A0A087WUV1_HUMAN Loading...

Cilia- and flagella-associated protein 45

AlphaFold DB , UniProt , Accession A0A087WUV1, Species HUMAN (Homo sapiens, Human), Gene CFAP45, Length 141 aa.

						>A0A087WUV1_HUMAN|A0A087WUV1|CFAP45
MVRELIVPTEDPSGESLIISPEEFERIKWASHVLTREELEARDQAFKKEKEATMDAVMTRKKIMKQKEMVWNNNKKLSDLEEVAKERAQNLLQRANKLRMEQEEELKDMSKIILNAKCHAIRDAQILEKQQIQKELDTEEK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.8	Low	59.3	Low	240 Å²	240	152.5 Å²	152.5	100%	1.182	78%	0.781	S	S	*	*				0	97.4	0	-80.2	-177.9	-83.7	0	0	107.7
2	V	48.5	Very low	59.6	Low	145 Å²	145	149.6 Å²	149.6	88%	0.879	78%	0.78	S	S	*	*	P	Polyproline II helix	trans	-86.4	118.9	175.3	-176.4	0	0	0	0	105.7
3	R	52.6	Low	60.1	Low	241 Å²	241	144.1 Å²	144.1	91%	0.909	76%	0.762	S	S	*	*	P	Polyproline II helix	trans	-82	120.6	172.4	-70.7	-176.4	175.7	-176.8	-1.4	107.2	L5	R3-L5 PolarHBondContact O-N 3.48Å
4	E	56.6	Low	60.5	Low	177 Å²	177	138.7 Å²	138.7	83%	0.827	76%	0.758	S	S	*	*	P	Polyproline II helix	trans	-65.5	117	170.2	-74.5	177.7	167.6	0	0	108.6	I6	E4-I6 PolarHBondContact O-N 3.05Å
5	L	68.1	Low	61	Low	153 Å²	153	141 Å²	141	80%	0.801	76%	0.762	S	S	*	*			trans	-77.8	98.2	173.4	-167.9	81.5	0	0	0	107.4	R3 V7	R3-L5 PolarHBondContact O-N 3.48Å; L5-V7 HydrophobicContact CD2-CG2 3.74Å; L5-V7 HydrophobicContact CG-CG2 4.08Å; L5-V7 PolarHBondContact O-N 3.03Å; L5-V7 VanDerWaalsContact O-N 3.07Å
6	I	64.1	Low	61.6	Low	151 Å²	151	136.3 Å²	136.3	77%	0.774	74%	0.742	S	S	*	*			trans	-74.1	97.3	171.4	-58.1	172.6	0	0	0	106.6	E4 P8	E4-I6 PolarHBondContact O-N 3.05Å; I6-P8 WeakPolarHBondContact O-CD 3.5Å
7	V	65.3	Low	62.4	Low	101 Å²	101	136.2 Å²	136.2	61%	0.612	74%	0.741	S	S	*	*			trans	-81.4	116.6	172.1	-176.6	0	0	0	0	107.2	L5 T9	L5-V7 HydrophobicContact CD2-CG2 3.74Å; L5-V7 HydrophobicContact CG-CG2 4.08Å; L5-V7 PolarHBondContact O-N 3.03Å; L5-V7 VanDerWaalsContact O-N 3.07Å; V7-T9 PolarHBondContact O-N 3.11Å
8	P	61.6	Low	63.2	Low	84 Å²	84	137.8 Å²	137.8	55%	0.545	75%	0.746	S	S	.	*			trans	-54.9	129.8	175.4	-24.3	34.9	0	0	0	110.5	I6 E10	I6-P8 WeakPolarHBondContact O-CD 3.5Å; P8-E10 VanDerWaalsContact C-N 3.28Å; P8-E10 WeakPolarHBondContact CB-O 3.4Å
9	T	59.9	Low	64.3	Low	149 Å²	149	133.5 Å²	133.5	91%	0.914	72%	0.722	S	S	*	*	S	Bend	trans	-74.5	-23.2	-179.3	-40	0	0	0	0	112.1	V7	V7-T9 PolarHBondContact O-N 3.11Å
10	E	64.1	Low	65.4	Low	171 Å²	171	129.4 Å²	129.4	80%	0.799	70%	0.704	S	S	*	*	S	Bend	trans	-120.4	143	174.3	-62.8	-170.5	173.1	0	0	109.6	P8 P12	P8-E10 VanDerWaalsContact C-N 3.28Å; P8-E10 WeakPolarHBondContact CB-O 3.4Å; E10-P12 WeakPolarHBondContact O-CD 3.44Å
11	D	60.4	Low	66.4	Low	65 Å²	65	128.2 Å²	128.2	35%	0.348	70%	0.703	S	S	.	*			trans	-65.2	117.4	-174.8	175	24.6	0	0	0	111.5	S13 G14 E15 S16	D11-S13 VanDerWaalsContact C-N 3.27Å; D11-S13 PolarHBondContact O-N 3.39Å; D11-S13 PolarHBondContact OD1-N 3.1Å; D11-S13 PolarHBondContact OD1-OG 3.48Å; D11-G14 PolarHBondContact O-N 2.96Å; D11-G14 WeakPolarHBondContact OD2-CA 3.41Å; D11-G14 PolarHBondContact OD2-N 3.48Å; D11-G14 VanDerWaalsContact OD2-N 3.11Å; D11-E15 PolarHBondContact OD2-N 3.13Å; D11-S16 VanDerWaalsContact CB-OG 3.32Å; D11-S16 WeakPolarHBondContact CB-OG 3.47Å; D11-S16 WeakPolarHBondContact OD2-CA 3.32Å; D11-S16 WeakPolarHBondContact OD2-CB 3.34Å; D11-S16 PolarHBondContact OD2-N 2.98Å; D11-S16 PolarHBondContact OD2-OG 3.23Å
12	P	63	Low	68.2	Low	118 Å²	118	124.4 Å²	124.4	77%	0.766	68%	0.682	S	S	*	*	S	Bend	trans	-70.2	-16.9	-177	27.5	-34.4	0	0	0	114.3	E10	E10-P12 WeakPolarHBondContact O-CD 3.44Å
13	S	66.4	Low	70	Confident	78 Å²	78	120.7 Å²	120.7	55%	0.545	66%	0.655	S	S	.	*	S	Bend	trans	-98.7	-17.6	177.1	76.7	0	0	0	0	114.2	D11 E15	D11-S13 VanDerWaalsContact C-N 3.27Å; D11-S13 PolarHBondContact O-N 3.39Å; D11-S13 PolarHBondContact OD1-N 3.1Å; D11-S13 PolarHBondContact OD1-OG 3.48Å; S13-E15 PolarHBondContact O-N 2.64Å; S13-E15 VanDerWaalsContact O-N 3.16Å; S13-E15 PolarHBondContact OG-N 3.13Å
14	G	65.3	Low	71.6	Confident	69 Å²	69	114.5 Å²	114.5	71%	0.711	64%	0.635	S	S	*	*	S	Bend	trans	65.5	6.8	-174.8	0	0	0	0	0	114.5	D11	D11-G14 PolarHBondContact O-N 2.96Å; D11-G14 WeakPolarHBondContact OD2-CA 3.41Å; D11-G14 PolarHBondContact OD2-N 3.48Å; D11-G14 VanDerWaalsContact OD2-N 3.11Å
15	E	68.3	Low	73.1	Confident	173 Å²	173	109.3 Å²	109.3	81%	0.808	61%	0.611	S	S	*	*			trans	-113.8	5.8	-176.2	-67.7	-175.7	173.1	0	0	112.4	D11 S13	D11-E15 PolarHBondContact OD2-N 3.13Å; S13-E15 PolarHBondContact O-N 2.64Å; S13-E15 VanDerWaalsContact O-N 3.16Å; S13-E15 PolarHBondContact OG-N 3.13Å
16	S	71.1	Confident	74.2	Confident	65 Å²	65	108.8 Å²	108.8	46%	0.455	60%	0.598	S	S	.	*			trans	-73	130.6	176.4	65.5	0	0	0	0	111.8	D11	D11-S16 VanDerWaalsContact CB-OG 3.32Å; D11-S16 WeakPolarHBondContact CB-OG 3.47Å; D11-S16 WeakPolarHBondContact OD2-CA 3.32Å; D11-S16 WeakPolarHBondContact OD2-CB 3.34Å; D11-S16 PolarHBondContact OD2-N 2.98Å; D11-S16 PolarHBondContact OD2-OG 3.23Å
17	L	74.4	Confident	75.2	Confident	136 Å²	136	105.5 Å²	105.5	71%	0.712	58%	0.581	S	S	*	*			trans	-97	106	175	-178.9	66.1	0	0	0	109.1	I19	L17-I19 HydrophobicContact CD1-CG2 4.05Å; L17-I19 HydrophobicContact CD2-CD1 4.34Å; L17-I19 HydrophobicContact CD2-CG2 3.98Å; L17-I19 HydrophobicContact CG-CG2 3.72Å; L17-I19 PolarHBondContact O-N 3.02Å
18	I	78.1	Confident	76.2	Confident	165 Å²	165	105.5 Å²	105.5	85%	0.846	57%	0.573	S	S	*	*			trans	-84.2	105.2	173.6	-56.7	172.8	0	0	0	108.2
19	I	83	Confident	77.2	Confident	56 Å²	56	110.1 Å²	110.1	29%	0.287	58%	0.58	S	S	.	*			trans	-123.8	153.5	177.7	48.4	170.5	0	0	0	110.8	L17 E23 F24 I27	L17-I19 HydrophobicContact CD1-CG2 4.05Å; L17-I19 HydrophobicContact CD2-CD1 4.34Å; L17-I19 HydrophobicContact CD2-CG2 3.98Å; L17-I19 HydrophobicContact CG-CG2 3.72Å; L17-I19 PolarHBondContact O-N 3.02Å; I19-E23 HydrophobicContact CB-CB 4.43Å; I19-E23 HydrophobicContact CB-CG 4.31Å; I19-E23 HydrophobicContact CG2-CG 4.28Å; I19-F24 HydrophobicContact CD1-CB 3.93Å; I19-F24 HydrophobicContact CD1-CD2 4.1Å; I19-F24 HydrophobicContact CG1-CB 4.49Å; I19-I27 HydrophobicContact CD1-CD1 4.28Å
20	S	86.8	Confident	78.3	Confident	50 Å²	50	107.1 Å²	107.1	35%	0.35	57%	0.57	S	S	.	*			trans	-69.2	153.9	176.4	74.8	0	0	0	0	111	E22 E23 F24	S20-E22 PolarHBondContact O-N 3.37Å; S20-E23 PolarHBondContact O-N 3.42Å; S20-E23 VanDerWaalsContact O-N 3.1Å; S20-E23 WeakPolarHBondContact OG-CB 3.46Å; S20-E23 PolarHBondContact OG-N 3.17Å; S20-F24 PolarHBondContact O-N 2.8Å
21	P	86.7	Confident	79.1	Confident	105 Å²	105	102.9 Å²	102.9	68%	0.682	56%	0.559	S	S	*	*	H	α-helix	trans	-57	-33.7	176.3	-25.9	34.8	0	0	0	113.5	F24 E25	P21-F24 PolarHBondContact O-N 3.49Å; P21-E25 PolarHBondContact O-N 3.47Å
22	E	89	Confident	80	Confident	160 Å²	160	104.4 Å²	104.4	75%	0.748	56%	0.564	S	S	*	*	H	α-helix	trans	-65.6	-42.5	177	-64.2	161.5	-175.7	0	0	111.6	S20 R26	S20-E22 PolarHBondContact O-N 3.37Å; E22-R26 WeakPolarHBondContact O-CB 3.38Å; E22-R26 PolarHBondContact O-N 3.08Å
23	E	85.3	Confident	80.6	Confident	68 Å²	68	104.7 Å²	104.7	32%	0.318	56%	0.564	S	S	.	*	H	α-helix	trans	-70.4	-38.2	178	-176.1	145	-121	0	0	111.6	I19 S20 R26 I27	I19-E23 HydrophobicContact CB-CB 4.43Å; I19-E23 HydrophobicContact CB-CG 4.31Å; I19-E23 HydrophobicContact CG2-CG 4.28Å; S20-E23 PolarHBondContact O-N 3.42Å; S20-E23 VanDerWaalsContact O-N 3.1Å; S20-E23 WeakPolarHBondContact OG-CB 3.46Å; S20-E23 PolarHBondContact OG-N 3.17Å; E23-R26 PolarHBondContact O-N 2.8Å; E23-R26 IonicContact OE1-CZ 3.35Å; E23-R26 IonicContact OE1-NH1 2.74Å; E23-R26 PolarHBondContact OE1-NH1 3.02Å; E23-R26 IonicContact OE1-NH2 3.46Å; E23-R26 PolarHBondContact OE1-NH2 3.38Å; E23-I27 HydrophobicContact CG-CD1 4.21Å; E23-I27 VanDerWaalsContact O-CG1 3.27Å; E23-I27 WeakPolarHBondContact O-CG1 3.47Å; E23-I27 PolarHBondContact O-N 3.2Å
24	F	86.3	Confident	81.1	Confident	110 Å²	110	104.6 Å²	104.6	48%	0.482	56%	0.556	S	S	.	*	H	α-helix	trans	-61.2	-50.2	172.6	177.1	-103.6	0	0	0	112.1	I19 S20 P21 R26 I27 K28	I19-F24 HydrophobicContact CD1-CB 3.93Å; I19-F24 HydrophobicContact CD1-CD2 4.1Å; I19-F24 HydrophobicContact CG1-CB 4.49Å; S20-F24 PolarHBondContact O-N 2.8Å; P21-F24 PolarHBondContact O-N 3.49Å; F24-R26 VanDerWaalsContact C-N 3.34Å; F24-R26 PolarHBondContact O-N 3.37Å; F24-I27 PolarHBondContact O-N 2.9Å; F24-K28 HydrophobicContact CE1-CD 4.22Å; F24-K28 VanDerWaalsContact O-CB 3.31Å; F24-K28 WeakPolarHBondContact O-CB 3.36Å; F24-K28 PolarHBondContact O-N 3.3Å
25	E	89.1	Confident	81.9	Confident	68 Å²	68	104.9 Å²	104.9	32%	0.318	54%	0.544	S	S	.	.	H	α-helix	trans	-63.7	-40.8	177.6	-75.7	-63.8	143.6	0	0	111	P21 I27 K28 W29	P21-E25 PolarHBondContact O-N 3.47Å; E25-I27 PolarHBondContact O-N 2.89Å; E25-K28 WeakPolarHBondContact O-CB 3.35Å; E25-K28 PolarHBondContact O-N 3.49Å; E25-K28 IonicContact OE1-NZ 2.94Å; E25-K28 PolarHBondContact OE1-NZ 3.14Å; E25-K28 IonicContact OE2-NZ 3.56Å; E25-W29 PolarHBondContact O-N 2.91Å; E25-W29 PolarHBondContact OE2-NE1 2.95Å
26	R	89.3	Confident	82.5	Confident	143 Å²	143	105.9 Å²	105.9	54%	0.54	54%	0.541	S	S	.	.	H	α-helix	trans	-56.5	-46.9	174.6	-172.4	-174.7	73	-131.3	4.3	112.3	E22 E23 F24 A30	E22-R26 WeakPolarHBondContact O-CB 3.38Å; E22-R26 PolarHBondContact O-N 3.08Å; E23-R26 PolarHBondContact O-N 2.8Å; E23-R26 IonicContact OE1-CZ 3.35Å; E23-R26 IonicContact OE1-NH1 2.74Å; E23-R26 PolarHBondContact OE1-NH1 3.02Å; E23-R26 IonicContact OE1-NH2 3.46Å; E23-R26 PolarHBondContact OE1-NH2 3.38Å; F24-R26 VanDerWaalsContact C-N 3.34Å; F24-R26 PolarHBondContact O-N 3.37Å; R26-A30 VanDerWaalsContact O-CB 3.26Å; R26-A30 WeakPolarHBondContact O-CB 3.34Å; R26-A30 PolarHBondContact O-N 3.28Å
27	I	86.2	Confident	83.1	Confident	81 Å²	81	110.3 Å²	110.3	42%	0.415	55%	0.554	S	S	.	*	H	α-helix	trans	-65	-43.5	178.1	-68.3	166.2	0	0	0	110.4	I19 E23 F24 E25 W29 A30 S31	I19-I27 HydrophobicContact CD1-CD1 4.28Å; E23-I27 HydrophobicContact CG-CD1 4.21Å; E23-I27 VanDerWaalsContact O-CG1 3.27Å; E23-I27 WeakPolarHBondContact O-CG1 3.47Å; E23-I27 PolarHBondContact O-N 3.2Å; F24-I27 PolarHBondContact O-N 2.9Å; E25-I27 PolarHBondContact O-N 2.89Å; I27-W29 PolarHBondContact O-N 3.29Å; I27-A30 PolarHBondContact O-N 3.07Å; I27-S31 VanDerWaalsContact O-CB 3.28Å; I27-S31 WeakPolarHBondContact O-CB 3.3Å; I27-S31 PolarHBondContact O-N 3.44Å; I27-S31 PolarHBondContact O-OG 3.45Å
28	K	85.8	Confident	83.6	Confident	102 Å²	102	107.7 Å²	107.7	44%	0.443	54%	0.538	S	S	.	.	H	α-helix	trans	-58.6	-48.3	177.4	-175.8	-176.9	172.6	-167.6	0	111.7	F24 E25 S31 H32	F24-K28 HydrophobicContact CE1-CD 4.22Å; F24-K28 VanDerWaalsContact O-CB 3.31Å; F24-K28 WeakPolarHBondContact O-CB 3.36Å; F24-K28 PolarHBondContact O-N 3.3Å; E25-K28 WeakPolarHBondContact O-CB 3.35Å; E25-K28 PolarHBondContact O-N 3.49Å; E25-K28 IonicContact OE1-NZ 2.94Å; E25-K28 PolarHBondContact OE1-NZ 3.14Å; E25-K28 IonicContact OE2-NZ 3.56Å; K28-S31 PolarHBondContact O-N 3.32Å; K28-S31 PolarHBondContact O-OG 2.92Å; K28-H32 PolarHBondContact O-N 3.47Å
29	W	83.6	Confident	83.8	Confident	180 Å²	180	104 Å²	104	68%	0.682	52%	0.52	S	S	*	.	H	α-helix	trans	-65.1	-38.9	175.1	-71.5	112.6	0	0	0	113	E25 I27 S31 H32	E25-W29 PolarHBondContact O-N 2.91Å; E25-W29 PolarHBondContact OE2-NE1 2.95Å; I27-W29 PolarHBondContact O-N 3.29Å; W29-S31 VanDerWaalsContact C-N 3.33Å; W29-H32 PolarHBondContact O-N 2.87Å
30	A	82.4	Confident	84	Confident	87 Å²	87	105.2 Å²	105.2	72%	0.719	52%	0.524	S	S	*	.	H	α-helix	trans	-69.5	-30.6	178	0	0	0	0	0	113.1	R26 I27	R26-A30 VanDerWaalsContact O-CB 3.26Å; R26-A30 WeakPolarHBondContact O-CB 3.34Å; R26-A30 PolarHBondContact O-N 3.28Å; I27-A30 PolarHBondContact O-N 3.07Å
31	S	80.2	Confident	84.1	Confident	81 Å²	81	105.5 Å²	105.5	57%	0.566	53%	0.529	S	S	*	.	H	α-helix	trans	-80.6	-15.4	177.3	71.4	0	0	0	0	113.7	I27 K28 W29 V33	I27-S31 VanDerWaalsContact O-CB 3.28Å; I27-S31 WeakPolarHBondContact O-CB 3.3Å; I27-S31 PolarHBondContact O-N 3.44Å; I27-S31 PolarHBondContact O-OG 3.45Å; K28-S31 PolarHBondContact O-N 3.32Å; K28-S31 PolarHBondContact O-OG 2.92Å; W29-S31 VanDerWaalsContact C-N 3.33Å; S31-V33 PolarHBondContact O-N 2.93Å; S31-V33 VanDerWaalsContact O-N 3.09Å
32	H	79.5	Confident	84.1	Confident	97 Å²	97	108.7 Å²	108.7	45%	0.449	53%	0.528	S	S	.	.			trans	-73.4	104.2	-178.1	-176.3	64	0	0	0	110.5	K28 W29 L34	K28-H32 PolarHBondContact O-N 3.47Å; W29-H32 PolarHBondContact O-N 2.87Å; H32-L34 PolarHBondContact O-N 3.2Å
33	V	76.4	Confident	84.1	Confident	125 Å²	125	104.9 Å²	104.9	76%	0.758	51%	0.513	S	S	*	.			trans	-81.3	112.2	173.9	-177.7	0	0	0	0	108.1	S31 T35	S31-V33 PolarHBondContact O-N 2.93Å; S31-V33 VanDerWaalsContact O-N 3.09Å; V33-T35 PolarHBondContact O-N 3.12Å
34	L	75.7	Confident	84.4	Confident	75 Å²	75	106.8 Å²	106.8	39%	0.393	52%	0.522	S	S	.	.			trans	-57	134.4	176.8	-68.6	168	0	0	0	110.2	H32 E38	H32-L34 PolarHBondContact O-N 3.2Å; L34-E38 HydrophobicContact CD2-CB 4.09Å
35	T	82.1	Confident	84.7	Confident	75 Å²	75	104.3 Å²	104.3	46%	0.46	52%	0.521	S	S	.	.			trans	-69.3	158.9	170.6	61.6	0	0	0	0	110	V33 E37 E38 L39	V33-T35 PolarHBondContact O-N 3.12Å; T35-E37 PolarHBondContact O-N 2.87Å; T35-E38 PolarHBondContact N-OE2 3.15Å; T35-E38 PolarHBondContact O-N 3.34Å; T35-E38 VanDerWaalsContact OG1-CG 3.27Å; T35-E38 WeakPolarHBondContact OG1-CG 3.31Å; T35-E38 PolarHBondContact OG1-OE2 3.32Å; T35-L39 PolarHBondContact O-N 2.97Å; T35-L39 VanDerWaalsContact O-N 3.09Å
36	R	81.4	Confident	84.9	Confident	195 Å²	195	107.3 Å²	107.3	74%	0.736	53%	0.533	S	S	*	.	H	α-helix	trans	-56	-38.2	179.6	-177.6	178.3	170.5	172.1	0.4	112.2	L39 E40	R36-L39 PolarHBondContact O-N 3.11Å; R36-E40 WeakPolarHBondContact CG-OE1 3.45Å; R36-E40 IonicContact CZ-OE1 3.8Å; R36-E40 IonicContact NE-OE1 2.96Å; R36-E40 PolarHBondContact NE-OE1 3.39Å; R36-E40 IonicContact NH2-OE1 3.74Å; R36-E40 WeakPolarHBondContact O-CB 3.39Å; R36-E40 VanDerWaalsContact O-CG 3.31Å; R36-E40 WeakPolarHBondContact O-CG 3.32Å; R36-E40 PolarHBondContact O-N 3.48Å
37	E	83.9	Confident	85.1	Confident	157 Å²	157	106.9 Å²	106.9	73%	0.734	54%	0.536	S	S	*	.	H	α-helix	trans	-67.9	-40.1	179.8	-64.3	178.8	-178.3	0	0	112.3	T35 E40 A41	T35-E37 PolarHBondContact O-N 2.87Å; E37-E40 PolarHBondContact O-N 2.89Å; E37-A41 WeakPolarHBondContact O-CB 3.49Å; E37-A41 PolarHBondContact O-N 2.97Å
38	E	84.3	Confident	85.6	Confident	82 Å²	82	109.7 Å²	109.7	38%	0.383	55%	0.545	S	S	.	.	H	α-helix	trans	-67.7	-37.5	176.8	-70.2	164	151.1	0	0	112.1	L34 T35 A41 R42	L34-E38 HydrophobicContact CD2-CB 4.09Å; T35-E38 PolarHBondContact N-OE2 3.15Å; T35-E38 PolarHBondContact O-N 3.34Å; T35-E38 VanDerWaalsContact OG1-CG 3.27Å; T35-E38 WeakPolarHBondContact OG1-CG 3.31Å; T35-E38 PolarHBondContact OG1-OE2 3.32Å; E38-A41 PolarHBondContact O-N 3.03Å; E38-R42 WeakPolarHBondContact O-CB 3.39Å; E38-R42 PolarHBondContact O-N 3.26Å
39	L	83.6	Confident	86	Confident	87 Å²	87	111.1 Å²	111.1	46%	0.455	55%	0.553	S	S	.	*	H	α-helix	trans	-64.2	-47	174.2	-171.7	70.8	0	0	0	110.9	T35 R36 A41 R42 D43	T35-L39 PolarHBondContact O-N 2.97Å; T35-L39 VanDerWaalsContact O-N 3.09Å; R36-L39 PolarHBondContact O-N 3.11Å; L39-A41 VanDerWaalsContact C-N 3.35Å; L39-A41 PolarHBondContact O-N 3.37Å; L39-R42 PolarHBondContact O-N 2.99Å; L39-D43 PolarHBondContact O-N 2.9Å
40	E	87.6	Confident	86.5	Confident	82 Å²	82	107.8 Å²	107.8	38%	0.383	54%	0.543	S	S	.	.	H	α-helix	trans	-62.6	-40.6	177	-72.9	175.9	-166.3	0	0	111.6	R36 E37 D43 Q44	R36-E40 WeakPolarHBondContact CG-OE1 3.45Å; R36-E40 IonicContact CZ-OE1 3.8Å; R36-E40 IonicContact NE-OE1 2.96Å; R36-E40 PolarHBondContact NE-OE1 3.39Å; R36-E40 IonicContact NH2-OE1 3.74Å; R36-E40 WeakPolarHBondContact O-CB 3.39Å; R36-E40 VanDerWaalsContact O-CG 3.31Å; R36-E40 WeakPolarHBondContact O-CG 3.32Å; R36-E40 PolarHBondContact O-N 3.48Å; E37-E40 PolarHBondContact O-N 2.89Å; E40-D43 PolarHBondContact O-N 3.49Å; E40-Q44 WeakPolarHBondContact O-CB 3.37Å; E40-Q44 VanDerWaalsContact O-CG 3.22Å; E40-Q44 WeakPolarHBondContact O-CG 3.27Å; E40-Q44 PolarHBondContact O-N 3.21Å
41	A	88.4	Confident	87.2	Confident	55 Å²	55	109.3 Å²	109.3	46%	0.455	54%	0.536	S	S	.	.	H	α-helix	trans	-64	-41.6	175.6	0	0	0	0	0	112.3	E37 E38 L39 Q44 A45	E37-A41 WeakPolarHBondContact O-CB 3.49Å; E37-A41 PolarHBondContact O-N 2.97Å; E38-A41 PolarHBondContact O-N 3.03Å; L39-A41 VanDerWaalsContact C-N 3.35Å; L39-A41 PolarHBondContact O-N 3.37Å; A41-Q44 PolarHBondContact O-N 2.91Å; A41-A45 WeakPolarHBondContact O-CB 3.38Å; A41-A45 PolarHBondContact O-N 3.42Å
42	R	85.8	Confident	87.9	Confident	173 Å²	173	108.3 Å²	108.3	65%	0.653	53%	0.532	S	S	*	.	H	α-helix	trans	-64.5	-43.7	176.2	-171.6	177.6	-176.3	164.3	0.5	111.8	E38 L39 Q44 A45 F46	E38-R42 WeakPolarHBondContact O-CB 3.39Å; E38-R42 PolarHBondContact O-N 3.26Å; L39-R42 PolarHBondContact O-N 2.99Å; R42-Q44 VanDerWaalsContact C-N 3.35Å; R42-A45 PolarHBondContact O-N 3.34Å; R42-F46 WeakPolarHBondContact O-CB 3.42Å; R42-F46 PolarHBondContact O-N 3.4Å
43	D	89.1	Confident	88.7	Confident	80 Å²	80	107.3 Å²	107.3	43%	0.428	53%	0.533	S	S	.	.	H	α-helix	trans	-64.8	-39.6	176.5	-77.9	-10.8	0	0	0	111.9	L39 E40 K47	L39-D43 PolarHBondContact O-N 2.9Å; E40-D43 PolarHBondContact O-N 3.49Å; D43-K47 WeakPolarHBondContact O-CB 3.43Å; D43-K47 VanDerWaalsContact O-CG 3.24Å; D43-K47 WeakPolarHBondContact O-CG 3.45Å; D43-K47 PolarHBondContact O-N 3.31Å
44	Q	92.7	Very high	89.6	Confident	108 Å²	108	106 Å²	106	51%	0.505	52%	0.52	S	S	.	.	H	α-helix	trans	-65.8	-43.1	174.7	-74.6	178.3	26.4	0	0	112	E40 A41 R42 K47 K48	E40-Q44 WeakPolarHBondContact O-CB 3.37Å; E40-Q44 VanDerWaalsContact O-CG 3.22Å; E40-Q44 WeakPolarHBondContact O-CG 3.27Å; E40-Q44 PolarHBondContact O-N 3.21Å; A41-Q44 PolarHBondContact O-N 2.91Å; R42-Q44 VanDerWaalsContact C-N 3.35Å; Q44-K47 PolarHBondContact O-N 3.07Å; Q44-K48 WeakPolarHBondContact O-CB 3.48Å; Q44-K48 WeakPolarHBondContact O-CG 3.46Å; Q44-K48 PolarHBondContact O-N 3.21Å
45	A	92.1	Very high	90.6	Very high	57 Å²	57	106.2 Å²	106.2	47%	0.471	52%	0.521	S	S	.	.	H	α-helix	trans	-60.9	-46	176.1	0	0	0	0	0	111.1	A41 R42 K47 K48 E49	A41-A45 WeakPolarHBondContact O-CB 3.38Å; A41-A45 PolarHBondContact O-N 3.42Å; R42-A45 PolarHBondContact O-N 3.34Å; A45-K47 PolarHBondContact O-N 3Å; A45-K48 PolarHBondContact O-N 3Å; A45-E49 PolarHBondContact O-N 3.14Å
46	F	92.6	Very high	91.3	Very high	131 Å²	131	105.4 Å²	105.4	58%	0.575	52%	0.522	S	S	*	.	H	α-helix	trans	-62.1	-41.9	176.7	-177.9	-102.9	0	0	0	112.5	R42 E49 K50	R42-F46 WeakPolarHBondContact O-CB 3.42Å; R42-F46 PolarHBondContact O-N 3.4Å; F46-E49 PolarHBondContact O-N 3.36Å; F46-K50 WeakPolarHBondContact O-CB 3.38Å; F46-K50 PolarHBondContact O-N 3.17Å
47	K	94.8	Very high	92	Very high	135 Å²	135	99.8 Å²	99.8	59%	0.587	51%	0.509	S	S	*	.	H	α-helix	trans	-62.4	-44.9	175.3	-76.4	172.8	-173.5	175.6	0	111.9	D43 Q44 A45 K50 E51	D43-K47 WeakPolarHBondContact O-CB 3.43Å; D43-K47 VanDerWaalsContact O-CG 3.24Å; D43-K47 WeakPolarHBondContact O-CG 3.45Å; D43-K47 PolarHBondContact O-N 3.31Å; Q44-K47 PolarHBondContact O-N 3.07Å; A45-K47 PolarHBondContact O-N 3Å; K47-K50 PolarHBondContact O-N 3.06Å; K47-E51 WeakPolarHBondContact O-CB 3.28Å; K47-E51 PolarHBondContact O-N 2.82Å
48	K	95.1	Very high	92.6	Very high	140 Å²	140	97.4 Å²	97.4	61%	0.609	50%	0.499	S	S	*	.	H	α-helix	trans	-62.8	-42.1	178.1	-74.2	176.2	-177.3	178.2	0	112	Q44 A45 E51 A52	Q44-K48 WeakPolarHBondContact O-CB 3.48Å; Q44-K48 WeakPolarHBondContact O-CG 3.46Å; Q44-K48 PolarHBondContact O-N 3.21Å; A45-K48 PolarHBondContact O-N 3Å; K48-E51 PolarHBondContact O-N 3Å; K48-A52 VanDerWaalsContact O-CB 3.31Å; K48-A52 WeakPolarHBondContact O-CB 3.35Å; K48-A52 PolarHBondContact O-N 3.39Å
49	E	94.3	Very high	93.2	Very high	132 Å²	132	97.3 Å²	97.3	62%	0.617	50%	0.504	S	S	*	.	H	α-helix	trans	-64.6	-43.5	176.1	-172.7	-178.8	178.2	0	0	111.5	A45 F46 E51 A52 T53	A45-E49 PolarHBondContact O-N 3.14Å; F46-E49 PolarHBondContact O-N 3.36Å; E49-E51 PolarHBondContact O-N 2.98Å; E49-A52 PolarHBondContact O-N 2.93Å; E49-T53 WeakPolarHBondContact O-CB 3.47Å; E49-T53 WeakPolarHBondContact O-CG2 3.44Å; E49-T53 PolarHBondContact O-N 3.45Å; E49-T53 PolarHBondContact O-OG1 3.43Å
50	K	95.5	Very high	93.8	Very high	110 Å²	110	101.5 Å²	101.5	48%	0.478	51%	0.514	S	S	.	.	H	α-helix	trans	-62.1	-42	175.2	-174	179.3	177.4	-179	0	112.1	F46 K47 T53 M54	F46-K50 WeakPolarHBondContact O-CB 3.38Å; F46-K50 PolarHBondContact O-N 3.17Å; K47-K50 PolarHBondContact O-N 3.06Å; K50-T53 WeakPolarHBondContact CA-OG1 3.39Å; K50-T53 PolarHBondContact O-OG1 3.43Å; K50-M54 HydrophobicContact CD-CE 4.24Å; K50-M54 HydrophobicContact CG-CE 3.95Å; K50-M54 HydrophobicContact CG-SD 4.29Å; K50-M54 WeakPolarHBondContact O-CB 3.3Å; K50-M54 WeakPolarHBondContact O-CG 3.24Å; K50-M54 PolarHBondContact O-N 2.97Å
51	E	96	Very high	94.2	Very high	119 Å²	119	104 Å²	104	56%	0.556	52%	0.524	S	S	*	.	H	α-helix	trans	-66.1	-47	177.1	-172.7	171.3	-163.2	0	0	111.1	K47 K48 E49 T53 M54 D55	K47-E51 WeakPolarHBondContact O-CB 3.28Å; K47-E51 PolarHBondContact O-N 2.82Å; K48-E51 PolarHBondContact O-N 3Å; E49-E51 PolarHBondContact O-N 2.98Å; E51-T53 VanDerWaalsContact C-N 3.33Å; E51-T53 PolarHBondContact O-N 2.98Å; E51-M54 WeakPolarHBondContact O-CB 3.35Å; E51-M54 PolarHBondContact O-N 3.36Å; E51-M54 VanDerWaalsContact O-N 3.13Å; E51-D55 WeakPolarHBondContact O-CB 3.46Å; E51-D55 PolarHBondContact O-N 3.38Å
52	A	95.6	Very high	94.6	Very high	59 Å²	59	108 Å²	108	49%	0.488	53%	0.531	S	S	.	.	H	α-helix	trans	-59.8	-41.5	177	0	0	0	0	0	112.5	K48 E49 D55 A56	K48-A52 VanDerWaalsContact O-CB 3.31Å; K48-A52 WeakPolarHBondContact O-CB 3.35Å; K48-A52 PolarHBondContact O-N 3.39Å; E49-A52 PolarHBondContact O-N 2.93Å; A52-D55 PolarHBondContact O-N 3.4Å; A52-A56 WeakPolarHBondContact O-CB 3.43Å; A52-A56 PolarHBondContact O-N 2.99Å
53	T	95.4	Very high	95.1	Very high	76 Å²	76	103.7 Å²	103.7	47%	0.466	52%	0.52	S	S	.	.	H	α-helix	trans	-67.6	-39.6	175.4	51.5	0	0	0	0	111.9	E49 K50 E51 A56 V57	E49-T53 WeakPolarHBondContact O-CB 3.47Å; E49-T53 WeakPolarHBondContact O-CG2 3.44Å; E49-T53 PolarHBondContact O-N 3.45Å; E49-T53 PolarHBondContact O-OG1 3.43Å; K50-T53 WeakPolarHBondContact CA-OG1 3.39Å; K50-T53 PolarHBondContact O-OG1 3.43Å; E51-T53 VanDerWaalsContact C-N 3.33Å; E51-T53 PolarHBondContact O-N 2.98Å; T53-A56 PolarHBondContact O-N 3.29Å; T53-V57 WeakPolarHBondContact O-CG2 3.4Å; T53-V57 PolarHBondContact O-N 3.34Å
54	M	95.9	Very high	95.4	Very high	99 Å²	99	104.8 Å²	104.8	49%	0.488	52%	0.524	S	S	.	.	H	α-helix	trans	-63.3	-44.4	174.3	-76.7	-178.4	174.4	0	0	112	K50 E51 V57 M58	K50-M54 HydrophobicContact CD-CE 4.24Å; K50-M54 HydrophobicContact CG-CE 3.95Å; K50-M54 HydrophobicContact CG-SD 4.29Å; K50-M54 WeakPolarHBondContact O-CB 3.3Å; K50-M54 WeakPolarHBondContact O-CG 3.24Å; K50-M54 PolarHBondContact O-N 2.97Å; E51-M54 WeakPolarHBondContact O-CB 3.35Å; E51-M54 PolarHBondContact O-N 3.36Å; E51-M54 VanDerWaalsContact O-N 3.13Å; M54-V57 PolarHBondContact O-N 2.97Å; M54-M58 WeakPolarHBondContact O-CB 3.4Å; M54-M58 WeakPolarHBondContact O-CG 3.48Å; M54-M58 PolarHBondContact O-N 3.22Å
55	D	96.4	Very high	95.5	Very high	78 Å²	78	106 Å²	106	42%	0.417	53%	0.527	S	S	.	.	H	α-helix	trans	-64	-42.5	177.7	-77.4	-11.7	0	0	0	111.8	E51 A52 V57 M58 T59	E51-D55 WeakPolarHBondContact O-CB 3.46Å; E51-D55 PolarHBondContact O-N 3.38Å; A52-D55 PolarHBondContact O-N 3.4Å; D55-V57 VanDerWaalsContact C-N 3.31Å; D55-V57 PolarHBondContact O-N 3.03Å; D55-M58 PolarHBondContact O-N 2.89Å; D55-M58 WeakPolarHBondContact OD1-CE 3.14Å; D55-T59 WeakPolarHBondContact O-CB 3.37Å; D55-T59 VanDerWaalsContact O-CG2 3.28Å; D55-T59 WeakPolarHBondContact O-CG2 3.46Å; D55-T59 PolarHBondContact O-N 3.48Å; D55-T59 PolarHBondContact O-OG1 3.49Å
56	A	96.4	Very high	95.5	Very high	58 Å²	58	108.2 Å²	108.2	48%	0.479	53%	0.528	S	S	.	.	H	α-helix	trans	-60.4	-39.9	174	0	0	0	0	0	112.1	A52 T53 T59 R60	A52-A56 WeakPolarHBondContact O-CB 3.43Å; A52-A56 PolarHBondContact O-N 2.99Å; T53-A56 PolarHBondContact O-N 3.29Å; A56-T59 WeakPolarHBondContact CA-OG1 3.41Å; A56-T59 PolarHBondContact O-OG1 3.28Å; A56-R60 WeakPolarHBondContact O-CB 3.43Å; A56-R60 PolarHBondContact O-N 3.23Å; A56-R60 VanDerWaalsContact O-N 3.13Å
57	V	96.8	Very high	95.5	Very high	77 Å²	77	108.3 Å²	108.3	47%	0.467	53%	0.528	S	S	.	.	H	α-helix	trans	-70.3	-42	176.1	170.9	0	0	0	0	111.3	T53 M54 D55 R60 K61	T53-V57 WeakPolarHBondContact O-CG2 3.4Å; T53-V57 PolarHBondContact O-N 3.34Å; M54-V57 PolarHBondContact O-N 2.97Å; D55-V57 VanDerWaalsContact C-N 3.31Å; D55-V57 PolarHBondContact O-N 3.03Å; V57-R60 PolarHBondContact O-N 3.03Å; V57-K61 HydrophobicContact CG1-CD 4.19Å; V57-K61 HydrophobicContact CG1-CG 4.47Å; V57-K61 WeakPolarHBondContact O-CB 3.47Å; V57-K61 WeakPolarHBondContact O-CG 3.43Å; V57-K61 PolarHBondContact O-N 2.9Å
58	M	96.3	Very high	95.4	Very high	107 Å²	107	108 Å²	108	53%	0.527	53%	0.529	S	S	.	.	H	α-helix	trans	-64.7	-44.4	179.2	-77.6	-164.9	-72.1	0	0	111.9	M54 D55 K61 K62	M54-M58 WeakPolarHBondContact O-CB 3.4Å; M54-M58 WeakPolarHBondContact O-CG 3.48Å; M54-M58 PolarHBondContact O-N 3.22Å; D55-M58 PolarHBondContact O-N 2.89Å; D55-M58 WeakPolarHBondContact OD1-CE 3.14Å; M58-K61 PolarHBondContact O-N 2.91Å; M58-K62 WeakPolarHBondContact O-CB 3.44Å; M58-K62 PolarHBondContact O-N 3.39Å
59	T	96.6	Very high	95.1	Very high	80 Å²	80	107.1 Å²	107.1	49%	0.491	53%	0.529	S	S	.	.	H	α-helix	trans	-60.8	-46.2	175.5	51.4	0	0	0	0	111	D55 A56 K61 K62 I63	D55-T59 WeakPolarHBondContact O-CB 3.37Å; D55-T59 VanDerWaalsContact O-CG2 3.28Å; D55-T59 WeakPolarHBondContact O-CG2 3.46Å; D55-T59 PolarHBondContact O-N 3.48Å; D55-T59 PolarHBondContact O-OG1 3.49Å; A56-T59 WeakPolarHBondContact CA-OG1 3.41Å; A56-T59 PolarHBondContact O-OG1 3.28Å; T59-K61 PolarHBondContact O-N 3.47Å; T59-K62 PolarHBondContact O-N 3.49Å; T59-I63 VanDerWaalsContact O-CG1 3.32Å; T59-I63 WeakPolarHBondContact O-CG1 3.38Å; T59-I63 PolarHBondContact O-N 3.21Å
60	R	96.1	Very high	94.8	Very high	176 Å²	176	104.8 Å²	104.8	66%	0.664	52%	0.523	S	S	*	.	H	α-helix	trans	-59.5	-44.7	174.9	-173.4	177.1	178.3	176.4	-0.3	112.3	A56 V57 K62 I63 M64	A56-R60 WeakPolarHBondContact O-CB 3.43Å; A56-R60 PolarHBondContact O-N 3.23Å; A56-R60 VanDerWaalsContact O-N 3.13Å; V57-R60 PolarHBondContact O-N 3.03Å; R60-K62 VanDerWaalsContact C-N 3.35Å; R60-K62 PolarHBondContact O-N 2.87Å; R60-I63 PolarHBondContact O-N 2.87Å; R60-M64 WeakPolarHBondContact O-CG 3.42Å; R60-M64 PolarHBondContact O-N 3.06Å
61	K	97	Very high	94.3	Very high	135 Å²	135	107.4 Å²	107.4	59%	0.587	53%	0.53	S	S	*	.	H	α-helix	trans	-60.9	-42.8	175.7	-78.5	-180	177.7	179.9	0	111.7	V57 M58 T59 M64 K65	V57-K61 HydrophobicContact CG1-CD 4.19Å; V57-K61 HydrophobicContact CG1-CG 4.47Å; V57-K61 WeakPolarHBondContact O-CB 3.47Å; V57-K61 WeakPolarHBondContact O-CG 3.43Å; V57-K61 PolarHBondContact O-N 2.9Å; M58-K61 PolarHBondContact O-N 2.91Å; T59-K61 PolarHBondContact O-N 3.47Å; K61-M64 PolarHBondContact O-N 2.89Å; K61-K65 WeakPolarHBondContact O-CG 3.49Å; K61-K65 PolarHBondContact O-N 2.93Å
62	K	96.5	Very high	93.7	Very high	138 Å²	138	106.5 Å²	106.5	60%	0.6	53%	0.529	S	S	*	.	H	α-helix	trans	-62.8	-45.8	178.4	-170.9	179.2	-178	179.7	0	111.4	M58 T59 R60 M64 K65 Q66	M58-K62 WeakPolarHBondContact O-CB 3.44Å; M58-K62 PolarHBondContact O-N 3.39Å; T59-K62 PolarHBondContact O-N 3.49Å; R60-K62 VanDerWaalsContact C-N 3.35Å; R60-K62 PolarHBondContact O-N 2.87Å; K62-M64 VanDerWaalsContact C-N 3.34Å; K62-M64 PolarHBondContact O-N 3.1Å; K62-K65 PolarHBondContact O-N 3.42Å; K62-Q66 WeakPolarHBondContact O-CG 3.41Å; K62-Q66 PolarHBondContact O-N 3.22Å
63	I	96.2	Very high	93.1	Very high	82 Å²	82	109.8 Å²	109.8	42%	0.421	54%	0.538	S	S	.	.	H	α-helix	trans	-61.1	-44.4	176.9	-66.7	165.7	0	0	0	110.6	T59 R60 Q66 K67	T59-I63 VanDerWaalsContact O-CG1 3.32Å; T59-I63 WeakPolarHBondContact O-CG1 3.38Å; T59-I63 PolarHBondContact O-N 3.21Å; R60-I63 PolarHBondContact O-N 2.87Å; I63-Q66 PolarHBondContact O-N 3.38Å; I63-K67 HydrophobicContact CG2-CD 4.09Å; I63-K67 HydrophobicContact CG2-CG 4.46Å; I63-K67 WeakPolarHBondContact O-CB 3.42Å; I63-K67 WeakPolarHBondContact O-CG 3.43Å; I63-K67 PolarHBondContact O-N 2.95Å
64	M	94.6	Very high	92.3	Very high	103 Å²	103	111.9 Å²	111.9	51%	0.507	55%	0.547	S	S	.	.	H	α-helix	trans	-63.2	-44.4	178.5	-72.7	-58.9	-171	0	0	112.1	R60 K61 K62 Q66 K67 E68	R60-M64 WeakPolarHBondContact O-CG 3.42Å; R60-M64 PolarHBondContact O-N 3.06Å; K61-M64 PolarHBondContact O-N 2.89Å; K62-M64 VanDerWaalsContact C-N 3.34Å; K62-M64 PolarHBondContact O-N 3.1Å; M64-Q66 VanDerWaalsContact C-N 3.34Å; M64-Q66 PolarHBondContact O-N 2.9Å; M64-K67 PolarHBondContact O-N 2.74Å; M64-E68 WeakPolarHBondContact O-CB 3.33Å; M64-E68 PolarHBondContact O-N 3Å
65	K	94.9	Very high	91.7	Very high	133 Å²	133	113.3 Å²	113.3	58%	0.578	55%	0.55	S	S	*	*	H	α-helix	trans	-59.9	-43	174.9	-74.2	-177.9	176.9	-171.6	0	112.3	K61 K62 E68 M69	K61-K65 WeakPolarHBondContact O-CG 3.49Å; K61-K65 PolarHBondContact O-N 2.93Å; K62-K65 PolarHBondContact O-N 3.42Å; K65-E68 PolarHBondContact O-N 3.23Å; K65-M69 WeakPolarHBondContact O-CG 3.46Å; K65-M69 PolarHBondContact O-N 3.25Å
66	Q	93.4	Very high	91	Very high	105 Å²	105	118.7 Å²	118.7	49%	0.491	57%	0.57	S	S	.	*	H	α-helix	trans	-62.9	-43.7	176.5	-74.8	176.6	-21.5	0	0	111.5	K62 I63 M64 E68 M69 V70	K62-Q66 WeakPolarHBondContact O-CG 3.41Å; K62-Q66 PolarHBondContact O-N 3.22Å; I63-Q66 PolarHBondContact O-N 3.38Å; M64-Q66 VanDerWaalsContact C-N 3.34Å; M64-Q66 PolarHBondContact O-N 2.9Å; Q66-E68 VanDerWaalsContact C-N 3.34Å; Q66-E68 PolarHBondContact O-N 2.9Å; Q66-M69 PolarHBondContact O-N 3.37Å; Q66-V70 WeakPolarHBondContact O-CG2 3.37Å; Q66-V70 PolarHBondContact O-N 3.16Å
67	K	92.4	Very high	90.2	Very high	133 Å²	133	119.7 Å²	119.7	58%	0.578	57%	0.567	S	S	*	*	H	α-helix	trans	-62.8	-40.3	176.1	-75	179.2	175.9	-175.1	0	112.2	I63 M64 V70 W71	I63-K67 HydrophobicContact CG2-CD 4.09Å; I63-K67 HydrophobicContact CG2-CG 4.46Å; I63-K67 WeakPolarHBondContact O-CB 3.42Å; I63-K67 WeakPolarHBondContact O-CG 3.43Å; I63-K67 PolarHBondContact O-N 2.95Å; M64-K67 PolarHBondContact O-N 2.74Å; K67-V70 PolarHBondContact O-N 3.29Å; K67-W71 WeakPolarHBondContact O-CB 3.43Å; K67-W71 PolarHBondContact O-N 3.03Å
68	E	92.1	Very high	89.8	Confident	127 Å²	127	118.9 Å²	118.9	59%	0.593	56%	0.564	S	S	*	*	H	α-helix	trans	-64.7	-43.7	176.6	-175.3	175.9	-164.9	0	0	111.9	M64 K65 Q66 V70 W71 N72	M64-E68 WeakPolarHBondContact O-CB 3.33Å; M64-E68 PolarHBondContact O-N 3Å; K65-E68 PolarHBondContact O-N 3.23Å; Q66-E68 VanDerWaalsContact C-N 3.34Å; Q66-E68 PolarHBondContact O-N 2.9Å; E68-V70 PolarHBondContact O-N 3.32Å; E68-W71 PolarHBondContact O-N 3.36Å; E68-N72 WeakPolarHBondContact O-CB 3.32Å; E68-N72 PolarHBondContact O-N 2.98Å
69	M	89.1	Confident	89.4	Confident	123 Å²	123	120 Å²	120	61%	0.606	57%	0.572	S	S	*	*	H	α-helix	trans	-59.3	-46.5	174	-72.1	178.3	-166.8	0	0	111.6	K65 Q66 N72 N73	K65-M69 WeakPolarHBondContact O-CG 3.46Å; K65-M69 PolarHBondContact O-N 3.25Å; Q66-M69 PolarHBondContact O-N 3.37Å; M69-N72 PolarHBondContact O-N 2.98Å; M69-N73 WeakPolarHBondContact O-CB 3.47Å; M69-N73 PolarHBondContact O-N 2.88Å; M69-N73 PolarHBondContact O-ND2 3.42Å
70	V	88.1	Confident	89.2	Confident	83 Å²	83	123 Å²	123	50%	0.503	59%	0.585	S	S	.	*	H	α-helix	trans	-63.3	-42.9	177.7	173.4	0	0	0	0	110.9	Q66 K67 E68 N73 N74	Q66-V70 WeakPolarHBondContact O-CG2 3.37Å; Q66-V70 PolarHBondContact O-N 3.16Å; K67-V70 PolarHBondContact O-N 3.29Å; E68-V70 PolarHBondContact O-N 3.32Å; V70-N73 PolarHBondContact O-N 3.46Å; V70-N74 WeakPolarHBondContact CG1-ND2 3.17Å; V70-N74 VanDerWaalsContact O-CB 3.25Å; V70-N74 WeakPolarHBondContact O-CB 3.39Å; V70-N74 VanDerWaalsContact O-CG 3.26Å; V70-N74 PolarHBondContact O-N 2.88Å; V70-N74 PolarHBondContact O-ND2 2.87Å
71	W	85.1	Confident	88.9	Confident	165 Å²	165	119.6 Å²	119.6	63%	0.625	58%	0.577	S	S	*	*	H	α-helix	trans	-62.8	-44.1	177.3	178	70.3	0	0	0	112.1	K67 E68 N74 K75	K67-W71 WeakPolarHBondContact O-CB 3.43Å; K67-W71 PolarHBondContact O-N 3.03Å; E68-W71 PolarHBondContact O-N 3.36Å; W71-N74 CarbonylContact O-C 3.49Å; W71-N74 PolarHBondContact O-N 2.9Å; W71-K75 WeakPolarHBondContact O-CB 3.42Å; W71-K75 PolarHBondContact O-N 3.35Å
72	N	83.6	Confident	88.7	Confident	99 Å²	99	118.7 Å²	118.7	53%	0.529	57%	0.574	S	S	.	*	H	α-helix	trans	-65.8	-39.4	178.8	-166.9	59.4	0	0	0	112.1	E68 M69 K75	E68-N72 WeakPolarHBondContact O-CB 3.32Å; E68-N72 PolarHBondContact O-N 2.98Å; M69-N72 PolarHBondContact O-N 2.98Å; N72-K75 WeakPolarHBondContact O-CB 3.22Å; N72-K75 PolarHBondContact O-N 2.91Å
73	N	81.2	Confident	88.5	Confident	128 Å²	128	115 Å²	115	68%	0.684	56%	0.564	S	S	*	*	H	α-helix	trans	-69.1	-34.5	176	-68.3	-11.3	0	0	0	112.6	M69 V70 K75	M69-N73 WeakPolarHBondContact O-CB 3.47Å; M69-N73 PolarHBondContact O-N 2.88Å; M69-N73 PolarHBondContact O-ND2 3.42Å; V70-N73 PolarHBondContact O-N 3.46Å; N73-K75 VanDerWaalsContact C-N 3.32Å
74	N	80.1	Confident	88.4	Confident	120 Å²	120	113.8 Å²	113.8	64%	0.642	57%	0.566	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.9	2.9	179.2	-67.3	-21	0	0	0	112.9	V70 W71 K76	V70-N74 WeakPolarHBondContact CG1-ND2 3.17Å; V70-N74 VanDerWaalsContact O-CB 3.25Å; V70-N74 WeakPolarHBondContact O-CB 3.39Å; V70-N74 VanDerWaalsContact O-CG 3.26Å; V70-N74 PolarHBondContact O-N 2.88Å; V70-N74 PolarHBondContact O-ND2 2.87Å; W71-N74 CarbonylContact O-C 3.49Å; W71-N74 PolarHBondContact O-N 2.9Å; N74-K76 PolarHBondContact O-N 2.92Å; N74-K76 VanDerWaalsContact O-N 3.16Å
75	K	83.4	Confident	88.4	Confident	130 Å²	130	114 Å²	114	57%	0.565	56%	0.563	S	S	*	*	P	Polyproline II helix	trans	-63.4	120.7	177.6	-172.6	175.3	176	-174.6	0	107.3	W71 N72 N73 L77	W71-K75 WeakPolarHBondContact O-CB 3.42Å; W71-K75 PolarHBondContact O-N 3.35Å; N72-K75 WeakPolarHBondContact O-CB 3.22Å; N72-K75 PolarHBondContact O-N 2.91Å; N73-K75 VanDerWaalsContact C-N 3.32Å; K75-L77 PolarHBondContact O-N 2.91Å
76	K	81.6	Confident	88.5	Confident	191 Å²	191	112.9 Å²	112.9	83%	0.83	56%	0.56	S	S	*	*	P	Polyproline II helix	trans	-57.9	137.4	174.7	-67.6	-175.5	177.4	-175.4	0	108.4	N74 S78	N74-K76 PolarHBondContact O-N 2.92Å; N74-K76 VanDerWaalsContact O-N 3.16Å; K76-S78 PolarHBondContact O-N 3.18Å
77	L	79.9	Confident	88.6	Confident	78 Å²	78	116.6 Å²	116.6	41%	0.408	57%	0.57	S	S	.	*	P	Polyproline II helix	trans	-52.8	138.7	169.3	-73.9	145.6	0	0	0	108	K75 E81 E82 K85	K75-L77 PolarHBondContact O-N 2.91Å; L77-E81 WeakPolarHBondContact CA-OE2 3.5Å; L77-E81 HydrophobicContact CB-CB 4.09Å; L77-E81 HydrophobicContact CD2-CB 3.52Å; L77-E81 HydrophobicContact CD2-CG 4.48Å; L77-E81 HydrophobicContact CG-CB 4.43Å; L77-E82 HydrophobicContact CB-CB 4.36Å; L77-K85 HydrophobicContact CD1-CD 4.05Å
78	S	86.8	Confident	88.8	Confident	60 Å²	60	112.6 Å²	112.6	42%	0.42	56%	0.562	S	S	.	*	P	Polyproline II helix	trans	-62.7	151.9	166.4	177.7	0	0	0	0	109.2	K76 L80 E81 E82	K76-S78 PolarHBondContact O-N 3.18Å; S78-L80 PolarHBondContact O-N 3.16Å; S78-E81 PolarHBondContact N-OE2 3.4Å; S78-E81 WeakPolarHBondContact O-CA 3.33Å; S78-E81 WeakPolarHBondContact O-CB 3.34Å; S78-E81 PolarHBondContact O-N 3.41Å; S78-E82 PolarHBondContact O-N 3.32Å
79	D	88.8	Confident	89	Confident	130 Å²	130	111.3 Å²	111.3	70%	0.695	56%	0.556	S	S	*	*	H	α-helix	trans	-48.4	-37.4	176	-54.4	-8.4	0	0	0	112.2	V83	D79-V83 VanDerWaalsContact O-CG2 3.27Å; D79-V83 WeakPolarHBondContact O-CG2 3.42Å; D79-V83 PolarHBondContact O-N 3.4Å
80	L	91.3	Very high	89.4	Confident	145 Å²	145	109.3 Å²	109.3	76%	0.759	55%	0.548	S	S	*	.	H	α-helix	trans	-64.6	-42.6	174.9	-77.2	159.6	0	0	0	113	S78 A84	S78-L80 PolarHBondContact O-N 3.16Å; L80-A84 WeakPolarHBondContact O-CB 3.45Å; L80-A84 PolarHBondContact O-N 2.96Å
81	E	91.2	Very high	89.9	Confident	104 Å²	104	111 Å²	111	49%	0.486	55%	0.553	S	S	.	*	H	α-helix	trans	-72.2	-35	179.5	-61.3	174.5	141.7	0	0	111.2	L77 S78 A84 K85	L77-E81 WeakPolarHBondContact CA-OE2 3.5Å; L77-E81 HydrophobicContact CB-CB 4.09Å; L77-E81 HydrophobicContact CD2-CB 3.52Å; L77-E81 HydrophobicContact CD2-CG 4.48Å; L77-E81 HydrophobicContact CG-CB 4.43Å; S78-E81 PolarHBondContact N-OE2 3.4Å; S78-E81 WeakPolarHBondContact O-CA 3.33Å; S78-E81 WeakPolarHBondContact O-CB 3.34Å; S78-E81 PolarHBondContact O-N 3.41Å; E81-A84 PolarHBondContact O-N 3.38Å; E81-K85 WeakPolarHBondContact O-CB 3.49Å; E81-K85 PolarHBondContact O-N 3.47Å
82	E	91.6	Very high	90.5	Very high	115 Å²	115	108.4 Å²	108.4	54%	0.537	55%	0.551	S	S	.	*	H	α-helix	trans	-65.4	-46.9	175	-169.5	164.5	-148.3	0	0	111.1	L77 S78 A84 K85 E86	L77-E82 HydrophobicContact CB-CB 4.36Å; S78-E82 PolarHBondContact O-N 3.32Å; E82-A84 VanDerWaalsContact C-N 3.32Å; E82-A84 PolarHBondContact O-N 2.85Å; E82-K85 WeakPolarHBondContact O-CB 3.35Å; E82-K85 PolarHBondContact O-N 2.88Å; E82-E86 PolarHBondContact O-N 3.32Å
83	V	93.9	Very high	91.1	Very high	62 Å²	62	109.6 Å²	109.6	38%	0.376	55%	0.554	S	S	.	*	H	α-helix	trans	-60.7	-41	173.6	170.8	0	0	0	0	111.4	D79 E86 R87	D79-V83 VanDerWaalsContact O-CG2 3.27Å; D79-V83 WeakPolarHBondContact O-CG2 3.42Å; D79-V83 PolarHBondContact O-N 3.4Å; V83-E86 PolarHBondContact O-N 2.93Å; V83-R87 WeakPolarHBondContact O-CB 3.25Å; V83-R87 VanDerWaalsContact O-CG 3.28Å; V83-R87 WeakPolarHBondContact O-CG 3.39Å; V83-R87 PolarHBondContact O-N 3.35Å
84	A	94.1	Very high	91.9	Very high	56 Å²	56	112 Å²	112	46%	0.463	55%	0.553	S	S	.	*	H	α-helix	trans	-63.8	-43	176.8	0	0	0	0	0	111.9	L80 E81 E82 R87 A88	L80-A84 WeakPolarHBondContact O-CB 3.45Å; L80-A84 PolarHBondContact O-N 2.96Å; E81-A84 PolarHBondContact O-N 3.38Å; E82-A84 VanDerWaalsContact C-N 3.32Å; E82-A84 PolarHBondContact O-N 2.85Å; A84-R87 PolarHBondContact O-N 3.28Å; A84-A88 WeakPolarHBondContact O-CB 3.36Å; A84-A88 PolarHBondContact O-N 2.84Å
85	K	94.4	Very high	92.7	Very high	106 Å²	106	108.8 Å²	108.8	46%	0.461	54%	0.543	S	S	.	.	H	α-helix	trans	-61.5	-46.7	175.9	-179.1	-177.2	176	-173.6	0	111.3	L77 E81 E82 R87 A88 Q89	L77-K85 HydrophobicContact CD1-CD 4.05Å; E81-K85 WeakPolarHBondContact O-CB 3.49Å; E81-K85 PolarHBondContact O-N 3.47Å; E82-K85 WeakPolarHBondContact O-CB 3.35Å; E82-K85 PolarHBondContact O-N 2.88Å; K85-R87 PolarHBondContact O-N 3.43Å; K85-A88 PolarHBondContact O-N 3.03Å; K85-Q89 WeakPolarHBondContact O-CB 3.33Å; K85-Q89 WeakPolarHBondContact O-CG 3.37Å; K85-Q89 PolarHBondContact O-N 3.36Å
86	E	96.1	Very high	93.4	Very high	110 Å²	110	106.2 Å²	106.2	51%	0.514	54%	0.536	S	S	.	.	H	α-helix	trans	-60.6	-46.3	178.3	-172.6	-172.1	177.2	0	0	111.2	E82 V83 A88 Q89 N90	E82-E86 PolarHBondContact O-N 3.32Å; V83-E86 PolarHBondContact O-N 2.93Å; E86-A88 VanDerWaalsContact C-N 3.34Å; E86-A88 PolarHBondContact O-N 3.4Å; E86-Q89 PolarHBondContact O-N 3.49Å; E86-N90 WeakPolarHBondContact O-CB 3.4Å; E86-N90 PolarHBondContact O-N 2.87Å; E86-N90 PolarHBondContact O-ND2 2.99Å
87	R	96	Very high	94	Very high	183 Å²	183	103.4 Å²	103.4	69%	0.691	52%	0.523	S	S	*	.	H	α-helix	trans	-59.4	-44.6	176.2	-73.8	175.7	-175.9	-167.8	3	112.1	V83 A84 K85 N90 L91	V83-R87 WeakPolarHBondContact O-CB 3.25Å; V83-R87 VanDerWaalsContact O-CG 3.28Å; V83-R87 WeakPolarHBondContact O-CG 3.39Å; V83-R87 PolarHBondContact O-N 3.35Å; A84-R87 PolarHBondContact O-N 3.28Å; K85-R87 PolarHBondContact O-N 3.43Å; R87-N90 PolarHBondContact O-N 3.4Å; R87-L91 WeakPolarHBondContact O-CB 3.32Å; R87-L91 PolarHBondContact O-N 3.35Å
88	A	96.3	Very high	94.8	Very high	50 Å²	50	103.8 Å²	103.8	41%	0.413	53%	0.525	S	S	.	.	H	α-helix	trans	-63.6	-42.9	177.9	0	0	0	0	0	111.8	A84 K85 E86 L91 L92	A84-A88 WeakPolarHBondContact O-CB 3.36Å; A84-A88 PolarHBondContact O-N 2.84Å; K85-A88 PolarHBondContact O-N 3.03Å; E86-A88 VanDerWaalsContact C-N 3.34Å; E86-A88 PolarHBondContact O-N 3.4Å; A88-L91 PolarHBondContact O-N 3.23Å; A88-L92 WeakPolarHBondContact O-CG 3.46Å; A88-L92 PolarHBondContact O-N 3.33Å
89	Q	96.6	Very high	95.2	Very high	99 Å²	99	108.5 Å²	108.5	46%	0.463	53%	0.534	S	S	.	.	H	α-helix	trans	-63.7	-46.8	176.7	-74.5	-179.9	-22.1	0	0	112	K85 E86 L91 L92 Q93	K85-Q89 WeakPolarHBondContact O-CB 3.33Å; K85-Q89 WeakPolarHBondContact O-CG 3.37Å; K85-Q89 PolarHBondContact O-N 3.36Å; E86-Q89 PolarHBondContact O-N 3.49Å; Q89-L91 VanDerWaalsContact C-N 3.29Å; Q89-L91 PolarHBondContact O-N 3.43Å; Q89-L92 PolarHBondContact O-N 2.98Å; Q89-Q93 WeakPolarHBondContact O-CB 3.4Å; Q89-Q93 WeakPolarHBondContact O-CG 3.37Å; Q89-Q93 PolarHBondContact O-N 3.43Å
90	N	97.6	Very high	95.4	Very high	81 Å²	81	106.8 Å²	106.8	43%	0.433	52%	0.523	S	S	.	.	H	α-helix	trans	-59.2	-40.7	175.9	-82.3	-43.2	0	0	0	111.8	E86 R87 Q93 R94	E86-N90 WeakPolarHBondContact O-CB 3.4Å; E86-N90 PolarHBondContact O-N 2.87Å; E86-N90 PolarHBondContact O-ND2 2.99Å; R87-N90 PolarHBondContact O-N 3.4Å; N90-Q93 PolarHBondContact O-N 2.96Å; N90-R94 VanDerWaalsContact O-CB 3.3Å; N90-R94 WeakPolarHBondContact O-CB 3.32Å; N90-R94 PolarHBondContact O-N 3.42Å
91	L	97.8	Very high	95.4	Very high	118 Å²	118	104.4 Å²	104.4	62%	0.618	51%	0.508	S	S	*	.	H	α-helix	trans	-63.5	-45.5	176.6	-176.7	63.6	0	0	0	111.7	R87 A88 Q89 R94 A95	R87-L91 WeakPolarHBondContact O-CB 3.32Å; R87-L91 PolarHBondContact O-N 3.35Å; A88-L91 PolarHBondContact O-N 3.23Å; Q89-L91 VanDerWaalsContact C-N 3.29Å; Q89-L91 PolarHBondContact O-N 3.43Å; L91-R94 PolarHBondContact O-N 2.96Å; L91-A95 WeakPolarHBondContact O-CB 3.44Å; L91-A95 PolarHBondContact O-N 3.49Å
92	L	97.5	Very high	95.5	Very high	111 Å²	111	105.9 Å²	105.9	58%	0.581	52%	0.515	S	S	*	.	H	α-helix	trans	-63.6	-44.6	177.2	-73.9	171.3	0	0	0	112	A88 Q89 R94 A95 N96	A88-L92 WeakPolarHBondContact O-CG 3.46Å; A88-L92 PolarHBondContact O-N 3.33Å; Q89-L92 PolarHBondContact O-N 2.98Å; L92-R94 VanDerWaalsContact C-N 3.33Å; L92-R94 PolarHBondContact O-N 2.9Å; L92-A95 PolarHBondContact O-N 3.36Å; L92-N96 WeakPolarHBondContact O-CB 3.38Å; L92-N96 PolarHBondContact O-N 3.47Å; L92-N96 PolarHBondContact O-ND2 2.88Å
93	Q	97.4	Very high	95.6	Very high	125 Å²	125	104.8 Å²	104.8	58%	0.584	51%	0.51	S	S	*	.	H	α-helix	trans	-60.5	-44.2	175.9	-74.9	179.9	-15.5	0	0	111.3	Q89 N90 N96 K97	Q89-Q93 WeakPolarHBondContact O-CB 3.4Å; Q89-Q93 WeakPolarHBondContact O-CG 3.37Å; Q89-Q93 PolarHBondContact O-N 3.43Å; N90-Q93 PolarHBondContact O-N 2.96Å; Q93-N96 PolarHBondContact O-N 3.41Å; Q93-K97 WeakPolarHBondContact O-CB 3.42Å; Q93-K97 PolarHBondContact O-N 2.92Å
94	R	97.9	Very high	95.5	Very high	177 Å²	177	109 Å²	109	67%	0.668	53%	0.525	S	S	*	.	H	α-helix	trans	-62.6	-44.5	176.4	-175.7	177	177.8	-178.6	-0.5	112	N90 L91 L92 K97 L98	N90-R94 VanDerWaalsContact O-CB 3.3Å; N90-R94 WeakPolarHBondContact O-CB 3.32Å; N90-R94 PolarHBondContact O-N 3.42Å; L91-R94 PolarHBondContact O-N 2.96Å; L92-R94 VanDerWaalsContact C-N 3.33Å; L92-R94 PolarHBondContact O-N 2.9Å; R94-K97 PolarHBondContact O-N 3.2Å; R94-L98 HydrophobicContact CG-CD1 4.25Å; R94-L98 WeakPolarHBondContact O-CG 3.37Å; R94-L98 PolarHBondContact O-N 2.87Å
95	A	97.2	Very high	95.5	Very high	53 Å²	53	114.3 Å²	114.3	44%	0.438	54%	0.541	S	S	.	.	H	α-helix	trans	-61.9	-44.1	177.5	0	0	0	0	0	111.6	L91 L92 L98 R99	L91-A95 WeakPolarHBondContact O-CB 3.44Å; L91-A95 PolarHBondContact O-N 3.49Å; L92-A95 PolarHBondContact O-N 3.36Å; A95-L98 PolarHBondContact O-N 3.13Å; A95-R99 WeakPolarHBondContact O-CB 3.45Å; A95-R99 PolarHBondContact O-N 3.04Å
96	N	96.5	Very high	95.4	Very high	77 Å²	77	112.8 Å²	112.8	41%	0.412	54%	0.537	S	S	.	.	H	α-helix	trans	-63.2	-43	176	-77.9	-30.8	0	0	0	112	L92 Q93 R99 M100	L92-N96 WeakPolarHBondContact O-CB 3.38Å; L92-N96 PolarHBondContact O-N 3.47Å; L92-N96 PolarHBondContact O-ND2 2.88Å; Q93-N96 PolarHBondContact O-N 3.41Å; N96-R99 WeakPolarHBondContact O-CB 3.33Å; N96-R99 PolarHBondContact O-N 2.95Å; N96-M100 WeakPolarHBondContact O-CG 3.43Å; N96-M100 PolarHBondContact O-N 2.9Å
97	K	96.1	Very high	95.3	Very high	132 Å²	132	112.4 Å²	112.4	57%	0.574	53%	0.533	S	S	*	.	H	α-helix	trans	-60.4	-48	176.7	-173.9	-179.8	-178.5	-172.5	0	111.6	Q93 R94 R99 M100 E101	Q93-K97 WeakPolarHBondContact O-CB 3.42Å; Q93-K97 PolarHBondContact O-N 2.92Å; R94-K97 PolarHBondContact O-N 3.2Å; K97-R99 VanDerWaalsContact C-N 3.27Å; K97-R99 PolarHBondContact O-N 3.44Å; K97-M100 PolarHBondContact O-N 3.4Å; K97-E101 WeakPolarHBondContact CE-OE1 3.38Å; K97-E101 IonicContact NZ-OE1 3.99Å; K97-E101 WeakPolarHBondContact O-CG 3.28Å; K97-E101 PolarHBondContact O-N 3.22Å
98	L	95.4	Very high	95.3	Very high	85 Å²	85	106.9 Å²	106.9	45%	0.445	52%	0.518	S	S	.	.	H	α-helix	trans	-61.4	-37.4	177.3	-72.1	172.1	0	0	0	112	R94 A95 Q102	R94-L98 HydrophobicContact CG-CD1 4.25Å; R94-L98 WeakPolarHBondContact O-CG 3.37Å; R94-L98 PolarHBondContact O-N 2.87Å; A95-L98 PolarHBondContact O-N 3.13Å; L98-Q102 WeakPolarHBondContact O-CG 3.33Å; L98-Q102 PolarHBondContact O-N 3.13Å
99	R	95.3	Very high	95.3	Very high	160 Å²	160	109.5 Å²	109.5	60%	0.604	52%	0.523	S	S	*	.	H	α-helix	trans	-64.8	-45.9	175.3	-172.5	-178	67.3	160.3	2.2	111.5	A95 N96 K97 Q102	A95-R99 WeakPolarHBondContact O-CB 3.45Å; A95-R99 PolarHBondContact O-N 3.04Å; N96-R99 WeakPolarHBondContact O-CB 3.33Å; N96-R99 PolarHBondContact O-N 2.95Å; K97-R99 VanDerWaalsContact C-N 3.27Å; K97-R99 PolarHBondContact O-N 3.44Å; R99-Q102 WeakPolarHBondContact O-CB 3.46Å; R99-Q102 PolarHBondContact O-N 2.95Å; R99-Q102 VanDerWaalsContact O-N 3.16Å
100	M	93.4	Very high	95.2	Very high	93 Å²	93	108.2 Å²	108.2	46%	0.458	53%	0.525	S	S	.	.	H	α-helix	trans	-62.6	-44.2	176.5	-70.8	176.2	68.6	0	0	111.4	N96 K97 Q102 E103 L106	N96-M100 WeakPolarHBondContact O-CG 3.43Å; N96-M100 PolarHBondContact O-N 2.9Å; K97-M100 PolarHBondContact O-N 3.4Å; M100-Q102 PolarHBondContact O-N 2.87Å; M100-E103 VanDerWaalsContact O-CB 3.22Å; M100-E103 WeakPolarHBondContact O-CB 3.35Å; M100-E103 WeakPolarHBondContact O-CG 3.37Å; M100-E103 PolarHBondContact O-N 3.29Å; M100-L106 HydrophobicContact CB-CD1 3.86Å; M100-L106 HydrophobicContact CE-CD1 4.37Å; M100-L106 WeakPolarHBondContact O-CD1 3.49Å
101	E	91.7	Very high	95.1	Very high	96 Å²	96	110.6 Å²	110.6	45%	0.449	53%	0.531	S	S	.	.	H	α-helix	trans	-59	-19.8	176	-73.9	173.7	-179	0	0	113.5	K97 K107	K97-E101 WeakPolarHBondContact CE-OE1 3.38Å; K97-E101 IonicContact NZ-OE1 3.99Å; K97-E101 WeakPolarHBondContact O-CG 3.28Å; K97-E101 PolarHBondContact O-N 3.22Å; E101-K107 WeakPolarHBondContact O-CE 3.36Å; E101-K107 WeakPolarHBondContact O-CG 3.49Å
102	Q	92.6	Very high	95.1	Very high	135 Å²	135	110.3 Å²	110.3	63%	0.631	53%	0.529	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79	-20.1	174.3	-72.3	-179.5	14	0	0	113.8	L98 R99 M100 K107	L98-Q102 WeakPolarHBondContact O-CG 3.33Å; L98-Q102 PolarHBondContact O-N 3.13Å; R99-Q102 WeakPolarHBondContact O-CB 3.46Å; R99-Q102 PolarHBondContact O-N 2.95Å; R99-Q102 VanDerWaalsContact O-N 3.16Å; M100-Q102 PolarHBondContact O-N 2.87Å; Q102-K107 VanDerWaalsContact O-CE 3.24Å; Q102-K107 WeakPolarHBondContact O-CE 3.19Å; Q102-K107 PolarHBondContact O-NZ 2.82Å
103	E	94.6	Very high	95.1	Very high	92 Å²	92	109 Å²	109	43%	0.43	52%	0.522	S	S	.	.	S	Bend	trans	-61.1	133.1	178.2	-62.9	171.6	-170.6	0	0	110.3	M100 E105 L106 K107	M100-E103 VanDerWaalsContact O-CB 3.22Å; M100-E103 WeakPolarHBondContact O-CB 3.35Å; M100-E103 WeakPolarHBondContact O-CG 3.37Å; M100-E103 PolarHBondContact O-N 3.29Å; E103-E105 PolarHBondContact O-N 2.93Å; E103-L106 HydrophobicContact CB-CB 4.46Å; E103-L106 HydrophobicContact CB-CD1 4.48Å; E103-L106 PolarHBondContact O-N 3.49Å; E103-K107 PolarHBondContact O-N 2.96Å
104	E	91.7	Very high	95.1	Very high	151 Å²	151	108.2 Å²	108.2	71%	0.706	52%	0.521	S	S	*	.	H	α-helix	trans	-62.3	-42.3	-170.4	-172.1	173.8	-164.1	0	0	112.4	L106 K107 D108	E104-L106 VanDerWaalsContact C-N 3.28Å; E104-L106 PolarHBondContact O-N 3.35Å; E104-K107 WeakPolarHBondContact O-CB 3.21Å; E104-K107 PolarHBondContact O-N 3.49Å; E104-K107 VanDerWaalsContact O-N 3.1Å; E104-D108 PolarHBondContact O-N 2.85Å
105	E	93.8	Very high	95.1	Very high	167 Å²	167	104 Å²	104	78%	0.78	51%	0.512	S	S	*	.	H	α-helix	trans	-58	-41.1	176.7	-59.8	-179.6	-179.6	0	0	111.9	E103 D108 M109	E103-E105 PolarHBondContact O-N 2.93Å; E105-D108 PolarHBondContact O-N 2.81Å; E105-M109 WeakPolarHBondContact O-CB 3.31Å; E105-M109 PolarHBondContact O-N 2.95Å
106	L	91.9	Very high	95.2	Very high	73 Å²	73	104.2 Å²	104.2	38%	0.382	51%	0.514	S	S	.	.	H	α-helix	trans	-70.7	-35.3	177.6	-77.9	179.5	0	0	0	112.2	M100 E103 E104 S110	M100-L106 HydrophobicContact CB-CD1 3.86Å; M100-L106 HydrophobicContact CE-CD1 4.37Å; M100-L106 WeakPolarHBondContact O-CD1 3.49Å; E103-L106 HydrophobicContact CB-CB 4.46Å; E103-L106 HydrophobicContact CB-CD1 4.48Å; E103-L106 PolarHBondContact O-N 3.49Å; E104-L106 VanDerWaalsContact C-N 3.28Å; E104-L106 PolarHBondContact O-N 3.35Å; L106-S110 WeakPolarHBondContact O-CB 3.27Å; L106-S110 PolarHBondContact O-N 2.93Å
107	K	94.1	Very high	95.3	Very high	102 Å²	102	106.7 Å²	106.7	44%	0.443	52%	0.521	S	S	.	.	H	α-helix	trans	-64	-43	172.6	-71.3	178.7	-178.8	157.9	0	111.7	E101 Q102 E103 E104 S110 K111	E101-K107 WeakPolarHBondContact O-CE 3.36Å; E101-K107 WeakPolarHBondContact O-CG 3.49Å; Q102-K107 VanDerWaalsContact O-CE 3.24Å; Q102-K107 WeakPolarHBondContact O-CE 3.19Å; Q102-K107 PolarHBondContact O-NZ 2.82Å; E103-K107 PolarHBondContact O-N 2.96Å; E104-K107 WeakPolarHBondContact O-CB 3.21Å; E104-K107 PolarHBondContact O-N 3.49Å; E104-K107 VanDerWaalsContact O-N 3.1Å; K107-S110 WeakPolarHBondContact O-CB 3.38Å; K107-S110 PolarHBondContact O-N 3.28Å; K107-K111 WeakPolarHBondContact O-CG 3.33Å; K107-K111 PolarHBondContact O-N 3.48Å
108	D	95.9	Very high	95.4	Very high	68 Å²	68	103.6 Å²	103.6	36%	0.364	52%	0.515	S	S	.	.	H	α-helix	trans	-67.7	-42	179.4	-74.5	-16.2	0	0	0	111.7	E104 E105 S110 K111 I112	E104-D108 PolarHBondContact O-N 2.85Å; E105-D108 PolarHBondContact O-N 2.81Å; D108-S110 VanDerWaalsContact C-N 3.29Å; D108-S110 PolarHBondContact O-N 3.31Å; D108-K111 WeakPolarHBondContact O-CB 3.26Å; D108-K111 PolarHBondContact O-N 3.45Å; D108-K111 VanDerWaalsContact O-N 3.14Å; D108-K111 IonicContact OD1-NZ 2.67Å; D108-K111 PolarHBondContact OD1-NZ 3.35Å; D108-I112 WeakPolarHBondContact O-CG1 3.36Å; D108-I112 PolarHBondContact O-N 2.88Å
109	M	95.5	Very high	95.5	Very high	104 Å²	104	104 Å²	104	51%	0.512	52%	0.515	S	S	.	.	H	α-helix	trans	-56.9	-44	169.8	-173.6	61.6	68.4	0	0	111.6	E105 K111 I112 I113	E105-M109 WeakPolarHBondContact O-CB 3.31Å; E105-M109 PolarHBondContact O-N 2.95Å; M109-K111 VanDerWaalsContact C-N 3.3Å; M109-K111 PolarHBondContact O-N 2.96Å; M109-I112 PolarHBondContact O-N 3.4Å; M109-I113 HydrophobicContact CG-CD1 4.01Å; M109-I113 WeakPolarHBondContact O-CG1 3.42Å; M109-I113 PolarHBondContact O-N 2.84Å
110	S	94.8	Very high	95.6	Very high	73 Å²	73	99.3 Å²	99.3	51%	0.51	51%	0.51	S	S	.	.	H	α-helix	trans	-61.6	-35.9	177.4	-171	0	0	0	0	112.8	L106 K107 D108 L114	L106-S110 WeakPolarHBondContact O-CB 3.27Å; L106-S110 PolarHBondContact O-N 2.93Å; K107-S110 WeakPolarHBondContact O-CB 3.38Å; K107-S110 PolarHBondContact O-N 3.28Å; D108-S110 VanDerWaalsContact C-N 3.29Å; D108-S110 PolarHBondContact O-N 3.31Å; S110-L114 WeakPolarHBondContact O-CB 3.24Å; S110-L114 PolarHBondContact O-N 3.42Å
111	K	96.2	Very high	95.9	Very high	130 Å²	130	99.8 Å²	99.8	57%	0.565	51%	0.513	S	S	*	.	H	α-helix	trans	-65.8	-42.9	174.2	-67.1	169.4	-167.2	157	0	111.4	K107 D108 M109 L114 N115	K107-K111 WeakPolarHBondContact O-CG 3.33Å; K107-K111 PolarHBondContact O-N 3.48Å; D108-K111 WeakPolarHBondContact O-CB 3.26Å; D108-K111 PolarHBondContact O-N 3.45Å; D108-K111 VanDerWaalsContact O-N 3.14Å; D108-K111 IonicContact OD1-NZ 2.67Å; D108-K111 PolarHBondContact OD1-NZ 3.35Å; M109-K111 VanDerWaalsContact C-N 3.3Å; M109-K111 PolarHBondContact O-N 2.96Å; K111-L114 PolarHBondContact O-N 3.26Å; K111-N115 WeakPolarHBondContact O-CB 3.4Å; K111-N115 PolarHBondContact O-N 3.22Å
112	I	97.6	Very high	96.2	Very high	113 Å²	113	102.6 Å²	102.6	58%	0.579	52%	0.52	S	S	*	.	H	α-helix	trans	-62	-46.9	177.6	-65.2	167	0	0	0	110.2	D108 M109 L114 N115 A116	D108-I112 WeakPolarHBondContact O-CG1 3.36Å; D108-I112 PolarHBondContact O-N 2.88Å; M109-I112 PolarHBondContact O-N 3.4Å; I112-L114 VanDerWaalsContact C-N 3.32Å; I112-L114 PolarHBondContact O-N 3.1Å; I112-N115 PolarHBondContact O-N 2.95Å; I112-A116 PolarHBondContact O-N 3.42Å
113	I	97.5	Very high	96.5	Very high	82 Å²	82	100.4 Å²	100.4	42%	0.421	51%	0.512	S	S	.	.	H	α-helix	trans	-59.4	-44.5	176.8	-68.1	167.9	0	0	0	110.9	M109 N115 A116 K117	M109-I113 HydrophobicContact CG-CD1 4.01Å; M109-I113 WeakPolarHBondContact O-CG1 3.42Å; M109-I113 PolarHBondContact O-N 2.84Å; I113-N115 VanDerWaalsContact C-N 3.33Å; I113-N115 PolarHBondContact O-N 2.67Å; I113-A116 PolarHBondContact O-N 2.98Å; I113-K117 HydrophobicContact CG2-CD 4.35Å; I113-K117 WeakPolarHBondContact O-CG 3.5Å; I113-K117 PolarHBondContact O-N 3.39Å
114	L	97.8	Very high	96.7	Very high	109 Å²	109	98.7 Å²	98.7	57%	0.571	51%	0.514	S	S	*	.	H	α-helix	trans	-61.4	-44.3	177.6	179.5	62	0	0	0	111.2	S110 K111 I112 K117 C118	S110-L114 WeakPolarHBondContact O-CB 3.24Å; S110-L114 PolarHBondContact O-N 3.42Å; K111-L114 PolarHBondContact O-N 3.26Å; I112-L114 VanDerWaalsContact C-N 3.32Å; I112-L114 PolarHBondContact O-N 3.1Å; L114-K117 WeakPolarHBondContact O-CB 3.33Å; L114-K117 PolarHBondContact O-N 3.29Å; L114-C118 PolarHBondContact O-N 3.28Å; L114-C118 PolarHBondContact O-SG 3.46Å; L114-C118 VanDerWaalsContact O-SG 3.34Å
115	N	98.1	Very high	97	Very high	89 Å²	89	96.9 Å²	96.9	48%	0.476	51%	0.506	S	S	.	.	H	α-helix	trans	-63.1	-45.3	178.7	-164.2	0.4	0	0	0	111.5	K111 I112 I113 K117 C118 H119	K111-N115 WeakPolarHBondContact O-CB 3.4Å; K111-N115 PolarHBondContact O-N 3.22Å; I112-N115 PolarHBondContact O-N 2.95Å; I113-N115 VanDerWaalsContact C-N 3.33Å; I113-N115 PolarHBondContact O-N 2.67Å; N115-K117 VanDerWaalsContact C-N 3.3Å; N115-K117 PolarHBondContact O-N 2.94Å; N115-C118 WeakPolarHBondContact O-CB 3.45Å; N115-C118 PolarHBondContact O-N 2.94Å; N115-C118 VanDerWaalsContact O-N 3.11Å; N115-H119 PolarHBondContact O-CD2 2.89Å; N115-H119 PolarHBondContact O-N 3.35Å; N115-H119 PolarHBondContact OD1-CD2 3.38Å; N115-H119 PolarHBondContact OD1-NE2 3.49Å; N115-H119 VanDerWaalsContact OD1-NE2 3.07Å
116	A	98.4	Very high	97.2	Very high	58 Å²	58	92.8 Å²	92.8	48%	0.479	49%	0.488	S	S	.	.	H	α-helix	trans	-58.1	-40.9	175.3	0	0	0	0	0	112.3	I112 I113 H119 A120	I112-A116 PolarHBondContact O-N 3.42Å; I113-A116 PolarHBondContact O-N 2.98Å; A116-H119 PolarHBondContact O-N 2.92Å; A116-A120 WeakPolarHBondContact O-CB 3.31Å; A116-A120 PolarHBondContact O-N 2.93Å
117	K	98.4	Very high	97.5	Very high	129 Å²	129	94.7 Å²	94.7	56%	0.561	50%	0.498	S	S	*	.	H	α-helix	trans	-62.2	-45.1	173.9	-73.1	177.5	179.6	-176.5	0	111.9	I113 L114 N115 H119 A120 I121	I113-K117 HydrophobicContact CG2-CD 4.35Å; I113-K117 WeakPolarHBondContact O-CG 3.5Å; I113-K117 PolarHBondContact O-N 3.39Å; L114-K117 WeakPolarHBondContact O-CB 3.33Å; L114-K117 PolarHBondContact O-N 3.29Å; N115-K117 VanDerWaalsContact C-N 3.3Å; N115-K117 PolarHBondContact O-N 2.94Å; K117-H119 VanDerWaalsContact C-N 3.33Å; K117-H119 PolarHBondContact O-N 2.94Å; K117-A120 PolarHBondContact O-N 3.35Å; K117-I121 WeakPolarHBondContact O-CG1 3.4Å; K117-I121 PolarHBondContact O-N 3.46Å
118	C	98.1	Very high	97.6	Very high	67 Å²	67	95.6 Å²	95.6	45%	0.453	50%	0.504	S	S	.	.	H	α-helix	trans	-61.4	-42.3	177.2	-70.3	0	0	0	0	111.9	L114 N115 R122	L114-C118 PolarHBondContact O-N 3.28Å; L114-C118 PolarHBondContact O-SG 3.46Å; L114-C118 VanDerWaalsContact O-SG 3.34Å; N115-C118 WeakPolarHBondContact O-CB 3.45Å; N115-C118 PolarHBondContact O-N 2.94Å; N115-C118 VanDerWaalsContact O-N 3.11Å; C118-R122 VanDerWaalsContact O-CB 3.31Å; C118-R122 WeakPolarHBondContact O-CB 3.28Å; C118-R122 PolarHBondContact O-N 2.82Å
119	H	98.3	Very high	97.7	Very high	93 Å²	93	100 Å²	100	43%	0.431	52%	0.52	S	S	.	.	H	α-helix	trans	-61.8	-49.5	175.4	-80.5	-67.2	0	0	0	111.7	N115 A116 K117 I121 R122 D123	N115-H119 PolarHBondContact O-CD2 2.89Å; N115-H119 PolarHBondContact O-N 3.35Å; N115-H119 PolarHBondContact OD1-CD2 3.38Å; N115-H119 PolarHBondContact OD1-NE2 3.49Å; N115-H119 VanDerWaalsContact OD1-NE2 3.07Å; A116-H119 PolarHBondContact O-N 2.92Å; K117-H119 VanDerWaalsContact C-N 3.33Å; K117-H119 PolarHBondContact O-N 2.94Å; H119-I121 VanDerWaalsContact C-N 3.31Å; H119-I121 PolarHBondContact O-N 3.3Å; H119-R122 PolarHBondContact O-N 3.21Å; H119-R122 VanDerWaalsContact O-N 3.12Å; H119-D123 VanDerWaalsContact O-CG 3.23Å; H119-D123 PolarHBondContact O-N 3.23Å
120	A	98.4	Very high	97.8	Very high	62 Å²	62	100 Å²	100	51%	0.512	52%	0.519	S	S	.	.	H	α-helix	trans	-58	-42.6	178.8	0	0	0	0	0	112.7	A116 K117 A124	A116-A120 WeakPolarHBondContact O-CB 3.31Å; A116-A120 PolarHBondContact O-N 2.93Å; K117-A120 PolarHBondContact O-N 3.35Å; A120-A124 PolarHBondContact O-N 2.96Å; A120-A124 VanDerWaalsContact O-N 3.15Å
121	I	98.3	Very high	98	Very high	102 Å²	102	101 Å²	101	52%	0.523	52%	0.515	S	S	.	.	H	α-helix	trans	-65.8	-44.7	176.5	-67.3	166.3	0	0	0	110.6	K117 H119 D123 A124 Q125	K117-I121 WeakPolarHBondContact O-CG1 3.4Å; K117-I121 PolarHBondContact O-N 3.46Å; H119-I121 VanDerWaalsContact C-N 3.31Å; H119-I121 PolarHBondContact O-N 3.3Å; I121-D123 VanDerWaalsContact C-N 3.33Å; I121-D123 PolarHBondContact O-N 2.86Å; I121-A124 PolarHBondContact O-N 2.94Å; I121-Q125 HydrophobicContact CG2-CG 4.37Å; I121-Q125 WeakPolarHBondContact O-CG 3.4Å; I121-Q125 PolarHBondContact O-N 3.18Å
122	R	98.4	Very high	98	Very high	155 Å²	155	98.8 Å²	98.8	59%	0.585	51%	0.509	S	S	*	.	H	α-helix	trans	-60.9	-44.1	179.1	177.7	177.9	-67.2	-166.2	-0.3	111.5	C118 H119 A124 Q125 I126	C118-R122 VanDerWaalsContact O-CB 3.31Å; C118-R122 WeakPolarHBondContact O-CB 3.28Å; C118-R122 PolarHBondContact O-N 2.82Å; H119-R122 PolarHBondContact O-N 3.21Å; H119-R122 VanDerWaalsContact O-N 3.12Å; R122-A124 VanDerWaalsContact C-N 3.32Å; R122-A124 PolarHBondContact O-N 2.9Å; R122-Q125 PolarHBondContact O-N 3.49Å; R122-I126 HydrophobicContact CG-CD1 3.86Å; R122-I126 HydrophobicContact CG-CG1 4.37Å; R122-I126 VanDerWaalsContact O-CG1 3.3Å; R122-I126 WeakPolarHBondContact O-CG1 3.35Å; R122-I126 PolarHBondContact O-N 2.83Å
123	D	98.4	Very high	98	Very high	89 Å²	89	98.1 Å²	98.1	48%	0.476	50%	0.503	S	S	.	.	H	α-helix	trans	-62.7	-43	-179.9	-66.7	-15.3	0	0	0	110.5	H119 I121 Q125 I126 L127	H119-D123 VanDerWaalsContact O-CG 3.23Å; H119-D123 PolarHBondContact O-N 3.23Å; I121-D123 VanDerWaalsContact C-N 3.33Å; I121-D123 PolarHBondContact O-N 2.86Å; D123-Q125 PolarHBondContact O-N 3.39Å; D123-I126 PolarHBondContact O-N 3.38Å; D123-L127 WeakPolarHBondContact O-CG 3.22Å; D123-L127 PolarHBondContact O-N 2.93Å
124	A	98.3	Very high	97.9	Very high	57 Å²	57	100.1 Å²	100.1	47%	0.471	51%	0.509	S	S	.	.	H	α-helix	trans	-59.9	-45.2	173.1	0	0	0	0	0	112.1	A120 I121 R122 I126 L127 E128	A120-A124 PolarHBondContact O-N 2.96Å; A120-A124 VanDerWaalsContact O-N 3.15Å; I121-A124 PolarHBondContact O-N 2.94Å; R122-A124 VanDerWaalsContact C-N 3.32Å; R122-A124 PolarHBondContact O-N 2.9Å; A124-I126 VanDerWaalsContact C-N 3.34Å; A124-I126 PolarHBondContact O-N 3.42Å; A124-L127 PolarHBondContact O-N 3.43Å; A124-E128 WeakPolarHBondContact O-CB 3.08Å; A124-E128 PolarHBondContact O-N 3.28Å
125	Q	98.2	Very high	97.8	Very high	113 Å²	113	99.5 Å²	99.5	53%	0.528	50%	0.503	S	S	.	.	H	α-helix	trans	-64.1	-35.8	177.5	-74	179.4	-30.9	0	0	113	I121 R122 D123 K129	I121-Q125 HydrophobicContact CG2-CG 4.37Å; I121-Q125 WeakPolarHBondContact O-CG 3.4Å; I121-Q125 PolarHBondContact O-N 3.18Å; R122-Q125 PolarHBondContact O-N 3.49Å; D123-Q125 PolarHBondContact O-N 3.39Å; Q125-K129 WeakPolarHBondContact O-CB 3.49Å; Q125-K129 PolarHBondContact O-N 3.21Å
126	I	98.2	Very high	97.7	Very high	80 Å²	80	99 Å²	99	41%	0.41	50%	0.5	S	S	.	.	H	α-helix	trans	-65.5	-45.8	176.1	-71	167.2	0	0	0	109.9	R122 D123 A124 K129 Q130	R122-I126 HydrophobicContact CG-CD1 3.86Å; R122-I126 HydrophobicContact CG-CG1 4.37Å; R122-I126 VanDerWaalsContact O-CG1 3.3Å; R122-I126 WeakPolarHBondContact O-CG1 3.35Å; R122-I126 PolarHBondContact O-N 2.83Å; D123-I126 PolarHBondContact O-N 3.38Å; A124-I126 VanDerWaalsContact C-N 3.34Å; A124-I126 PolarHBondContact O-N 3.42Å; I126-K129 PolarHBondContact O-N 2.95Å; I126-Q130 WeakPolarHBondContact O-CG 3.32Å; I126-Q130 PolarHBondContact O-N 3.47Å
127	L	98.1	Very high	97.5	Very high	114 Å²	114	99.8 Å²	99.8	60%	0.597	50%	0.496	S	S	*	.	H	α-helix	trans	-62.5	-44.6	177.1	-69.2	173.3	0	0	0	111.4	D123 A124 Q130 Q131	D123-L127 WeakPolarHBondContact O-CG 3.22Å; D123-L127 PolarHBondContact O-N 2.93Å; A124-L127 PolarHBondContact O-N 3.43Å; L127-Q130 PolarHBondContact O-N 3.47Å; L127-Q131 WeakPolarHBondContact O-CB 3.49Å; L127-Q131 PolarHBondContact O-N 3.4Å
128	E	97.9	Very high	97.3	Very high	121 Å²	121	98.5 Å²	98.5	57%	0.565	50%	0.499	S	S	*	.	H	α-helix	trans	-59	-47.4	175.8	-176.5	177.8	-152.9	0	0	111.3	A124 Q130 Q131 I132	A124-E128 WeakPolarHBondContact O-CB 3.08Å; A124-E128 PolarHBondContact O-N 3.28Å; E128-Q130 VanDerWaalsContact C-N 3.33Å; E128-Q130 PolarHBondContact O-N 2.91Å; E128-Q131 WeakPolarHBondContact O-CB 3.38Å; E128-Q131 PolarHBondContact O-N 2.57Å; E128-Q131 VanDerWaalsContact O-N 3.14Å; E128-I132 HydrophobicContact CG-CD1 3.99Å; E128-I132 WeakPolarHBondContact O-CG1 3.31Å; E128-I132 PolarHBondContact O-N 3.32Å
129	K	98	Very high	96.8	Very high	159 Å²	159	102.8 Å²	102.8	69%	0.691	51%	0.513	S	S	*	.	H	α-helix	trans	-59.7	-42.5	177.2	-173.8	-175.9	179.3	-175.6	0	112.2	Q125 I126 Q131 I132 Q133	Q125-K129 WeakPolarHBondContact O-CB 3.49Å; Q125-K129 PolarHBondContact O-N 3.21Å; I126-K129 PolarHBondContact O-N 2.95Å; K129-Q131 VanDerWaalsContact C-N 3.31Å; K129-I132 PolarHBondContact O-N 3.07Å; K129-Q133 PolarHBondContact O-N 3.27Å; K129-Q133 VanDerWaalsContact O-N 3.08Å
130	Q	97.4	Very high	96.1	Very high	104 Å²	104	106.3 Å²	106.3	49%	0.486	53%	0.529	S	S	.	.	H	α-helix	trans	-65	-37.8	177.2	-73.1	175.9	3.5	0	0	111.9	I126 L127 E128 K134	I126-Q130 WeakPolarHBondContact O-CG 3.32Å; I126-Q130 PolarHBondContact O-N 3.47Å; L127-Q130 PolarHBondContact O-N 3.47Å; E128-Q130 VanDerWaalsContact C-N 3.33Å; E128-Q130 PolarHBondContact O-N 2.91Å; Q130-K134 WeakPolarHBondContact O-CG 3.33Å; Q130-K134 PolarHBondContact O-N 3.36Å
131	Q	97.4	Very high	94.4	Very high	95 Å²	95	114.7 Å²	114.7	44%	0.444	55%	0.554	S	S	.	*	H	α-helix	trans	-65.6	-47.4	176.8	-176.3	60.4	22.3	0	0	111.2	L127 E128 K129 Q133 K134 E135	L127-Q131 WeakPolarHBondContact O-CB 3.49Å; L127-Q131 PolarHBondContact O-N 3.4Å; E128-Q131 WeakPolarHBondContact O-CB 3.38Å; E128-Q131 PolarHBondContact O-N 2.57Å; E128-Q131 VanDerWaalsContact O-N 3.14Å; K129-Q131 VanDerWaalsContact C-N 3.31Å; Q131-Q133 VanDerWaalsContact C-N 3.32Å; Q131-Q133 PolarHBondContact O-N 3.16Å; Q131-K134 PolarHBondContact O-N 2.87Å; Q131-E135 WeakPolarHBondContact CG-OE1 3.27Å; Q131-E135 PolarHBondContact NE2-OE1 3.18Å; Q131-E135 WeakPolarHBondContact O-CG 3.39Å; Q131-E135 PolarHBondContact O-N 3.19Å
132	I	96.9	Very high	94.2	Very high	83 Å²	83	115.3 Å²	115.3	43%	0.426	56%	0.556	S	S	.	*	H	α-helix	trans	-57.8	-44.6	176.9	-67.2	165.8	0	0	0	111	E128 K129 K134 E135 L136	E128-I132 HydrophobicContact CG-CD1 3.99Å; E128-I132 WeakPolarHBondContact O-CG1 3.31Å; E128-I132 PolarHBondContact O-N 3.32Å; K129-I132 PolarHBondContact O-N 3.07Å; I132-K134 VanDerWaalsContact C-N 3.33Å; I132-K134 PolarHBondContact O-N 3.18Å; I132-E135 PolarHBondContact O-N 3.09Å; I132-L136 HydrophobicContact CG2-CD1 4Å; I132-L136 HydrophobicContact CG2-CG 4.43Å; I132-L136 WeakPolarHBondContact O-CG 3.38Å; I132-L136 PolarHBondContact O-N 3.23Å
133	Q	96.9	Very high	93.9	Very high	99 Å²	99	113.2 Å²	113.2	46%	0.463	55%	0.554	S	S	.	*	H	α-helix	trans	-61.6	-42.4	179	-173	64	54.3	0	0	112	K129 Q131 E135 L136 D137	K129-Q133 PolarHBondContact O-N 3.27Å; K129-Q133 VanDerWaalsContact O-N 3.08Å; Q131-Q133 VanDerWaalsContact C-N 3.32Å; Q131-Q133 PolarHBondContact O-N 3.16Å; Q133-E135 VanDerWaalsContact C-N 3.32Å; Q133-E135 PolarHBondContact O-N 3.42Å; Q133-L136 PolarHBondContact O-N 2.84Å; Q133-D137 PolarHBondContact NE2-OD1 3.46Å; Q133-D137 PolarHBondContact O-N 3.4Å
134	K	96.1	Very high	93.7	Very high	124 Å²	124	114.6 Å²	114.6	54%	0.539	56%	0.558	S	S	.	*	H	α-helix	trans	-62.2	-41.7	176.8	-71.4	172.7	-173.9	174.4	0	111.5	Q130 Q131 I132 D137 T138	Q130-K134 WeakPolarHBondContact O-CG 3.33Å; Q130-K134 PolarHBondContact O-N 3.36Å; Q131-K134 PolarHBondContact O-N 2.87Å; I132-K134 VanDerWaalsContact C-N 3.33Å; I132-K134 PolarHBondContact O-N 3.18Å; K134-D137 PolarHBondContact O-N 3.11Å; K134-T138 PolarHBondContact O-N 3.48Å; K134-T138 VanDerWaalsContact O-N 3.13Å; K134-T138 PolarHBondContact O-OG1 3.21Å
135	E	95.7	Very high	93.4	Very high	97 Å²	97	117.9 Å²	117.9	45%	0.453	56%	0.564	S	S	.	*	H	α-helix	trans	-62.5	-47	178.2	-72	170	-170.4	0	0	110.9	Q131 I132 Q133 D137 T138 E139	Q131-E135 WeakPolarHBondContact CG-OE1 3.27Å; Q131-E135 PolarHBondContact NE2-OE1 3.18Å; Q131-E135 WeakPolarHBondContact O-CG 3.39Å; Q131-E135 PolarHBondContact O-N 3.19Å; I132-E135 PolarHBondContact O-N 3.09Å; Q133-E135 VanDerWaalsContact C-N 3.32Å; Q133-E135 PolarHBondContact O-N 3.42Å; E135-D137 PolarHBondContact O-N 3.09Å; E135-T138 WeakPolarHBondContact O-CB 3.5Å; E135-T138 PolarHBondContact O-N 3.47Å; E135-T138 VanDerWaalsContact O-N 3.1Å; E135-E139 PolarHBondContact O-N 3.3Å
136	L	95.1	Very high	93.1	Very high	77 Å²	77	118.3 Å²	118.3	40%	0.403	57%	0.566	S	S	.	*	H	α-helix	trans	-58.3	-48.6	174.9	-70.4	169.7	0	0	0	112.7	I132 Q133 T138 E139 E140	I132-L136 HydrophobicContact CG2-CD1 4Å; I132-L136 HydrophobicContact CG2-CG 4.43Å; I132-L136 WeakPolarHBondContact O-CG 3.38Å; I132-L136 PolarHBondContact O-N 3.23Å; Q133-L136 PolarHBondContact O-N 2.84Å; L136-T138 PolarHBondContact O-N 3.03Å; L136-T138 VanDerWaalsContact O-N 3.13Å; L136-E139 PolarHBondContact O-N 2.83Å; L136-E139 VanDerWaalsContact O-N 3.11Å; L136-E140 PolarHBondContact O-N 2.96Å
137	D	94.6	Very high	92.8	Very high	76 Å²	76	120.8 Å²	120.8	41%	0.406	58%	0.576	S	S	.	*	H	α-helix	trans	-62.1	-22.6	178.7	-66.2	-9.7	0	0	0	112.7	Q133 K134 E135 K141	Q133-D137 PolarHBondContact NE2-OD1 3.46Å; Q133-D137 PolarHBondContact O-N 3.4Å; K134-D137 PolarHBondContact O-N 3.11Å; E135-D137 PolarHBondContact O-N 3.09Å; D137-K141 WeakPolarHBondContact O-CG 3.44Å
138	T	94.7	Very high	92.4	Very high	101 Å²	101	121.3 Å²	121.3	62%	0.62	58%	0.575	S	S	*	*	H	α-helix	trans	-85	-35.2	177.4	-46.4	0	0	0	0	111.3	K134 E135 L136	K134-T138 PolarHBondContact O-N 3.48Å; K134-T138 VanDerWaalsContact O-N 3.13Å; K134-T138 PolarHBondContact O-OG1 3.21Å; E135-T138 WeakPolarHBondContact O-CB 3.5Å; E135-T138 PolarHBondContact O-N 3.47Å; E135-T138 VanDerWaalsContact O-N 3.1Å; L136-T138 PolarHBondContact O-N 3.03Å; L136-T138 VanDerWaalsContact O-N 3.13Å
139	E	88.4	Confident	92	Very high	158 Å²	158	121.3 Å²	121.3	74%	0.738	58%	0.575	S	S	*	*	H	α-helix	trans	-71.1	-31.3	175.3	-71.2	-175.9	172.3	0	0	113.1	E135 L136 K141	E135-E139 PolarHBondContact O-N 3.3Å; L136-E139 PolarHBondContact O-N 2.83Å; L136-E139 VanDerWaalsContact O-N 3.11Å; E139-K141 VanDerWaalsContact C-N 3.31Å; E139-K141 PolarHBondContact O-N 2.8Å
140	E	81.9	Confident	91.5	Very high	167 Å²	167	118.2 Å²	118.2	78%	0.78	57%	0.566	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.9	-6.2	179.5	-69.8	-173.6	169.7	0	0	114.5	L136	L136-E140 PolarHBondContact O-N 2.96Å
141	K	62.5	Low	90.9	Very high	237 Å²	237	119.5 Å²	119.5	100%	1.03	57%	0.573	S	S	*	*			trans	-95	0	177.4	-80.2	179.6	180	173.9	0	112.8	D137 E139	D137-K141 WeakPolarHBondContact O-CG 3.44Å; E139-K141 VanDerWaalsContact C-N 3.31Å; E139-K141 PolarHBondContact O-N 2.8Å

Retrieved 141 of 141 residues in 167.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).