A0A087WUX7_HUMAN Loading...

AFG2 interacting ribosome maturation factor

AlphaFold DB , UniProt , Accession A0A087WUX7, Species HUMAN (Homo sapiens, Human), Gene AIRIM, Length 37 aa.

						>A0A087WUX7_HUMAN|A0A087WUX7|AIRIM
MTQDRPLLAVQEALKKCFPVVEEQQGLWQSALRDCQP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.4	Low	70.3	Confident	233 Å²	233	127.2 Å²	127.2	100%	1.148	66%	0.663	S	S	*	*				0	53.8	0	-70.5	-80.3	-160	0	0	110.6
2	T	52.8	Low	71.3	Confident	131 Å²	131	123.3 Å²	123.3	80%	0.804	64%	0.639	S	S	*	*			trans	-157.4	27.9	-174.8	14.5	0	0	0	0	112.6
3	Q	55	Low	72.4	Confident	176 Å²	176	117.5 Å²	117.5	82%	0.822	62%	0.62	S	S	*	*	S	Bend	trans	-115.5	-9.9	177.1	-113.8	172.9	-8.8	0	0	113.6	P6	Q3-P6 WeakPolarHBondContact O-CD 3.33Å
4	D	61.3	Low	73.1	Confident	101 Å²	101	115.4 Å²	115.4	54%	0.54	61%	0.609	S	S	.	*	H	α-helix	trans	-86.5	-15.1	-178.3	-72.4	-77.3	0	0	0	114.8	L7 L8	D4-L7 PolarHBondContact O-N 3.16Å; D4-L8 WeakPolarHBondContact O-CB 3.4Å; D4-L8 PolarHBondContact O-N 3.19Å
5	R	66.9	Low	73.5	Confident	208 Å²	208	114.7 Å²	114.7	79%	0.785	60%	0.599	S	S	*	*	H	α-helix	trans	-60.2	-43.5	-178.1	-86.5	-175.3	-172.6	-172.3	1.6	114.5	L7 L8 A9	R5-L7 VanDerWaalsContact C-N 3.32Å; R5-L8 PolarHBondContact O-N 3.18Å; R5-A9 WeakPolarHBondContact O-CB 3.43Å; R5-A9 PolarHBondContact O-N 3.25Å
6	P	78.3	Confident	73.9	Confident	87 Å²	87	117.9 Å²	117.9	57%	0.565	61%	0.606	S	S	*	*	H	α-helix	trans	-64	-41.5	176.2	-17.9	30	0	0	0	111.4	Q3 A9 V10	Q3-P6 WeakPolarHBondContact O-CD 3.33Å; P6-A9 PolarHBondContact O-N 2.96Å; P6-V10 WeakPolarHBondContact O-CG2 3.45Å; P6-V10 PolarHBondContact O-N 3.2Å
7	L	79.6	Confident	74.4	Confident	114 Å²	114	116.2 Å²	116.2	60%	0.597	61%	0.606	S	S	*	*	H	α-helix	trans	-63.5	-45.7	179.3	-156.9	89.4	0	0	0	110.7	D4 R5 A9 V10 Q11	D4-L7 PolarHBondContact O-N 3.16Å; R5-L7 VanDerWaalsContact C-N 3.32Å; L7-A9 VanDerWaalsContact C-N 3.34Å; L7-A9 PolarHBondContact O-N 2.97Å; L7-V10 PolarHBondContact O-N 3.26Å; L7-Q11 WeakPolarHBondContact O-CB 3.22Å; L7-Q11 PolarHBondContact O-N 2.94Å
8	L	80.4	Confident	74.7	Confident	99 Å²	99	115.8 Å²	115.8	52%	0.518	60%	0.599	S	S	.	*	H	α-helix	trans	-60.2	-43.7	176.5	-130.5	96.5	0	0	0	111.5	D4 R5 V10 Q11 E12	D4-L8 WeakPolarHBondContact O-CB 3.4Å; D4-L8 PolarHBondContact O-N 3.19Å; R5-L8 PolarHBondContact O-N 3.18Å; L8-V10 VanDerWaalsContact C-N 3.34Å; L8-V10 PolarHBondContact O-N 2.87Å; L8-Q11 WeakPolarHBondContact O-CB 3.47Å; L8-Q11 PolarHBondContact O-N 3.32Å; L8-E12 WeakPolarHBondContact O-CG 3.43Å; L8-E12 PolarHBondContact O-N 3.26Å
9	A	83.6	Confident	74.6	Confident	62 Å²	62	113.6 Å²	113.6	51%	0.512	59%	0.593	S	S	.	*	H	α-helix	trans	-63.9	-40.7	179.3	0	0	0	0	0	111.9	R5 P6 L7 A13	R5-A9 WeakPolarHBondContact O-CB 3.43Å; R5-A9 PolarHBondContact O-N 3.25Å; P6-A9 PolarHBondContact O-N 2.96Å; L7-A9 VanDerWaalsContact C-N 3.34Å; L7-A9 PolarHBondContact O-N 2.97Å; A9-A13 WeakPolarHBondContact O-CB 3.46Å; A9-A13 PolarHBondContact O-N 2.88Å
10	V	85.1	Confident	74.6	Confident	86 Å²	86	111.6 Å²	111.6	52%	0.521	59%	0.585	S	S	.	*	H	α-helix	trans	-65.1	-42.7	173.8	172.6	0	0	0	0	110.4	P6 L7 L8 E12 A13 L14	P6-V10 WeakPolarHBondContact O-CG2 3.45Å; P6-V10 PolarHBondContact O-N 3.2Å; L7-V10 PolarHBondContact O-N 3.26Å; L8-V10 VanDerWaalsContact C-N 3.34Å; L8-V10 PolarHBondContact O-N 2.87Å; V10-E12 PolarHBondContact O-N 2.96Å; V10-A13 PolarHBondContact O-N 3.19Å; V10-L14 HydrophobicContact CG1-CD1 3.86Å; V10-L14 HydrophobicContact CG1-CG 4.28Å; V10-L14 WeakPolarHBondContact O-CB 3.46Å; V10-L14 VanDerWaalsContact O-CG 3.25Å; V10-L14 WeakPolarHBondContact O-CG 3.34Å; V10-L14 PolarHBondContact O-N 2.97Å
11	Q	80.1	Confident	74.6	Confident	102 Å²	102	108.9 Å²	108.9	48%	0.477	57%	0.573	S	S	.	*	H	α-helix	trans	-60.5	-44.8	177.9	-129.8	178.5	8.1	0	0	112	L7 L8 L14 K15	L7-Q11 WeakPolarHBondContact O-CB 3.22Å; L7-Q11 PolarHBondContact O-N 2.94Å; L8-Q11 WeakPolarHBondContact O-CB 3.47Å; L8-Q11 PolarHBondContact O-N 3.32Å; Q11-L14 PolarHBondContact O-N 3.45Å; Q11-K15 WeakPolarHBondContact O-CG 3.25Å; Q11-K15 PolarHBondContact O-N 2.9Å
12	E	82.6	Confident	75.6	Confident	81 Å²	81	104.1 Å²	104.1	38%	0.379	55%	0.548	S	S	.	.	H	α-helix	trans	-68.5	-35.5	177.7	-70.6	-59.6	123.1	0	0	112.4	L8 V10 K15 K16	L8-E12 WeakPolarHBondContact O-CG 3.43Å; L8-E12 PolarHBondContact O-N 3.26Å; V10-E12 PolarHBondContact O-N 2.96Å; E12-K15 IonicContact OE1-NZ 2.87Å; E12-K15 PolarHBondContact OE1-NZ 3.22Å; E12-K16 WeakPolarHBondContact O-CG 3.41Å; E12-K16 PolarHBondContact O-N 3.36Å; E12-K16 VanDerWaalsContact O-N 3.16Å
13	A	84.8	Confident	76.8	Confident	48 Å²	48	105.5 Å²	105.5	40%	0.397	55%	0.545	S	S	.	.	H	α-helix	trans	-64.6	-44.4	172.5	0	0	0	0	0	111.4	A9 V10 K16 C17	A9-A13 WeakPolarHBondContact O-CB 3.46Å; A9-A13 PolarHBondContact O-N 2.88Å; V10-A13 PolarHBondContact O-N 3.19Å; A13-K16 PolarHBondContact O-N 2.88Å; A13-C17 WeakPolarHBondContact O-CB 3.39Å; A13-C17 PolarHBondContact O-N 3.01Å; A13-C17 PolarHBondContact O-SG 3.27Å
14	L	82.2	Confident	77.9	Confident	88 Å²	88	100.5 Å²	100.5	46%	0.461	52%	0.522	S	S	.	.	H	α-helix	trans	-63.7	-44	177.9	-69.8	172	0	0	0	111.6	V10 Q11 K16 C17 F18	V10-L14 HydrophobicContact CG1-CD1 3.86Å; V10-L14 HydrophobicContact CG1-CG 4.28Å; V10-L14 WeakPolarHBondContact O-CB 3.46Å; V10-L14 VanDerWaalsContact O-CG 3.25Å; V10-L14 WeakPolarHBondContact O-CG 3.34Å; V10-L14 PolarHBondContact O-N 2.97Å; Q11-L14 PolarHBondContact O-N 3.45Å; L14-K16 VanDerWaalsContact C-N 3.28Å; L14-K16 PolarHBondContact O-N 3.45Å; L14-C17 PolarHBondContact O-N 3.32Å; L14-F18 HydrophobicContact CB-CD2 4.46Å; L14-F18 HydrophobicContact CD2-CD2 4.09Å; L14-F18 HydrophobicContact CD2-CE2 3.7Å; L14-F18 WeakPolarHBondContact O-CB 3.42Å; L14-F18 VanDerWaalsContact O-CD2 3.22Å; L14-F18 WeakPolarHBondContact O-CD2 3.47Å; L14-F18 PolarHBondContact O-N 3.48Å
15	K	78.9	Confident	78.7	Confident	105 Å²	105	101 Å²	101	46%	0.457	52%	0.521	S	S	.	.	H	α-helix	trans	-57.4	-41	174.7	-73.8	178.2	-170	166.1	0	112.5	Q11 E12	Q11-K15 WeakPolarHBondContact O-CG 3.25Å; Q11-K15 PolarHBondContact O-N 2.9Å; E12-K15 IonicContact OE1-NZ 2.87Å; E12-K15 PolarHBondContact OE1-NZ 3.22Å
16	K	80.3	Confident	79.3	Confident	165 Å²	165	93.3 Å²	93.3	72%	0.717	51%	0.507	S	S	*	.	H	α-helix	trans	-71.4	-33.7	177.9	-72.3	175.1	-176.4	177.9	0	113.7	E12 A13 L14 P19	E12-K16 WeakPolarHBondContact O-CG 3.41Å; E12-K16 PolarHBondContact O-N 3.36Å; E12-K16 VanDerWaalsContact O-N 3.16Å; A13-K16 PolarHBondContact O-N 2.88Å; L14-K16 VanDerWaalsContact C-N 3.28Å; L14-K16 PolarHBondContact O-N 3.45Å; K16-P19 WeakPolarHBondContact O-CD 3.39Å
17	C	82.6	Confident	79.5	Confident	89 Å²	89	94.5 Å²	94.5	60%	0.601	51%	0.507	S	S	*	.	H	α-helix	trans	-78.2	-24.8	179.7	-69.8	0	0	0	0	112.6	A13 L14 P19	A13-C17 WeakPolarHBondContact O-CB 3.39Å; A13-C17 PolarHBondContact O-N 3.01Å; A13-C17 PolarHBondContact O-SG 3.27Å; L14-C17 PolarHBondContact O-N 3.32Å; C17-P19 WeakPolarHBondContact O-CD 3.41Å
18	F	79.5	Confident	79.7	Confident	110 Å²	110	95.3 Å²	95.3	48%	0.482	50%	0.503	S	S	.	.			trans	-125.1	49.7	-172.7	-60.1	-71.1	0	0	0	113.4	L14 V20 V21	L14-F18 HydrophobicContact CB-CD2 4.46Å; L14-F18 HydrophobicContact CD2-CD2 4.09Å; L14-F18 HydrophobicContact CD2-CE2 3.7Å; L14-F18 WeakPolarHBondContact O-CB 3.42Å; L14-F18 VanDerWaalsContact O-CD2 3.22Å; L14-F18 WeakPolarHBondContact O-CD2 3.47Å; L14-F18 PolarHBondContact O-N 3.48Å; F18-V20 PolarHBondContact O-N 3.01Å; F18-V21 HydrophobicContact CB-CB 4.08Å; F18-V21 HydrophobicContact CB-CG2 3.73Å; F18-V21 HydrophobicContact CD1-CG2 4.34Å; F18-V21 HydrophobicContact CG-CG2 4.36Å; F18-V21 WeakPolarHBondContact O-CB 3.34Å; F18-V21 PolarHBondContact O-N 3.49Å
19	P	74.1	Confident	79.7	Confident	74 Å²	74	95.4 Å²	95.4	48%	0.481	50%	0.501	S	S	.	.	H	α-helix	trans	-62	-31.2	176	26.4	-33.2	0	0	0	111.4	K16 C17 V21 E22 E23	K16-P19 WeakPolarHBondContact O-CD 3.39Å; C17-P19 WeakPolarHBondContact O-CD 3.41Å; P19-V21 PolarHBondContact O-N 2.84Å; P19-E22 PolarHBondContact O-N 3.29Å; P19-E23 PolarHBondContact O-N 3.24Å
20	V	73.9	Confident	79.6	Confident	73 Å²	73	95 Å²	95	44%	0.442	49%	0.494	S	S	.	.	H	α-helix	trans	-61	-25.5	174.5	74.5	0	0	0	0	112.3	F18 Q24	F18-V20 PolarHBondContact O-N 3.01Å; V20-Q24 HydrophobicContact CG2-CG 3.91Å; V20-Q24 WeakPolarHBondContact O-CB 3.19Å; V20-Q24 WeakPolarHBondContact O-CG 3.31Å; V20-Q24 PolarHBondContact O-N 3.49Å
21	V	73.4	Confident	79.5	Confident	55 Å²	55	93.1 Å²	93.1	33%	0.333	49%	0.488	S	S	.	.	H	α-helix	trans	-73.5	-33.9	179.5	170.6	0	0	0	0	111.5	F18 P19 Q25 W28	F18-V21 HydrophobicContact CB-CB 4.08Å; F18-V21 HydrophobicContact CB-CG2 3.73Å; F18-V21 HydrophobicContact CD1-CG2 4.34Å; F18-V21 HydrophobicContact CG-CG2 4.36Å; F18-V21 WeakPolarHBondContact O-CB 3.34Å; F18-V21 PolarHBondContact O-N 3.49Å; P19-V21 PolarHBondContact O-N 2.84Å; V21-Q25 PolarHBondContact O-N 3.17Å; V21-Q25 VanDerWaalsContact O-N 3.17Å; V21-W28 HydrophobicContact CB-CH2 4.11Å; V21-W28 HydrophobicContact CG1-CH2 3.6Å; V21-W28 HydrophobicContact CG1-CZ3 3.58Å; V21-W28 HydrophobicContact CG2-CH2 3.88Å
22	E	72.9	Confident	79.6	Confident	133 Å²	133	94.7 Å²	94.7	62%	0.621	50%	0.498	S	S	*	.	H	α-helix	trans	-69.5	-44.2	171.6	-75.3	-175.3	164.7	0	0	111.2	P19 Q24 Q25	P19-E22 PolarHBondContact O-N 3.29Å; E22-Q24 VanDerWaalsContact C-N 3.3Å; E22-Q24 PolarHBondContact O-N 3.23Å; E22-Q25 VanDerWaalsContact O-CB 3.31Å; E22-Q25 WeakPolarHBondContact O-CB 2.95Å; E22-Q25 PolarHBondContact O-N 3.37Å
23	E	77.9	Confident	79.5	Confident	159 Å²	159	98.8 Å²	98.8	74%	0.743	51%	0.51	S	S	*	.	H	α-helix	trans	-61	-38.7	176	-78.5	-175.4	151.2	0	0	112.5	P19 Q25	P19-E23 PolarHBondContact O-N 3.24Å; E23-Q25 VanDerWaalsContact C-N 3.31Å; E23-Q25 PolarHBondContact O-N 2.92Å
24	Q	76.8	Confident	79.5	Confident	72 Å²	72	102.3 Å²	102.3	34%	0.336	52%	0.522	S	S	.	.	H	α-helix	trans	-82.5	-7.9	-177.8	-63.6	-75.5	9.6	0	0	113.1	V20 E22 G26 L27 W28	V20-Q24 HydrophobicContact CG2-CG 3.91Å; V20-Q24 WeakPolarHBondContact O-CB 3.19Å; V20-Q24 WeakPolarHBondContact O-CG 3.31Å; V20-Q24 PolarHBondContact O-N 3.49Å; E22-Q24 VanDerWaalsContact C-N 3.3Å; E22-Q24 PolarHBondContact O-N 3.23Å; Q24-G26 VanDerWaalsContact C-N 3.29Å; Q24-G26 PolarHBondContact O-N 3.09Å; Q24-L27 PolarHBondContact O-N 3.08Å; Q24-L27 VanDerWaalsContact O-N 3.08Å; Q24-W28 HydrophobicContact CB-CD2 4.37Å; Q24-W28 HydrophobicContact CB-CZ2 4.13Å; Q24-W28 PolarHBondContact O-N 2.88Å
25	Q	78.6	Confident	79.2	Confident	112 Å²	112	103 Å²	103	52%	0.523	53%	0.533	S	S	.	.	H	α-helix	trans	-58.8	-40.4	-176.2	-169.1	177.2	35.7	0	0	112.3	V21 E22 E23 W28 Q29	V21-Q25 PolarHBondContact O-N 3.17Å; V21-Q25 VanDerWaalsContact O-N 3.17Å; E22-Q25 VanDerWaalsContact O-CB 3.31Å; E22-Q25 WeakPolarHBondContact O-CB 2.95Å; E22-Q25 PolarHBondContact O-N 3.37Å; E23-Q25 VanDerWaalsContact C-N 3.31Å; E23-Q25 PolarHBondContact O-N 2.92Å; Q25-W28 PolarHBondContact O-N 3.04Å; Q25-Q29 WeakPolarHBondContact O-CG 3.34Å; Q25-Q29 PolarHBondContact O-N 3.43Å
26	G	80.4	Confident	78.7	Confident	46 Å²	46	105.7 Å²	105.7	47%	0.474	55%	0.548	S	S	.	.	H	α-helix	trans	-66.5	-38.9	176.7	0	0	0	0	0	112.9	Q24 Q29 S30	Q24-G26 VanDerWaalsContact C-N 3.29Å; Q24-G26 PolarHBondContact O-N 3.09Å; G26-Q29 PolarHBondContact O-N 3.28Å; G26-S30 PolarHBondContact O-N 2.87Å; G26-S30 VanDerWaalsContact O-N 3.09Å
27	L	82.1	Confident	78.2	Confident	111 Å²	111	107.3 Å²	107.3	58%	0.581	58%	0.575	S	S	*	*	H	α-helix	trans	-69.5	-38.5	178	-70.6	167.3	0	0	0	111.3	Q24 S30 A31	Q24-L27 PolarHBondContact O-N 3.08Å; Q24-L27 VanDerWaalsContact O-N 3.08Å; L27-S30 PolarHBondContact O-N 3.28Å; L27-A31 WeakPolarHBondContact O-CB 3.4Å; L27-A31 PolarHBondContact O-N 3.48Å
28	W	83.9	Confident	78	Confident	131 Å²	131	108.3 Å²	108.3	50%	0.496	57%	0.574	S	S	.	*	H	α-helix	trans	-65.9	-39.8	173.7	-65.5	-12.5	0	0	0	112.8	V21 Q24 Q25 S30 A31 L32	V21-W28 HydrophobicContact CB-CH2 4.11Å; V21-W28 HydrophobicContact CG1-CH2 3.6Å; V21-W28 HydrophobicContact CG1-CZ3 3.58Å; V21-W28 HydrophobicContact CG2-CH2 3.88Å; Q24-W28 HydrophobicContact CB-CD2 4.37Å; Q24-W28 HydrophobicContact CB-CZ2 4.13Å; Q24-W28 PolarHBondContact O-N 2.88Å; Q25-W28 PolarHBondContact O-N 3.04Å; W28-S30 VanDerWaalsContact C-N 3.28Å; W28-S30 PolarHBondContact O-N 3.44Å; W28-A31 PolarHBondContact O-N 3.23Å; W28-L32 VanDerWaalsContact O-CB 3.29Å; W28-L32 WeakPolarHBondContact O-CB 3.4Å; W28-L32 WeakPolarHBondContact O-CG 3.29Å; W28-L32 PolarHBondContact O-N 2.85Å
29	Q	79.6	Confident	78	Confident	102 Å²	102	108.2 Å²	108.2	48%	0.477	58%	0.579	S	S	.	*	H	α-helix	trans	-65.8	-30.9	174.4	-75	-179.6	8	0	0	112.8	Q25 G26 R33	Q25-Q29 WeakPolarHBondContact O-CG 3.34Å; Q25-Q29 PolarHBondContact O-N 3.43Å; G26-Q29 PolarHBondContact O-N 3.28Å; Q29-R33 WeakPolarHBondContact O-CG 3.39Å; Q29-R33 PolarHBondContact O-N 3.15Å; Q29-R33 PolarHBondContact O-NE 2.86Å
30	S	82.8	Confident	78.2	Confident	52 Å²	52	110.1 Å²	110.1	36%	0.364	58%	0.584	S	S	.	*	H	α-helix	trans	-69.4	-53.8	170.1	-165.1	0	0	0	0	110.3	G26 L27 W28 L32 R33 D34	G26-S30 PolarHBondContact O-N 2.87Å; G26-S30 VanDerWaalsContact O-N 3.09Å; L27-S30 PolarHBondContact O-N 3.28Å; W28-S30 VanDerWaalsContact C-N 3.28Å; W28-S30 PolarHBondContact O-N 3.44Å; S30-L32 VanDerWaalsContact C-N 3.28Å; S30-L32 PolarHBondContact O-N 2.88Å; S30-R33 CarbonylContact O-C 3.54Å; S30-R33 WeakPolarHBondContact O-CA 3.37Å; S30-R33 WeakPolarHBondContact O-CB 3.39Å; S30-R33 PolarHBondContact O-N 3Å; S30-D34 VanDerWaalsContact O-CG 3.25Å; S30-D34 PolarHBondContact O-N 3.38Å; S30-D34 VanDerWaalsContact O-OD2 3.08Å; S30-D34 PolarHBondContact OG-OD2 3.4Å
31	A	83.1	Confident	78.4	Confident	48 Å²	48	112.2 Å²	112.2	40%	0.397	59%	0.593	S	S	.	*	H	α-helix	trans	-57.3	-39.4	-178.7	0	0	0	0	0	112.8	L27 W28 R33 D34 C35	L27-A31 WeakPolarHBondContact O-CB 3.4Å; L27-A31 PolarHBondContact O-N 3.48Å; W28-A31 PolarHBondContact O-N 3.23Å; A31-R33 VanDerWaalsContact C-N 3.32Å; A31-R33 PolarHBondContact O-N 2.83Å; A31-D34 PolarHBondContact O-N 3.06Å; A31-C35 WeakPolarHBondContact O-CB 3.37Å; A31-C35 PolarHBondContact O-N 3.48Å; A31-C35 PolarHBondContact O-SG 3.35Å; A31-C35 VanDerWaalsContact O-SG 3.4Å
32	L	81.7	Confident	78.7	Confident	134 Å²	134	115.8 Å²	115.8	70%	0.702	61%	0.609	S	S	*	*	H	α-helix	trans	-65.9	-32.3	174.2	-80.3	166.6	0	0	0	113.1	W28 S30	W28-L32 VanDerWaalsContact O-CB 3.29Å; W28-L32 WeakPolarHBondContact O-CB 3.4Å; W28-L32 WeakPolarHBondContact O-CG 3.29Å; W28-L32 PolarHBondContact O-N 2.85Å; S30-L32 VanDerWaalsContact C-N 3.28Å; S30-L32 PolarHBondContact O-N 2.88Å
33	R	79.6	Confident	79.1	Confident	167 Å²	167	114.7 Å²	114.7	63%	0.63	61%	0.608	S	S	*	*	H	α-helix	trans	-76.1	-34.2	173.9	-80	-177.5	-78.3	-161.7	-1.6	112	Q29 S30 A31 Q36	Q29-R33 WeakPolarHBondContact O-CG 3.39Å; Q29-R33 PolarHBondContact O-N 3.15Å; Q29-R33 PolarHBondContact O-NE 2.86Å; S30-R33 CarbonylContact O-C 3.54Å; S30-R33 WeakPolarHBondContact O-CA 3.37Å; S30-R33 WeakPolarHBondContact O-CB 3.39Å; S30-R33 PolarHBondContact O-N 3Å; A31-R33 VanDerWaalsContact C-N 3.32Å; A31-R33 PolarHBondContact O-N 2.83Å; R33-Q36 WeakPolarHBondContact O-CG 3.39Å
34	D	85.7	Confident	79.2	Confident	122 Å²	122	111.5 Å²	111.5	65%	0.652	60%	0.598	S	S	*	*	H	α-helix	trans	-75.3	-31.9	179.3	-62.9	-36.8	0	0	0	111.5	S30 A31 Q36	S30-D34 VanDerWaalsContact O-CG 3.25Å; S30-D34 PolarHBondContact O-N 3.38Å; S30-D34 VanDerWaalsContact O-OD2 3.08Å; S30-D34 PolarHBondContact OG-OD2 3.4Å; A31-D34 PolarHBondContact O-N 3.06Å; D34-Q36 PolarHBondContact O-N 3.31Å
35	C	75.4	Confident	79.4	Confident	102 Å²	102	114.5 Å²	114.5	69%	0.689	62%	0.619	S	S	*	*			trans	-80.3	63.2	167.1	-66.9	0	0	0	0	110.9	A31	A31-C35 WeakPolarHBondContact O-CB 3.37Å; A31-C35 PolarHBondContact O-N 3.48Å; A31-C35 PolarHBondContact O-SG 3.35Å; A31-C35 VanDerWaalsContact O-SG 3.4Å
36	Q	69.1	Low	79.5	Confident	162 Å²	162	114.8 Å²	114.8	76%	0.757	63%	0.626	S	S	*	*			trans	-69.3	145	159.7	-68.8	-159.8	-17.1	0	0	109.6	R33 D34	R33-Q36 WeakPolarHBondContact O-CG 3.39Å; D34-Q36 PolarHBondContact O-N 3.31Å
37	P	70.1	Confident	79.4	Confident	200 Å²	200	121 Å²	121	100%	1.299	64%	0.64	S	S	*	*			trans	-58.7	0	178.2	25	-34	0	0	0	113.3

Retrieved 37 of 37 residues in 24.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).