Å; R74-L77 PolarHBondContact O-N 2.85Å; R74-Q78 WeakPolarHBondContact O-CB 3.42Å; R74-Q78 VanDerWaalsContact O-CG 3.3Å; R74-Q78 WeakPolarHBondContact O-CG 3.41Å; R74-Q78 PolarHBondContact O-N 3.02Å
75	N	95.1	Very high	93	Very high	58 Å²	58	64.9 Å²	64.9	31%	0.31	32%	0.321	S	S	.	.	H	α-helix	trans	-59.4	-41.9	175.9	-68.7	-11.3	0	0	0	111.2	F42 E71 L73	F42-N75 HydrophobicContact CB-CB 3.93Å; F42-N75 HydrophobicContact CD1-CB 4.29Å; F42-N75 PolarHBondContact O-ND2 3.17Å; E71-N75 WeakPolarHBondContact O-CB 3.22Å; E71-N75 PolarHBondContact O-N 3.25Å; E71-N75 PolarHBondContact O-ND2 2.91Å; E71-N75 PolarHBondContact O-OD1 3.07Å; L73-N75 PolarHBondContact O-N 2.91Å
76	A	94.1	Very high	92.8	Very high	0 Å²	0	68.2 Å²	68.2	0%	0	36%	0.355	C	S	.	.	H	α-helix	trans	-64.9	-47.2	174	0	0	0	0	0	111.3	F39 F42 F67 G72 L73 R74 Q78 Q79 H82	F39-A76 HydrophobicContact CD1-CB 4.47Å; F42-A76 HydrophobicContact CB-CB 4.07Å; F42-A76 HydrophobicContact CD2-CB 4.02Å; F42-A76 HydrophobicContact CG-CB 3.99Å; F67-A76 HydrophobicContact CE2-CB 4.11Å; F67-A76 HydrophobicContact CZ-CB 3.78Å; G72-A76 PolarHBondContact O-N 3.45Å; G72-A76 VanDerWaalsContact O-N 3.16Å; L73-A76 PolarHBondContact O-N 3.49Å; R74-A76 VanDerWaalsContact C-N 3.29Å; R74-A76 PolarHBondContact O-N 3.1Å; A76-Q78 VanDerWaalsContact C-N 3.3Å; A76-Q78 PolarHBondContact O-N 3.4Å; A76-Q79 WeakPolarHBondContact O-CB 3.31Å; A76-Q79 PolarHBondContact O-N 3.23Å; A76-Q79 VanDerWaalsContact O-N 3.17Å; A76-H82 PolarHBondContact O-CE1 2.86Å; A76-H82 VanDerWaalsContact O-CE1 3.24Å; A76-H82 PolarHBondContact O-NE2 3.21Å
77	L	91.8	Very high	92.7	Very high	81 Å²	81	68.1 Å²	68.1	42%	0.424	36%	0.358	S	S	.	.	H	α-helix	trans	-67.2	-26.5	-178.9	-68.5	173.5	0	0	0	114.2	L73 R74 Q79 F91	L73-L77 HydrophobicContact CD1-CD1 3.88Å; L73-L77 HydrophobicContact CD1-CG 3.98Å; L73-L77 HydrophobicContact CD2-CD1 4.46Å; L73-L77 HydrophobicContact CG-CD1 3.87Å; L73-L77 HydrophobicContact CG-CG 4.36Å; L73-L77 WeakPolarHBondContact O-CG 3.41Å; L73-L77 PolarHBondContact O-N 2.96Å; R74-L77 PolarHBondContact O-N 2.85Å; L77-Q79 VanDerWaalsContact C-N 3.27Å; L77-F91 HydrophobicContact CD2-CB 4.24Å
78	Q	92.8	Very high	92.6	Very high	154 Å²	154	72.1 Å²	72.1	72%	0.72	38%	0.375	S	S	*	.	H	α-helix	trans	-73.4	-21	175.7	-77.3	176.8	-7.7	0	0	112.8	R74 A76 E80	R74-Q78 WeakPolarHBondContact O-CB 3.42Å; R74-Q78 VanDerWaalsContact O-CG 3.3Å; R74-Q78 WeakPolarHBondContact O-CG 3.41Å; R74-Q78 PolarHBondContact O-N 3.02Å; A76-Q78 VanDerWaalsContact C-N 3.3Å; A76-Q78 PolarHBondContact O-N 3.4Å; Q78-E80 PolarHBondContact O-N 2.85Å
79	Q	91.9	Very high	92.4	Very high	89 Å²	89	69.5 Å²	69.5	42%	0.416	36%	0.357	S	S	.	.			trans	-74.6	116.8	178.4	177.8	65.2	10.4	0	0	110.2	F42 A76 L77 N81 H82	F42-Q79 HydrophobicContact CE1-CB 3.95Å; F42-Q79 HydrophobicContact CE1-CG 4.15Å; F42-Q79 HydrophobicContact CZ-CB 4.16Å; F42-Q79 HydrophobicContact CZ-CG 4.02Å; A76-Q79 WeakPolarHBondContact O-CB 3.31Å; A76-Q79 PolarHBondContact O-N 3.23Å; A76-Q79 VanDerWaalsContact O-N 3.17Å; L77-Q79 VanDerWaalsContact C-N 3.27Å; Q79-N81 VanDerWaalsContact C-N 3.29Å; Q79-N81 WeakPolarHBondContact CG-O 3.13Å; Q79-N81 PolarHBondContact NE2-O 2.85Å; Q79-N81 PolarHBondContact O-N 3.09Å; Q79-H82 PolarHBondContact O-NE2 2.78Å
80	E	86.1	Confident	92.2	Very high	158 Å²	158	71 Å²	71	74%	0.738	36%	0.36	S	S	*	.	S	Bend	trans	-67	-30.7	-176.2	-171.3	-176.4	-155.6	0	0	113.1	Q78	Q78-E80 PolarHBondContact O-N 2.85Å
81	N	90.2	Very high	91.7	Very high	62 Å²	62	68.1 Å²	68.1	33%	0.332	35%	0.346	S	S	.	.			trans	-133.4	110.9	-174.1	-61.2	-62.9	0	0	0	110.7	Q79 K88	Q79-N81 VanDerWaalsContact C-N 3.29Å; Q79-N81 WeakPolarHBondContact CG-O 3.13Å; Q79-N81 PolarHBondContact NE2-O 2.85Å; Q79-N81 PolarHBondContact O-N 3.09Å; N81-K88 WeakPolarHBondContact OD1-CE 3.35Å; N81-K88 PolarHBondContact OD1-NZ 3.36Å
82	H	92.1	Very high	90.3	Very high	2 Å²	2	69.5 Å²	69.5	1%	0.009	35%	0.351	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.1	120.5	162.2	-55.5	-99.9	0	0	0	108.9	H38 F39 F42 A76 Q79 K88 C89 F91	H38-H82 AromaticContact NE2-CG 3.87Å; H38-H82 AromaticContact NE2-ND1 3.4Å; H38-H82 PolarHBondContact NE2-ND1 3.17Å; F39-H82 AromaticContact CE1-CE1 3.94Å; F39-H82 AromaticContact CE1-ND1 3.68Å; F42-H82 AromaticContact CE2-CE1 3.51Å; F42-H82 AromaticContact CE2-ND1 3.54Å; F42-H82 AromaticContact CZ-CE1 3.57Å; F42-H82 AromaticContact CZ-ND1 3.69Å; A76-H82 PolarHBondContact O-CE1 2.86Å; A76-H82 VanDerWaalsContact O-CE1 3.24Å; A76-H82 PolarHBondContact O-NE2 3.21Å; Q79-H82 PolarHBondContact O-NE2 2.78Å; H82-K88 WeakPolarHBondContact O-CA 3.38Å; H82-C89 HydrophobicContact CB-CB 4.46Å; H82-C89 PolarHBondContact O-N 2.89Å; H82-F91 HydrophobicContact CB-CE2 3.43Å; H82-F91 VanDerWaalsContact CB-CE2 3.43Å; H82-F91 HydrophobicContact CB-CZ 3.52Å; H82-F91 AromaticContact CD2-CD2 3.38Å; H82-F91 WeakPolarHBondContact CD2-CD2 3.05Å; H82-F91 AromaticContact CD2-CE1 3.88Å; H82-F91 AromaticContact CD2-CE2 2.97Å; H82-F91 WeakPolarHBondContact CD2-CE2 3.36Å; H82-F91 AromaticContact CD2-CZ 3.21Å; H82-F91 WeakPolarHBondContact CD2-CZ 3.33Å; H82-F91 AromaticContact CG-CE2 3.32Å; H82-F91 AromaticContact CG-CZ 3.23Å; H82-F91 AromaticContact ND1-CZ 3.79Å; H82-F91 AromaticContact NE2-CD2 3.98Å; H82-F91 AromaticContact NE2-CE1 3.89Å; H82-F91 AromaticContact NE2-CE2 3.8Å; H82-F91 AromaticContact NE2-CZ 3.7Å
83	I	93.4	Very high	90.1	Very high	100 Å²	100	72.9 Å²	72.9	51%	0.513	37%	0.367	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.5	120.5	-178.9	-57.6	173.6	0	0	0	107.1	V87	I83-V87 WeakPolarHBondContact CA-O 3.32Å
84	I	92.8	Very high	89.9	Confident	9 Å²	9	75.2 Å²	75.2	5%	0.046	38%	0.379	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.3	126.8	175.7	-57.8	179.3	0	0	0	106.2	P27 A30 L35 H38 F39 G86 V87	P27-I84 HydrophobicContact CG-CB 4.45Å; P27-I84 HydrophobicContact CG-CG2 4.28Å; P27-I84 WeakPolarHBondContact CG-O 3.47Å; A30-I84 HydrophobicContact CB-CG2 3.82Å; L35-I84 HydrophobicContact CD1-CD1 4.07Å; L35-I84 HydrophobicContact CG-CD1 3.98Å; H38-I84 HydrophobicContact CB-CD1 4.47Å; F39-I84 HydrophobicContact CE2-CD1 4.49Å; I84-G86 PolarHBondContact O-N 2.78Å; I84-G86 VanDerWaalsContact O-N 3.11Å; I84-V87 PolarHBondContact N-O 3.12Å; I84-V87 PolarHBondContact O-N 3.31Å
85	D	90	Very high	89.6	Confident	85 Å²	85	71.2 Å²	71.2	46%	0.455	37%	0.369	S	S	.	.	T	Hydrogen-bonded Turn	trans	47.7	38.5	-175.3	-61.8	-11.1	0	0	0	113.7	P27 T29 Q34 V87	P27-D85 HydrophobicContact CG-CB 4.14Å; T29-D85 PolarHBondContact OG1-OD2 2.9Å; Q34-D85 PolarHBondContact NE2-OD1 2.97Å; D85-V87 PolarHBondContact O-N 3.29Å
86	G	89.9	Confident	89.3	Confident	69 Å²	69	72 Å²	72	71%	0.711	37%	0.372	S	S	*	.	T	Hydrogen-bonded Turn	trans	77	-0.8	-178.4	0	0	0	0	0	115.2	I84	I84-G86 PolarHBondContact O-N 2.78Å; I84-G86 VanDerWaalsContact O-N 3.11Å
87	V	91.8	Very high	89	Confident	43 Å²	43	76.5 Å²	76.5	26%	0.261	40%	0.395	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.9	124.9	177.5	179.2	0	0	0	0	110.6	R25 P27 I83 I84 D85 C89	R25-V87 HydrophobicContact CG-CG1 4.38Å; R25-V87 WeakPolarHBondContact O-CG1 3.3Å; P27-V87 HydrophobicContact CB-CB 4.11Å; P27-V87 HydrophobicContact CB-CG2 3.87Å; P27-V87 HydrophobicContact CG-CB 4.11Å; P27-V87 HydrophobicContact CG-CG2 4.34Å; I83-V87 WeakPolarHBondContact CA-O 3.32Å; I84-V87 PolarHBondContact N-O 3.12Å; I84-V87 PolarHBondContact O-N 3.31Å; D85-V87 PolarHBondContact O-N 3.29Å; V87-C89 PolarHBondContact O-N 2.97Å
88	K	92.8	Very high	88.8	Confident	84 Å²	84	76.2 Å²	76.2	37%	0.365	39%	0.394	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-69	113.1	169.8	-178.9	172.7	175	168.4	0	110.4	R25 N81 H82	R25-K88 PolarHBondContact NH1-O 3.29Å; N81-K88 WeakPolarHBondContact OD1-CE 3.35Å; N81-K88 PolarHBondContact OD1-NZ 3.36Å; H82-K88 WeakPolarHBondContact O-CA 3.38Å
89	C	90.8	Very high	88.5	Confident	3 Å²	3	70.6 Å²	70.6	2%	0.02	37%	0.37	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78	152.4	172.2	-65.7	0	0	0	0	110.7	V23 H82 V87 F91	V23-C89 HydrophobicContact CG1-CB 3.95Å; H82-C89 HydrophobicContact CB-CB 4.46Å; H82-C89 PolarHBondContact O-N 2.89Å; V87-C89 PolarHBondContact O-N 2.97Å; C89-F91 HydrophobicContact CB-CE2 3.72Å; C89-F91 HydrophobicContact CB-CZ 4.15Å
90	L	88.3	Confident	88.3	Confident	79 Å²	79	69.2 Å²	69.2	41%	0.414	37%	0.367	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.2	143.1	177.2	-63.6	177.5	0	0	0	110.6	V23 R24 R25 F92	V23-L90 CarbonylContact C-O 3.47Å; V23-L90 WeakPolarHBondContact CA-O 3.34Å; R24-L90 HydrophobicContact CB-CB 4.31Å; R24-L90 PolarHBondContact N-O 3.4Å; R24-L90 PolarHBondContact O-N 2.87Å; R25-L90 HydrophobicContact CB-CD1 4.49Å; R25-L90 HydrophobicContact CB-CG 4.33Å; L90-F92 HydrophobicContact CB-CE2 4.27Å
91	F	83.3	Confident	88.4	Confident	42 Å²	42	61.8 Å²	61.8	18%	0.184	34%	0.336	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.8	144.5	-174.1	-66.8	-100	0	0	0	110.6	F22 V23 F39 L77 H82 C89	F22-F91 WeakPolarHBondContact O-CA 3.43Å; V23-F91 HydrophobicContact CB-CE1 4.4Å; V23-F91 HydrophobicContact CG1-CE1 4.08Å; V23-F91 HydrophobicContact CG1-CE2 4.35Å; V23-F91 HydrophobicContact CG1-CZ 3.89Å; V23-F91 HydrophobicContact CG2-CD1 4.03Å; V23-F91 HydrophobicContact CG2-CE1 3.59Å; V23-F91 HydrophobicContact CG2-CZ 4.24Å; F39-F91 AromaticContact CE1-CE1 3.31Å; F39-F91 HydrophobicContact CE1-CE1 3.31Å; F39-F91 AromaticContact CE1-CZ 3.53Å; F39-F91 HydrophobicContact CE1-CZ 3.53Å; F39-F91 AromaticContact CZ-CE1 3.38Å; F39-F91 HydrophobicContact CZ-CE1 3.38Å; F39-F91 AromaticContact CZ-CZ 3.42Å; F39-F91 HydrophobicContact CZ-CZ 3.42Å; F39-F91 VanDerWaalsContact CZ-CZ 3.42Å; L77-F91 HydrophobicContact CD2-CB 4.24Å; H82-F91 HydrophobicContact CB-CE2 3.43Å; H82-F91 VanDerWaalsContact CB-CE2 3.43Å; H82-F91 HydrophobicContact CB-CZ 3.52Å; H82-F91 AromaticContact CD2-CD2 3.38Å; H82-F91 WeakPolarHBondContact CD2-CD2 3.05Å; H82-F91 AromaticContact CD2-CE1 3.88Å; H82-F91 AromaticContact CD2-CE2 2.97Å; H82-F91 WeakPolarHBondContact CD2-CE2 3.36Å; H82-F91 AromaticContact CD2-CZ 3.21Å; H82-F91 WeakPolarHBondContact CD2-CZ 3.33Å; H82-F91 AromaticContact CG-CE2 3.32Å; H82-F91 AromaticContact CG-CZ 3.23Å; H82-F91 AromaticContact ND1-CZ 3.79Å; H82-F91 AromaticContact NE2-CD2 3.98Å; H82-F91 AromaticContact NE2-CE1 3.89Å; H82-F91 AromaticContact NE2-CE2 3.8Å; H82-F91 AromaticContact NE2-CZ 3.7Å; C89-F91 HydrophobicContact CB-CE2 3.72Å; C89-F91 HydrophobicContact CB-CZ 4.15Å
92	F	65.8	Low	88.3	Confident	164 Å²	164	61.8 Å²	61.8	72%	0.719	34%	0.336	S	S	*	.			trans	-141.1	0	173.3	-60.2	-94.5	0	0	0	110.1	F22 R24 L90	F22-F92 HydrophobicContact CD1-CB 4.13Å; F22-F92 HydrophobicContact CD1-CD2 4.14Å; F22-F92 HydrophobicContact CD1-CG 4.49Å; F22-F92 PolarHBondContact N-O 2.87Å; F22-F92 PolarHBondContact O-N 3.48Å; F22-F92 VanDerWaalsContact O-N 3.09Å; R24-F92 HydrophobicContact CG-CD2 4.32Å; R24-F92 HydrophobicContact CG-CE2 4.24Å; L90-F92 HydrophobicContact CB-CE2 4.27Å

Retrieved 92 of 92 residues in 200.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).