A0A087WUU4_HUMAN Loading...

C-C motif chemokine ligand 16

AlphaFold DB , UniProt , Accession A0A087WUU4, Species HUMAN (Homo sapiens, Human), Gene CCL16, Length 53 aa.

						>A0A087WUU4_HUMAN|A0A087WUU4|CCL16
MKVSEAALSLLVLILIITSASRSQPSWSAVSRSRLTTTSASRVQVILLPQPPE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	58.8	Low	82.7	Confident	217 Å²	217	111.6 Å²	111.6	100%	1.069	62%	0.622	S	S	*	*				0	-31.7	0	-64.1	170.7	80.2	0	0	113.9	V3	M1-V3 PolarHBondContact O-N 3.32Å
2	K	63.1	Low	83.4	Confident	188 Å²	188	109.1 Å²	109.1	82%	0.817	61%	0.611	S	S	*	*	H	α-helix	trans	-73.5	-23.6	-174.8	-139.9	136.2	78.6	167.7	0	116.1	S4 A6	K2-S4 VanDerWaalsContact C-N 3.34Å; K2-A6 PolarHBondContact O-N 3.14Å
3	V	70.8	Confident	83.9	Confident	125 Å²	125	108.2 Å²	108.2	76%	0.758	60%	0.603	S	S	*	*	H	α-helix	trans	-71.7	-29.4	178.1	84.7	0	0	0	0	112.5	M1 A7	M1-V3 PolarHBondContact O-N 3.32Å; V3-A7 WeakPolarHBondContact O-CB 3.39Å; V3-A7 PolarHBondContact O-N 3.41Å
4	S	83.3	Confident	84.4	Confident	62 Å²	62	106.6 Å²	106.6	43%	0.434	59%	0.592	S	S	.	*	H	α-helix	trans	-64.7	-46.7	176.4	178.1	0	0	0	0	110.9	K2 A6 A7 L8	K2-S4 VanDerWaalsContact C-N 3.34Å; S4-A6 PolarHBondContact O-N 3.27Å; S4-A7 PolarHBondContact O-N 2.95Å; S4-L8 WeakPolarHBondContact O-CG 3.46Å; S4-L8 PolarHBondContact O-N 2.96Å
5	E	86.4	Confident	84.7	Confident	129 Å²	129	106.5 Å²	106.5	60%	0.603	59%	0.589	S	S	*	*	H	α-helix	trans	-60.9	-44	178.9	-60.6	-64	95.1	0	0	111.7	A7 L8 S9	E5-A7 PolarHBondContact O-N 3.37Å; E5-L8 PolarHBondContact O-N 3.44Å; E5-S9 VanDerWaalsContact O-CB 3.3Å; E5-S9 WeakPolarHBondContact O-CB 3.38Å; E5-S9 PolarHBondContact O-N 3.26Å
6	A	89.1	Confident	84.7	Confident	62 Å²	62	106.4 Å²	106.4	51%	0.512	59%	0.586	S	S	.	*	H	α-helix	trans	-64.9	-39	176.7	0	0	0	0	0	112	K2 S4 S9 L10	K2-A6 PolarHBondContact O-N 3.14Å; S4-A6 PolarHBondContact O-N 3.27Å; A6-S9 PolarHBondContact O-N 2.81Å; A6-L10 WeakPolarHBondContact O-CB 3.02Å; A6-L10 PolarHBondContact O-N 3.29Å
7	A	90.9	Very high	84.6	Confident	57 Å²	57	105.8 Å²	105.8	47%	0.471	58%	0.58	S	S	.	*	H	α-helix	trans	-66.5	-42.5	176.4	0	0	0	0	0	112.1	V3 S4 E5 L10 L11	V3-A7 WeakPolarHBondContact O-CB 3.39Å; V3-A7 PolarHBondContact O-N 3.41Å; S4-A7 PolarHBondContact O-N 2.95Å; E5-A7 PolarHBondContact O-N 3.37Å; A7-L10 PolarHBondContact O-N 2.82Å; A7-L11 WeakPolarHBondContact O-CB 3.44Å; A7-L11 PolarHBondContact O-N 3.21Å
8	L	91.7	Very high	84.6	Confident	94 Å²	94	102.8 Å²	102.8	49%	0.492	57%	0.566	S	S	.	*	H	α-helix	trans	-63.1	-44	173.8	-69.1	174.1	0	0	0	111.1	S4 E5 L10 L11 V12	S4-L8 WeakPolarHBondContact O-CG 3.46Å; S4-L8 PolarHBondContact O-N 2.96Å; E5-L8 PolarHBondContact O-N 3.44Å; L8-L10 VanDerWaalsContact C-N 3.33Å; L8-L10 PolarHBondContact O-N 3.39Å; L8-L11 PolarHBondContact O-N 3.29Å; L8-V12 VanDerWaalsContact O-CG2 3.29Å; L8-V12 WeakPolarHBondContact O-CG2 3.12Å; L8-V12 PolarHBondContact O-N 3.07Å
9	S	90.3	Very high	84.3	Confident	83 Å²	83	101.1 Å²	101.1	58%	0.58	56%	0.562	S	S	*	*	H	α-helix	trans	-63.1	-39.7	177.7	-160.6	0	0	0	0	111.9	E5 A6 L13	E5-S9 VanDerWaalsContact O-CB 3.3Å; E5-S9 WeakPolarHBondContact O-CB 3.38Å; E5-S9 PolarHBondContact O-N 3.26Å; A6-S9 PolarHBondContact O-N 2.81Å; S9-L13 WeakPolarHBondContact O-CB 3.39Å; S9-L13 PolarHBondContact O-N 2.57Å
10	L	92.4	Very high	83.7	Confident	106 Å²	106	98.1 Å²	98.1	56%	0.555	55%	0.551	S	S	*	*	H	α-helix	trans	-66.4	-43.2	175.2	-172.5	70.4	0	0	0	111.2	A6 A7 L8 L13 I14	A6-L10 WeakPolarHBondContact O-CB 3.02Å; A6-L10 PolarHBondContact O-N 3.29Å; A7-L10 PolarHBondContact O-N 2.82Å; L8-L10 VanDerWaalsContact C-N 3.33Å; L8-L10 PolarHBondContact O-N 3.39Å; L10-L13 PolarHBondContact O-N 3.16Å; L10-I14 HydrophobicContact CG-CD1 4.01Å; L10-I14 VanDerWaalsContact O-CG1 3.27Å; L10-I14 WeakPolarHBondContact O-CG1 3.41Å; L10-I14 PolarHBondContact O-N 2.99Å
11	L	93	Very high	83	Confident	105 Å²	105	96.7 Å²	96.7	55%	0.55	55%	0.547	S	S	.	.	H	α-helix	trans	-61.2	-46.3	178.1	-165.8	83.2	0	0	0	111.5	A7 L8 I14 L15	A7-L11 WeakPolarHBondContact O-CB 3.44Å; A7-L11 PolarHBondContact O-N 3.21Å; L8-L11 PolarHBondContact O-N 3.29Å; L11-I14 PolarHBondContact O-N 2.94Å; L11-L15 WeakPolarHBondContact O-CG 3.44Å; L11-L15 PolarHBondContact O-N 3.06Å
12	V	91.1	Very high	83.3	Confident	81 Å²	81	95.7 Å²	95.7	49%	0.491	53%	0.532	S	S	.	.	H	α-helix	trans	-62	-44	177.2	171.3	0	0	0	0	110.9	L8 I14 L15 I16	L8-V12 VanDerWaalsContact O-CG2 3.29Å; L8-V12 WeakPolarHBondContact O-CG2 3.12Å; L8-V12 PolarHBondContact O-N 3.07Å; V12-I14 PolarHBondContact O-N 2.97Å; V12-L15 PolarHBondContact O-N 3.44Å; V12-I16 HydrophobicContact CG1-CD1 4.06Å; V12-I16 WeakPolarHBondContact O-CG1 3.09Å; V12-I16 PolarHBondContact O-N 2.75Å
13	L	90	Very high	83.4	Confident	97 Å²	97	90.8 Å²	90.8	51%	0.508	52%	0.521	S	S	.	.	H	α-helix	trans	-60.9	-44.1	177.9	-176.2	63.4	0	0	0	111.9	S9 L10 L15 I16 I17	S9-L13 WeakPolarHBondContact O-CB 3.39Å; S9-L13 PolarHBondContact O-N 2.57Å; L10-L13 PolarHBondContact O-N 3.16Å; L13-L15 VanDerWaalsContact C-N 3.34Å; L13-L15 PolarHBondContact O-N 3.14Å; L13-I16 PolarHBondContact O-N 2.68Å; L13-I17 HydrophobicContact CD1-CD1 4.19Å; L13-I17 HydrophobicContact CG-CD1 4.04Å; L13-I17 WeakPolarHBondContact O-CG1 3.38Å; L13-I17 PolarHBondContact O-N 3.15Å; L13-I17 VanDerWaalsContact O-N 3.12Å
14	I	90.4	Very high	83.1	Confident	87 Å²	87	88 Å²	88	45%	0.446	50%	0.5	S	S	.	.	H	α-helix	trans	-63.2	-40.3	177.5	-68.3	166.9	0	0	0	111.1	L10 L11 V12 I17 T18	L10-I14 HydrophobicContact CG-CD1 4.01Å; L10-I14 VanDerWaalsContact O-CG1 3.27Å; L10-I14 WeakPolarHBondContact O-CG1 3.41Å; L10-I14 PolarHBondContact O-N 2.99Å; L11-I14 PolarHBondContact O-N 2.94Å; V12-I14 PolarHBondContact O-N 2.97Å; I14-I17 PolarHBondContact O-N 2.92Å; I14-T18 VanDerWaalsContact O-CB 3.28Å; I14-T18 WeakPolarHBondContact O-CB 3.43Å; I14-T18 PolarHBondContact O-N 3.4Å; I14-T18 PolarHBondContact O-OG1 2.89Å
15	L	89.1	Confident	81.7	Confident	105 Å²	105	90.5 Å²	90.5	55%	0.55	51%	0.514	S	S	.	.	H	α-helix	trans	-64.3	-41.3	177.4	-73.7	175.2	0	0	0	112.4	L11 V12 L13 S19	L11-L15 WeakPolarHBondContact O-CG 3.44Å; L11-L15 PolarHBondContact O-N 3.06Å; V12-L15 PolarHBondContact O-N 3.44Å; L13-L15 VanDerWaalsContact C-N 3.34Å; L13-L15 PolarHBondContact O-N 3.14Å; L15-S19 VanDerWaalsContact O-CB 3.23Å; L15-S19 WeakPolarHBondContact O-CB 3.06Å; L15-S19 PolarHBondContact O-N 2.92Å; L15-S19 PolarHBondContact O-OG 3.33Å
16	I	84.8	Confident	80.4	Confident	105 Å²	105	87 Å²	87	54%	0.538	50%	0.504	S	S	.	.	H	α-helix	trans	-64.8	-45.8	178.2	-67.4	174.9	0	0	0	110.8	V12 L13 S19 A20	V12-I16 HydrophobicContact CG1-CD1 4.06Å; V12-I16 WeakPolarHBondContact O-CG1 3.09Å; V12-I16 PolarHBondContact O-N 2.75Å; L13-I16 PolarHBondContact O-N 2.68Å; I16-S19 WeakPolarHBondContact CA-OG 3.49Å; I16-S19 PolarHBondContact O-OG 2.86Å; I16-A20 WeakPolarHBondContact O-CB 3.44Å; I16-A20 PolarHBondContact O-N 3.24Å; I16-A20 VanDerWaalsContact O-N 3.09Å
17	I	82.9	Confident	78.8	Confident	95 Å²	95	92.9 Å²	92.9	49%	0.487	51%	0.513	S	S	.	.	H	α-helix	trans	-64.9	-46.9	179.2	-64.3	167	0	0	0	110.5	L13 I14 S19 A20 S21	L13-I17 HydrophobicContact CD1-CD1 4.19Å; L13-I17 HydrophobicContact CG-CD1 4.04Å; L13-I17 WeakPolarHBondContact O-CG1 3.38Å; L13-I17 PolarHBondContact O-N 3.15Å; L13-I17 VanDerWaalsContact O-N 3.12Å; I14-I17 PolarHBondContact O-N 2.92Å; I17-S19 PolarHBondContact O-N 2.97Å; I17-A20 PolarHBondContact O-N 3.19Å; I17-S21 WeakPolarHBondContact O-CB 2.87Å; I17-S21 PolarHBondContact O-N 3.43Å; I17-S21 PolarHBondContact O-OG 3.43Å; I17-S21 VanDerWaalsContact O-OG 3.11Å
18	T	84.3	Confident	77.1	Confident	53 Å²	53	92.8 Å²	92.8	33%	0.325	51%	0.509	S	S	.	.	H	α-helix	trans	-69.5	-34.5	-176.3	-50	0	0	0	0	112.5	I14 R22	I14-T18 VanDerWaalsContact O-CB 3.28Å; I14-T18 WeakPolarHBondContact O-CB 3.43Å; I14-T18 PolarHBondContact O-N 3.4Å; I14-T18 PolarHBondContact O-OG1 2.89Å; T18-R22 WeakPolarHBondContact O-CB 3.39Å; T18-R22 PolarHBondContact O-N 2.81Å
19	S	80.1	Confident	75.4	Confident	69 Å²	69	90.9 Å²	90.9	48%	0.483	51%	0.507	S	S	.	.	H	α-helix	trans	-69	-40.4	174.6	56.6	0	0	0	0	111.9	L15 I16 I17	L15-S19 VanDerWaalsContact O-CB 3.23Å; L15-S19 WeakPolarHBondContact O-CB 3.06Å; L15-S19 PolarHBondContact O-N 2.92Å; L15-S19 PolarHBondContact O-OG 3.33Å; I16-S19 WeakPolarHBondContact CA-OG 3.49Å; I16-S19 PolarHBondContact O-OG 2.86Å; I17-S19 PolarHBondContact O-N 2.97Å
20	A	72.8	Confident	73.8	Confident	42 Å²	42	91.5 Å²	91.5	35%	0.347	51%	0.507	S	S	.	.	H	α-helix	trans	-62	-42.6	172.4	0	0	0	0	0	111.9	I16 I17 S23 Q24	I16-A20 WeakPolarHBondContact O-CB 3.44Å; I16-A20 PolarHBondContact O-N 3.24Å; I16-A20 VanDerWaalsContact O-N 3.09Å; I17-A20 PolarHBondContact O-N 3.19Å; A20-S23 PolarHBondContact O-N 3.26Å; A20-Q24 WeakPolarHBondContact O-CG 3.14Å; A20-Q24 PolarHBondContact O-N 3.06Å; A20-Q24 PolarHBondContact O-OE1 3.47Å
21	S	68.3	Low	72	Confident	68 Å²	68	88.9 Å²	88.9	48%	0.476	50%	0.497	S	S	.	.	H	α-helix	trans	-72.1	-31.5	-179.5	-61.7	0	0	0	0	114.5	I17 S23 Q24	I17-S21 WeakPolarHBondContact O-CB 2.87Å; I17-S21 PolarHBondContact O-N 3.43Å; I17-S21 PolarHBondContact O-OG 3.43Å; I17-S21 VanDerWaalsContact O-OG 3.11Å; S21-S23 VanDerWaalsContact C-N 3.26Å; S21-S23 PolarHBondContact O-N 3.46Å; S21-Q24 VanDerWaalsContact CA-OE1 3.29Å; S21-Q24 PolarHBondContact O-N 3.36Å
22	R	65	Low	70.2	Confident	197 Å²	197	91.6 Å²	91.6	74%	0.743	50%	0.5	S	S	*	.	H	α-helix	trans	-70.6	-20.2	176.4	-100.5	-175.6	-74.7	-134.8	2.5	114.1	T18	T18-R22 WeakPolarHBondContact O-CB 3.39Å; T18-R22 PolarHBondContact O-N 2.81Å
23	S	65.5	Low	68.5	Low	84 Å²	84	91.2 Å²	91.2	59%	0.587	50%	0.501	S	S	*	.	T	Hydrogen-bonded Turn	trans	-108.2	15.6	177.4	-58.9	0	0	0	0	113.2	A20 S21 P25	A20-S23 PolarHBondContact O-N 3.26Å; S21-S23 VanDerWaalsContact C-N 3.26Å; S21-S23 PolarHBondContact O-N 3.46Å; S23-P25 WeakPolarHBondContact O-CD 3.14Å
24	Q	64.1	Low	66.9	Low	67 Å²	67	95.2 Å²	95.2	31%	0.313	51%	0.51	S	S	.	.	T	Hydrogen-bonded Turn	trans	-91.5	101.7	-177.8	-95	154.9	2.3	0	0	112.6	A20 S21 W27	A20-Q24 WeakPolarHBondContact O-CG 3.14Å; A20-Q24 PolarHBondContact O-N 3.06Å; A20-Q24 PolarHBondContact O-OE1 3.47Å; S21-Q24 VanDerWaalsContact CA-OE1 3.29Å; S21-Q24 PolarHBondContact O-N 3.36Å; Q24-W27 HydrophobicContact CG-CB 3.98Å; Q24-W27 VanDerWaalsContact NE2-CB 3.35Å; Q24-W27 VanDerWaalsContact NE2-CD2 3.33Å
25	P	53.7	Low	65.3	Low	114 Å²	114	97 Å²	97	74%	0.74	52%	0.519	S	S	*	.	T	Hydrogen-bonded Turn		-102	-3	107.3	25.9	-20.7	0	0	0	112.2	S23 A29	S23-P25 WeakPolarHBondContact O-CD 3.14Å; P25-A29 PolarHBondContact O-N 3.34Å
26	S	59.2	Low	63.7	Low	56 Å²	56	96.4 Å²	96.4	39%	0.392	52%	0.52	S	S	.	.	H	α-helix	trans	-81.4	-16.2	-163.3	88.6	0	0	0	0	117.1	S28 A29 V30	S26-S28 VanDerWaalsContact C-N 3.28Å; S26-S28 PolarHBondContact O-N 3.12Å; S26-A29 PolarHBondContact O-N 3.46Å; S26-V30 WeakPolarHBondContact O-CG2 3.2Å; S26-V30 PolarHBondContact O-N 2.94Å
27	W	55.3	Low	62.3	Low	186 Å²	186	96.2 Å²	96.2	71%	0.705	52%	0.524	S	S	*	.	H	α-helix	trans	-68.5	-35.1	175.9	-135.4	-10.4	0	0	0	111.4	Q24 S31	Q24-W27 HydrophobicContact CG-CB 3.98Å; Q24-W27 VanDerWaalsContact NE2-CB 3.35Å; Q24-W27 VanDerWaalsContact NE2-CD2 3.33Å; W27-S31 WeakPolarHBondContact O-CB 3.33Å; W27-S31 PolarHBondContact O-N 3.11Å; W27-S31 PolarHBondContact O-OG 3.5Å
28	S	55.7	Low	61.1	Low	55 Å²	55	94.9 Å²	94.9	39%	0.385	52%	0.52	S	S	.	.	H	α-helix	trans	-75	-32.4	172.2	-165	0	0	0	0	111.5	S26 R32	S26-S28 VanDerWaalsContact C-N 3.28Å; S26-S28 PolarHBondContact O-N 3.12Å; S28-R32 WeakPolarHBondContact O-CB 3.48Å; S28-R32 PolarHBondContact O-N 3.09Å; S28-R32 VanDerWaalsContact OG-CZ 3.29Å; S28-R32 PolarHBondContact OG-NE 2.94Å; S28-R32 PolarHBondContact OG-NH2 3.26Å
29	A	55.6	Low	59.7	Low	54 Å²	54	95.3 Å²	95.3	45%	0.446	53%	0.526	S	S	.	.	H	α-helix	trans	-69.6	-46.6	178.6	0	0	0	0	0	112.6	P25 S26 S33	P25-A29 PolarHBondContact O-N 3.34Å; S26-A29 PolarHBondContact O-N 3.46Å; A29-S33 WeakPolarHBondContact O-CB 3.37Å; A29-S33 PolarHBondContact O-N 2.75Å
30	V	56.4	Low	58.6	Low	96 Å²	96	94.5 Å²	94.5	58%	0.582	52%	0.523	S	S	*	.	H	α-helix	trans	-74.4	-33	-179.7	-178.2	0	0	0	0	111.4	S26 R34	S26-V30 WeakPolarHBondContact O-CG2 3.2Å; S26-V30 PolarHBondContact O-N 2.94Å; V30-R34 PolarHBondContact O-N 2.93Å; V30-R34 VanDerWaalsContact O-N 3.15Å
31	S	55.2	Low	58	Low	50 Å²	50	96.1 Å²	96.1	35%	0.35	53%	0.531	S	S	.	.	H	α-helix	trans	-79.7	-37.3	178.4	-48.7	0	0	0	0	113.1	W27 L35	W27-S31 WeakPolarHBondContact O-CB 3.33Å; W27-S31 PolarHBondContact O-N 3.11Å; W27-S31 PolarHBondContact O-OG 3.5Å; S31-L35 WeakPolarHBondContact O-CB 3.29Å; S31-L35 PolarHBondContact O-N 3.4Å; S31-L35 VanDerWaalsContact O-N 3.14Å
32	R	54.6	Low	57.5	Low	163 Å²	163	101.8 Å²	101.8	62%	0.615	54%	0.542	S	S	*	.	H	α-helix	trans	-66.2	-42.2	167.4	-86.8	-177.7	-83.7	179	-7.5	111.2	S28 R34 L35 T36	S28-R32 WeakPolarHBondContact O-CB 3.48Å; S28-R32 PolarHBondContact O-N 3.09Å; S28-R32 VanDerWaalsContact OG-CZ 3.29Å; S28-R32 PolarHBondContact OG-NE 2.94Å; S28-R32 PolarHBondContact OG-NH2 3.26Å; R32-R34 PolarHBondContact O-N 3Å; R32-L35 CarbonylContact O-C 3.53Å; R32-L35 PolarHBondContact O-N 3.44Å; R32-L35 VanDerWaalsContact O-N 3.16Å; R32-T36 WeakPolarHBondContact O-CB 3.49Å; R32-T36 PolarHBondContact O-N 3.39Å; R32-T36 PolarHBondContact O-OG1 3.42Å
33	S	55.8	Low	57.2	Low	72 Å²	72	95.6 Å²	95.6	50%	0.503	53%	0.526	S	S	.	.	H	α-helix	trans	-64.3	-39.2	-176.8	-164.1	0	0	0	0	112.2	A29 T36 T37	A29-S33 WeakPolarHBondContact O-CB 3.37Å; A29-S33 PolarHBondContact O-N 2.75Å; S33-T36 PolarHBondContact O-N 3.47Å; S33-T37 WeakPolarHBondContact O-CB 3.4Å; S33-T37 PolarHBondContact O-N 3.42Å; S33-T37 PolarHBondContact O-OG1 2.86Å; S33-T37 VanDerWaalsContact O-OG1 3.06Å
34	R	56.8	Low	56.9	Low	182 Å²	182	98.2 Å²	98.2	69%	0.687	53%	0.529	S	S	*	.	H	α-helix	trans	-69.6	-38.9	172.8	-144.8	171.9	86.8	-118.2	6.4	112.2	V30 R32 T38	V30-R34 PolarHBondContact O-N 2.93Å; V30-R34 VanDerWaalsContact O-N 3.15Å; R32-R34 PolarHBondContact O-N 3Å; R34-T38 WeakPolarHBondContact O-CB 3.5Å; R34-T38 PolarHBondContact O-N 3.41Å; R34-T38 PolarHBondContact O-OG1 2.88Å
35	L	56.9	Low	56.6	Low	125 Å²	125	100.4 Å²	100.4	65%	0.654	55%	0.547	S	S	*	.	H	α-helix	trans	-67.3	-32.7	174.9	-83.5	162.7	0	0	0	112.8	S31 R32 S39	S31-L35 WeakPolarHBondContact O-CB 3.29Å; S31-L35 PolarHBondContact O-N 3.4Å; S31-L35 VanDerWaalsContact O-N 3.14Å; R32-L35 CarbonylContact O-C 3.53Å; R32-L35 PolarHBondContact O-N 3.44Å; R32-L35 VanDerWaalsContact O-N 3.16Å; L35-S39 WeakPolarHBondContact O-CA 3.23Å; L35-S39 WeakPolarHBondContact O-CB 3.4Å; L35-S39 PolarHBondContact O-N 2.88Å
36	T	55.2	Low	57.1	Low	91 Å²	91	101.9 Å²	101.9	56%	0.558	55%	0.547	S	S	*	.	H	α-helix	trans	-77.1	-41	177.4	-51.2	0	0	0	0	111.9	R32 S33 S39 A40	R32-T36 WeakPolarHBondContact O-CB 3.49Å; R32-T36 PolarHBondContact O-N 3.39Å; R32-T36 PolarHBondContact O-OG1 3.42Å; S33-T36 PolarHBondContact O-N 3.47Å; T36-S39 PolarHBondContact O-N 3.44Å; T36-A40 WeakPolarHBondContact O-CB 3.36Å; T36-A40 PolarHBondContact O-N 3.49Å
37	T	54.4	Low	57	Low	101 Å²	101	105.4 Å²	105.4	62%	0.62	56%	0.561	S	S	*	*	H	α-helix	trans	-68.5	-35.9	176.2	-58.6	0	0	0	0	112	S33 S41	S33-T37 WeakPolarHBondContact O-CB 3.4Å; S33-T37 PolarHBondContact O-N 3.42Å; S33-T37 PolarHBondContact O-OG1 2.86Å; S33-T37 VanDerWaalsContact O-OG1 3.06Å; T37-S41 WeakPolarHBondContact O-CB 3.48Å; T37-S41 PolarHBondContact O-N 3.2Å
38	T	57.9	Low	57.3	Low	68 Å²	68	103 Å²	103	42%	0.417	56%	0.562	S	S	.	*	H	α-helix	trans	-81.1	-28.2	174.5	-27.3	0	0	0	0	112.4	R34 R42	R34-T38 WeakPolarHBondContact O-CB 3.5Å; R34-T38 PolarHBondContact O-N 3.41Å; R34-T38 PolarHBondContact O-OG1 2.88Å; T38-R42 WeakPolarHBondContact O-CB 3.3Å; T38-R42 PolarHBondContact O-N 3.39Å
39	S	55.2	Low	57.6	Low	62 Å²	62	105.7 Å²	105.7	43%	0.434	58%	0.577	S	S	.	*	H	α-helix	trans	-69.8	-47.2	175.3	179.8	0	0	0	0	111.2	L35 T36 S41 R42 V43	L35-S39 WeakPolarHBondContact O-CA 3.23Å; L35-S39 WeakPolarHBondContact O-CB 3.4Å; L35-S39 PolarHBondContact O-N 2.88Å; T36-S39 PolarHBondContact O-N 3.44Å; S39-S41 VanDerWaalsContact C-N 3.26Å; S39-S41 PolarHBondContact O-N 3.45Å; S39-R42 PolarHBondContact O-N 3.06Å; S39-V43 WeakPolarHBondContact O-CB 3.33Å; S39-V43 WeakPolarHBondContact O-CG2 3.36Å; S39-V43 PolarHBondContact O-N 2.93Å
40	A	57.2	Low	58.1	Low	51 Å²	51	111.6 Å²	111.6	42%	0.421	60%	0.596	S	S	.	*	H	α-helix	trans	-64.4	-31.5	176.8	0	0	0	0	0	112.8	T36 Q44	T36-A40 WeakPolarHBondContact O-CB 3.36Å; T36-A40 PolarHBondContact O-N 3.49Å; A40-Q44 WeakPolarHBondContact O-CB 3.39Å; A40-Q44 WeakPolarHBondContact O-CG 3.27Å; A40-Q44 PolarHBondContact O-N 2.92Å; A40-Q44 PolarHBondContact O-NE2 3.35Å
41	S	59.4	Low	58.2	Low	76 Å²	76	112.1 Å²	112.1	53%	0.531	60%	0.601	S	S	.	*	H	α-helix	trans	-79.2	-34.7	177.9	-179	0	0	0	0	113.4	T37 S39 V45	T37-S41 WeakPolarHBondContact O-CB 3.48Å; T37-S41 PolarHBondContact O-N 3.2Å; S39-S41 VanDerWaalsContact C-N 3.26Å; S39-S41 PolarHBondContact O-N 3.45Å; S41-V45 WeakPolarHBondContact O-CG2 3.28Å
42	R	58.1	Low	58.3	Low	187 Å²	187	115.7 Å²	115.7	71%	0.706	62%	0.623	S	S	*	*	H	α-helix	trans	-80.4	-34.3	172.5	-84	-172.7	178.8	-177.9	-0.5	113.7	T38 S39 Q44 V45 I46	T38-R42 WeakPolarHBondContact O-CB 3.3Å; T38-R42 PolarHBondContact O-N 3.39Å; S39-R42 PolarHBondContact O-N 3.06Å; R42-Q44 VanDerWaalsContact C-N 3.33Å; R42-V45 PolarHBondContact O-N 3Å; R42-I46 PolarHBondContact O-N 2.94Å
43	V	59.7	Low	58.7	Low	67 Å²	67	120.6 Å²	120.6	41%	0.406	65%	0.653	S	S	.	*	H	α-helix	trans	-69.1	-32.8	178	172.5	0	0	0	0	110.9	S39 V45 I46 L47	S39-V43 WeakPolarHBondContact O-CB 3.33Å; S39-V43 WeakPolarHBondContact O-CG2 3.36Å; S39-V43 PolarHBondContact O-N 2.93Å; V43-V45 VanDerWaalsContact C-N 3.29Å; V43-V45 PolarHBondContact O-N 2.7Å; V43-I46 PolarHBondContact O-N 3.47Å; V43-L47 HydrophobicContact CG1-CD1 3.79Å; V43-L47 HydrophobicContact CG1-CG 4.48Å; V43-L47 WeakPolarHBondContact O-CB 3.32Å; V43-L47 PolarHBondContact O-N 3.26Å
44	Q	57.5	Low	58.8	Low	139 Å²	139	123.1 Å²	123.1	65%	0.65	66%	0.661	S	S	*	*	H	α-helix	trans	-63.6	-30.9	170.8	-88.5	173.6	72.4	0	0	113.6	A40 R42 L48	A40-Q44 WeakPolarHBondContact O-CB 3.39Å; A40-Q44 WeakPolarHBondContact O-CG 3.27Å; A40-Q44 PolarHBondContact O-N 2.92Å; A40-Q44 PolarHBondContact O-NE2 3.35Å; R42-Q44 VanDerWaalsContact C-N 3.33Å; Q44-L48 PolarHBondContact O-N 3.04Å
45	V	59.3	Low	58.9	Low	114 Å²	114	119.9 Å²	119.9	69%	0.691	66%	0.659	S	S	*	*	H	α-helix	trans	-77.5	-25.4	177.7	178.8	0	0	0	0	111.8	S41 R42 V43	S41-V45 WeakPolarHBondContact O-CG2 3.28Å; R42-V45 PolarHBondContact O-N 3Å; V43-V45 VanDerWaalsContact C-N 3.29Å; V43-V45 PolarHBondContact O-N 2.7Å
46	I	64	Low	59	Low	144 Å²	144	119.7 Å²	119.7	74%	0.738	66%	0.659	S	S	*	*	H	α-helix	trans	-84.6	-26.9	174.7	-61.4	167.8	0	0	0	111.5	R42 V43	R42-I46 PolarHBondContact O-N 2.94Å; V43-I46 PolarHBondContact O-N 3.47Å
47	L	57.9	Low	59.3	Low	130 Å²	130	121.4 Å²	121.4	68%	0.681	67%	0.665	S	S	*	*	S	Bend	trans	-89.8	6.1	177.1	-83	169.2	0	0	0	114.3	V43 P49	V43-L47 HydrophobicContact CG1-CD1 3.79Å; V43-L47 HydrophobicContact CG1-CG 4.48Å; V43-L47 WeakPolarHBondContact O-CB 3.32Å; V43-L47 PolarHBondContact O-N 3.26Å; L47-P49 WeakPolarHBondContact O-CD 3.37Å
48	L	61.1	Low	59.6	Low	137 Å²	137	122.6 Å²	122.6	72%	0.717	67%	0.668	S	S	*	*	S	Bend	trans	-85.5	100.8	164.5	-148.3	75.1	0	0	0	107.1	Q44 Q50	Q44-L48 PolarHBondContact O-N 3.04Å; L48-Q50 PolarHBondContact O-N 3.01Å; L48-Q50 VanDerWaalsContact O-N 3.14Å
49	P	62.3	Low	59.7	Low	110 Å²	110	126.3 Å²	126.3	71%	0.714	69%	0.685	S	S	*	*	P	Polyproline II helix	trans	-61.7	122.4	168.4	28.1	-32.3	0	0	0	106.5	L47	L47-P49 WeakPolarHBondContact O-CD 3.37Å
50	Q	64.9	Low	60	Low	178 Å²	178	130.9 Å²	130.9	83%	0.832	70%	0.703	S	S	*	*	P	Polyproline II helix	trans	-51.3	129.1	169.6	-171.7	177	19.2	0	0	107.9	L48	L48-Q50 PolarHBondContact O-N 3.01Å; L48-Q50 VanDerWaalsContact O-N 3.14Å
51	P	58.4	Low	60.2	Low	108 Å²	108	137 Å²	137	70%	0.701	73%	0.725	S	S	*	*	P	Polyproline II helix	trans	-64.6	133.8	179.3	26.6	-31.6	0	0	0	108.3
52	P	57.6	Low	60.3	Low	124 Å²	124	142.1 Å²	142.1	81%	0.805	74%	0.741	S	S	*	*	P	Polyproline II helix	trans	-69.4	132.5	174.5	28.8	-31.1	0	0	0	109
53	E	62.5	Low	60.5	Low	267 Å²	267	138 Å²	138	100%	1.248	74%	0.744	S	S	*	*			trans	-72.7	0	149.6	-73.7	-174.9	148.9	0	0	109.6

Retrieved 53 of 53 residues in 39.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).