A0A087WV46_HUMAN Loading...

Ragulator complex protein LAMTOR4

As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator plays a dual role for the small GTPases Rag (RagA/RRAGA, RagB/RRAGB, RagC/RRAGC and/or RagD/RRAGD): it (1) acts as a guanine nucleotide exchange factor (GEF), activating the small GTPases Rag and (2) mediates recruitment of Rag GTPases to the lysosome membrane. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated.

AlphaFold DB , UniProt , Accession A0A087WV46, Species HUMAN (Homo sapiens, Human), Gene LAMTOR4, Length 82 aa.

						>A0A087WV46_HUMAN|A0A087WV46|LAMTOR4
MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSGVSLLQWSLENTHCW
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.5	Very low	68.2	Low	229 Å²	229	101.5 Å²	101.5	100%	1.128	55%	0.545	S	S	*	.				0	47.4	0	-66.2	-175.1	-85.1	0	0	111.1
2	T	58.7	Low	69	Low	60 Å²	60	100.4 Å²	100.4	37%	0.368	54%	0.537	S	S	.	.			trans	-87.7	-20	176.2	31.9	0	0	0	0	112.6	A4 L5 T6 L27	T2-A4 PolarHBondContact O-N 3.01Å; T2-L5 WeakPolarHBondContact O-CB 3.37Å; T2-L5 PolarHBondContact O-N 3.13Å; T2-L5 VanDerWaalsContact O-N 3.13Å; T2-T6 PolarHBondContact O-N 3.45Å; T2-T6 VanDerWaalsContact O-N 3.12Å; T2-L27 HydrophobicContact CG2-CB 4.23Å; T2-L27 HydrophobicContact CG2-CD1 4.31Å
3	S	58.1	Low	68.4	Low	77 Å²	77	101.6 Å²	101.6	54%	0.538	55%	0.554	S	S	.	*	H	α-helix	trans	-62.7	-33.3	-172.7	-168	0	0	0	0	114.9	T6 Q7	S3-T6 WeakPolarHBondContact CA-OG1 3.29Å; S3-T6 PolarHBondContact O-OG1 3.31Å; S3-Q7 WeakPolarHBondContact O-CB 3.48Å; S3-Q7 WeakPolarHBondContact O-CG 3.44Å; S3-Q7 PolarHBondContact O-N 3.27Å
4	A	67.6	Low	68.6	Low	79 Å²	79	105.6 Å²	105.6	65%	0.653	57%	0.574	S	S	*	*	H	α-helix	trans	-71.5	-30.8	176.9	0	0	0	0	0	112.8	T2 G8	T2-A4 PolarHBondContact O-N 3.01Å; A4-G8 PolarHBondContact O-N 2.93Å
5	L	73.1	Confident	68.7	Low	116 Å²	116	102.3 Å²	102.3	61%	0.607	55%	0.554	S	S	*	*	H	α-helix	trans	-72.8	-43.7	175.2	-95.7	138.1	0	0	0	111	T2 G8 L9	T2-L5 WeakPolarHBondContact O-CB 3.37Å; T2-L5 PolarHBondContact O-N 3.13Å; T2-L5 VanDerWaalsContact O-N 3.13Å; L5-G8 PolarHBondContact O-N 3.23Å; L5-L9 PolarHBondContact O-N 3.05Å
6	T	73.8	Confident	69.1	Low	13 Å²	13	103.4 Å²	103.4	8%	0.08	56%	0.558	C	S	.	*	H	α-helix	trans	-66.7	-40	179.1	60	0	0	0	0	112	T2 S3 G8 L9 E10 Y18 A28	T2-T6 PolarHBondContact O-N 3.45Å; T2-T6 VanDerWaalsContact O-N 3.12Å; S3-T6 WeakPolarHBondContact CA-OG1 3.29Å; S3-T6 PolarHBondContact O-OG1 3.31Å; T6-G8 PolarHBondContact O-N 3.22Å; T6-L9 WeakPolarHBondContact O-CB 3.5Å; T6-L9 PolarHBondContact O-N 2.93Å; T6-L9 VanDerWaalsContact O-N 3.08Å; T6-E10 WeakPolarHBondContact O-CG 3.41Å; T6-E10 PolarHBondContact O-N 3.08Å; T6-Y18 WeakPolarHBondContact CB-OH 3.46Å; T6-Y18 HydrophobicContact CG2-CD2 4.44Å; T6-Y18 HydrophobicContact CG2-CE2 3.51Å; T6-A28 HydrophobicContact CG2-CB 3.59Å
7	Q	72.3	Confident	69.9	Low	119 Å²	119	98.6 Å²	98.6	56%	0.556	54%	0.538	S	S	*	.	H	α-helix	trans	-60.4	-30.5	173.3	-80.5	-176.5	-61.8	0	0	113.5	S3 R11	S3-Q7 WeakPolarHBondContact O-CB 3.48Å; S3-Q7 WeakPolarHBondContact O-CG 3.44Å; S3-Q7 PolarHBondContact O-N 3.27Å; Q7-R11 VanDerWaalsContact O-CG 3.29Å; Q7-R11 WeakPolarHBondContact O-CG 3.37Å
8	G	77	Confident	70.7	Confident	44 Å²	44	94.6 Å²	94.6	45%	0.454	51%	0.514	S	S	.	.	H	α-helix	trans	-71.2	-37.5	175.6	0	0	0	0	0	112.5	A4 L5 T6	A4-G8 PolarHBondContact O-N 2.93Å; L5-G8 PolarHBondContact O-N 3.23Å; T6-G8 PolarHBondContact O-N 3.22Å
9	L	77.6	Confident	71.4	Confident	52 Å²	52	91.5 Å²	91.5	27%	0.272	50%	0.497	S	S	.	.	H	α-helix	trans	-69.8	-47.1	176.6	-67.9	162.4	0	0	0	110.3	L5 T6 R11 I12 Q15 Y18 V20	L5-L9 PolarHBondContact O-N 3.05Å; T6-L9 WeakPolarHBondContact O-CB 3.5Å; T6-L9 PolarHBondContact O-N 2.93Å; T6-L9 VanDerWaalsContact O-N 3.08Å; L9-R11 PolarHBondContact O-N 3.15Å; L9-I12 HydrophobicContact CD2-CD1 4.17Å; L9-I12 WeakPolarHBondContact O-CB 3.31Å; L9-I12 WeakPolarHBondContact O-CG1 3.33Å; L9-I12 PolarHBondContact O-N 3.35Å; L9-Q15 VanDerWaalsContact C-NE2 3.34Å; L9-Q15 VanDerWaalsContact C-OE1 3.27Å; L9-Q15 PolarHBondContact O-NE2 2.98Å; L9-Q15 VanDerWaalsContact O-NE2 3.15Å; L9-Q15 PolarHBondContact O-OE1 2.74Å; L9-Y18 HydrophobicContact CB-CD1 4.29Å; L9-Y18 HydrophobicContact CB-CG 4.05Å; L9-Y18 HydrophobicContact CD1-CD2 3.96Å; L9-Y18 HydrophobicContact CD1-CG 4.15Å; L9-V20 HydrophobicContact CD1-CG2 3.81Å
10	E	68.8	Low	72.1	Confident	109 Å²	109	88.3 Å²	88.3	51%	0.509	48%	0.48	S	S	.	.	H	α-helix	trans	-58.6	-19.2	178.3	-68.9	177.6	102.9	0	0	114.5	T6 I12 Y18	T6-E10 WeakPolarHBondContact O-CG 3.41Å; T6-E10 PolarHBondContact O-N 3.08Å; E10-I12 VanDerWaalsContact C-N 3.32Å; E10-Y18 HydrophobicContact CG-CD1 4.17Å; E10-Y18 HydrophobicContact CG-CE1 3.48Å; E10-Y18 VanDerWaalsContact CG-CE1 3.48Å
11	R	74.8	Confident	72.6	Confident	219 Å²	219	86.6 Å²	86.6	83%	0.826	47%	0.47	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.7	-1.5	176.4	-71.1	177.4	79.4	173.8	6.4	113.9	Q7 L9 P13	Q7-R11 VanDerWaalsContact O-CG 3.29Å; Q7-R11 WeakPolarHBondContact O-CG 3.37Å; L9-R11 PolarHBondContact O-N 3.15Å; R11-P13 WeakPolarHBondContact O-CD 3.35Å
12	I	77.8	Confident	74.2	Confident	88 Å²	88	78.1 Å²	78.1	45%	0.451	43%	0.434	S	S	.	.	S	Bend	trans	-77.1	119.8	177.4	-61.3	174.8	0	0	0	108.6	L9 E10 Q15	L9-I12 HydrophobicContact CD2-CD1 4.17Å; L9-I12 WeakPolarHBondContact O-CB 3.31Å; L9-I12 WeakPolarHBondContact O-CG1 3.33Å; L9-I12 PolarHBondContact O-N 3.35Å; E10-I12 VanDerWaalsContact C-N 3.32Å; I12-Q15 HydrophobicContact CB-CB 4.17Å; I12-Q15 HydrophobicContact CG2-CB 4.41Å; I12-Q15 VanDerWaalsContact O-CB 3.31Å; I12-Q15 WeakPolarHBondContact O-CB 3.47Å; I12-Q15 PolarHBondContact O-N 3.12Å
13	P	61.4	Low	75.2	Confident	116 Å²	116	84.9 Å²	84.9	75%	0.753	46%	0.461	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65	141.7	175.9	27.5	-32.6	0	0	0	110	R11 Q15	R11-P13 WeakPolarHBondContact O-CD 3.35Å; P13-Q15 VanDerWaalsContact C-N 3.28Å; P13-Q15 PolarHBondContact O-N 3.47Å
14	D	70.7	Confident	75.8	Confident	157 Å²	157	83.4 Å²	83.4	84%	0.84	46%	0.458	S	S	*	.	T	Hydrogen-bonded Turn	trans	70.1	14.4	-175.8	-149.5	-119	0	0	0	115.3	L16	D14-L16 PolarHBondContact O-N 3.19Å
15	Q	70.4	Confident	76.2	Confident	57 Å²	57	82.3 Å²	82.3	27%	0.266	45%	0.449	S	S	.	.			trans	-73.9	110.9	175.5	-171.5	177.6	-83.3	0	0	111.4	L9 I12 P13 G17 Y18	L9-Q15 VanDerWaalsContact C-NE2 3.34Å; L9-Q15 VanDerWaalsContact C-OE1 3.27Å; L9-Q15 PolarHBondContact O-NE2 2.98Å; L9-Q15 VanDerWaalsContact O-NE2 3.15Å; L9-Q15 PolarHBondContact O-OE1 2.74Å; I12-Q15 HydrophobicContact CB-CB 4.17Å; I12-Q15 HydrophobicContact CG2-CB 4.41Å; I12-Q15 VanDerWaalsContact O-CB 3.31Å; I12-Q15 WeakPolarHBondContact O-CB 3.47Å; I12-Q15 PolarHBondContact O-N 3.12Å; P13-Q15 VanDerWaalsContact C-N 3.28Å; P13-Q15 PolarHBondContact O-N 3.47Å; Q15-G17 VanDerWaalsContact CG-O 3.25Å; Q15-G17 WeakPolarHBondContact CG-O 3.25Å; Q15-Y18 VanDerWaalsContact NE2-CD1 3.28Å
16	L	74.9	Confident	76.6	Confident	120 Å²	120	79.5 Å²	79.5	63%	0.628	44%	0.436	S	S	*	.			trans	-76.6	-23.1	174	-63.5	173.9	0	0	0	113.4	D14 G31 D32	D14-L16 PolarHBondContact O-N 3.19Å; L16-G31 WeakPolarHBondContact O-CA 3.49Å; L16-D32 PolarHBondContact O-N 2.74Å; L16-D32 VanDerWaalsContact O-N 3.16Å
17	G	83	Confident	77	Confident	21 Å²	21	83.2 Å²	83.2	22%	0.216	46%	0.455	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-179.2	167.1	179.1	0	0	0	0	0	112	Q15 S30	Q15-G17 VanDerWaalsContact CG-O 3.25Å; Q15-G17 WeakPolarHBondContact CG-O 3.25Å; G17-S30 CarbonylContact C-O 3.48Å; G17-S30 WeakPolarHBondContact CA-O 3.26Å
18	Y	83.4	Confident	77.4	Confident	27 Å²	27	78.3 Å²	78.3	11%	0.106	44%	0.435	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.7	153.5	173.1	66.4	-93.2	0	0	0	110.9	T6 L9 E10 Q15 V20 A28 S29 S30	T6-Y18 WeakPolarHBondContact CB-OH 3.46Å; T6-Y18 HydrophobicContact CG2-CD2 4.44Å; T6-Y18 HydrophobicContact CG2-CE2 3.51Å; L9-Y18 HydrophobicContact CB-CD1 4.29Å; L9-Y18 HydrophobicContact CB-CG 4.05Å; L9-Y18 HydrophobicContact CD1-CD2 3.96Å; L9-Y18 HydrophobicContact CD1-CG 4.15Å; E10-Y18 HydrophobicContact CG-CD1 4.17Å; E10-Y18 HydrophobicContact CG-CE1 3.48Å; E10-Y18 VanDerWaalsContact CG-CE1 3.48Å; Q15-Y18 VanDerWaalsContact NE2-CD1 3.28Å; Y18-V20 HydrophobicContact CD2-CG2 4.26Å; Y18-A28 HydrophobicContact CE2-CB 4.1Å; Y18-S29 CarbonylContact O-C 3.58Å; Y18-S29 VanDerWaalsContact O-CA 3.26Å; Y18-S29 WeakPolarHBondContact O-CA 3.03Å; Y18-S30 PolarHBondContact N-O 2.91Å; Y18-S30 PolarHBondContact O-N 2.97Å
19	L	85.1	Confident	77.5	Confident	35 Å²	35	77.8 Å²	77.8	18%	0.183	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.7	122	178.4	-170.7	117.1	0	0	0	108.7	L21 A28 L33 A40 I43	L19-L21 HydrophobicContact CD2-CD1 3.42Å; L19-L21 VanDerWaalsContact CD2-CD1 3.42Å; L19-L21 HydrophobicContact CD2-CD2 3.91Å; L19-L21 HydrophobicContact CD2-CG 3.47Å; L19-L21 VanDerWaalsContact CD2-CG 3.47Å; L19-L21 HydrophobicContact CG-CG 4.4Å; L19-A28 CarbonylContact C-O 3.5Å; L19-A28 WeakPolarHBondContact CA-O 3.37Å; L19-L33 HydrophobicContact CB-CB 4.45Å; L19-L33 HydrophobicContact CB-CD1 4.22Å; L19-L33 HydrophobicContact CD1-CB 4.37Å; L19-A40 HydrophobicContact CD1-CB 4.26Å; L19-A40 HydrophobicContact CD2-CB 4.1Å; L19-I43 HydrophobicContact CD2-CD1 4.26Å
20	V	84.8	Confident	77.7	Confident	27 Å²	27	76.9 Å²	76.9	16%	0.164	42%	0.422	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.4	117.8	177.9	-176.2	0	0	0	0	107.7	L9 Y18 L27 A28	L9-V20 HydrophobicContact CD1-CG2 3.81Å; Y18-V20 HydrophobicContact CD2-CG2 4.26Å; V20-L27 HydrophobicContact CB-CB 4.41Å; V20-L27 HydrophobicContact CG1-CB 4.11Å; V20-L27 HydrophobicContact CG1-CD1 4.37Å; V20-L27 PolarHBondContact O-N 2.84Å; V20-A28 HydrophobicContact CB-CB 4.1Å; V20-A28 HydrophobicContact CG2-CB 4.15Å; V20-A28 PolarHBondContact N-O 3.16Å; V20-A28 PolarHBondContact O-N 3.03Å
21	L	83	Confident	78.1	Confident	53 Å²	53	73.6 Å²	73.6	28%	0.277	42%	0.418	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.7	143.1	179.2	-68.2	161.2	0	0	0	110.6	L19 A25 V26 A40 I43	L19-L21 HydrophobicContact CD2-CD1 3.42Å; L19-L21 VanDerWaalsContact CD2-CD1 3.42Å; L19-L21 HydrophobicContact CD2-CD2 3.91Å; L19-L21 HydrophobicContact CD2-CG 3.47Å; L19-L21 VanDerWaalsContact CD2-CG 3.47Å; L19-L21 HydrophobicContact CG-CG 4.4Å; L21-A25 CarbonylContact C-O 3.55Å; L21-A25 WeakPolarHBondContact CA-O 3.4Å; L21-V26 HydrophobicContact CD2-CB 4.46Å; L21-V26 HydrophobicContact CD2-CG2 3.77Å; L21-A40 HydrophobicContact CD2-CB 3.68Å; L21-I43 HydrophobicContact CD1-CB 4.35Å; L21-I43 HydrophobicContact CD1-CG2 4.03Å
22	S	81.8	Confident	78	Confident	51 Å²	51	69.2 Å²	69.2	36%	0.357	41%	0.411	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.9	124.3	168.7	-176.3	0	0	0	0	109.9	G24 A25	S22-G24 PolarHBondContact O-N 3.32Å; S22-A25 PolarHBondContact N-O 2.78Å; S22-A25 PolarHBondContact O-N 3.37Å
23	E	79.6	Confident	77.6	Confident	203 Å²	203	67.8 Å²	67.8	95%	0.949	40%	0.404	S	S	*	.	T	Hydrogen-bonded Turn	trans	50.5	32.4	-179.9	-61.1	-171.7	94.1	0	0	114.1	A25	E23-A25 VanDerWaalsContact C-N 3.33Å
24	G	70.9	Confident	78.2	Confident	45 Å²	45	68.3 Å²	68.3	46%	0.464	40%	0.396	S	S	.	.	T	Hydrogen-bonded Turn	trans	84.7	-1.2	-178.5	0	0	0	0	0	115.2	S22	S22-G24 PolarHBondContact O-N 3.32Å
25	A	76.9	Confident	78.1	Confident	56 Å²	56	67 Å²	67	46%	0.463	39%	0.389	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.7	142.9	172.5	0	0	0	0	0	111.6	L21 S22 E23 L27	L21-A25 CarbonylContact C-O 3.55Å; L21-A25 WeakPolarHBondContact CA-O 3.4Å; S22-A25 PolarHBondContact N-O 2.78Å; S22-A25 PolarHBondContact O-N 3.37Å; E23-A25 VanDerWaalsContact C-N 3.33Å; A25-L27 PolarHBondContact O-N 3.44Å
26	V	80	Confident	78.4	Confident	58 Å²	58	67.8 Å²	67.8	35%	0.352	40%	0.395	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.2	116.9	173.4	-178.1	0	0	0	0	109	L21 A40	L21-V26 HydrophobicContact CD2-CB 4.46Å; L21-V26 HydrophobicContact CD2-CG2 3.77Å; V26-A40 HydrophobicContact CG2-CB 3.43Å; V26-A40 VanDerWaalsContact CG2-CB 3.43Å
27	L	82.2	Confident	78.6	Confident	90 Å²	90	69 Å²	69	47%	0.471	40%	0.398	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.8	-33.9	173.9	-69.5	-172.5	0	0	0	112.7	T2 V20 A25	T2-L27 HydrophobicContact CG2-CB 4.23Å; T2-L27 HydrophobicContact CG2-CD1 4.31Å; V20-L27 HydrophobicContact CB-CB 4.41Å; V20-L27 HydrophobicContact CG1-CB 4.11Å; V20-L27 HydrophobicContact CG1-CD1 4.37Å; V20-L27 PolarHBondContact O-N 2.84Å; A25-L27 PolarHBondContact O-N 3.44Å
28	A	80.8	Confident	78.6	Confident	17 Å²	17	75.8 Å²	75.8	14%	0.14	42%	0.424	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-157	141.2	175.5	0	0	0	0	0	109.2	T6 Y18 L19 V20	T6-A28 HydrophobicContact CG2-CB 3.59Å; Y18-A28 HydrophobicContact CE2-CB 4.1Å; L19-A28 CarbonylContact C-O 3.5Å; L19-A28 WeakPolarHBondContact CA-O 3.37Å; V20-A28 HydrophobicContact CB-CB 4.1Å; V20-A28 HydrophobicContact CG2-CB 4.15Å; V20-A28 PolarHBondContact N-O 3.16Å; V20-A28 PolarHBondContact O-N 3.03Å
29	S	80.4	Confident	78.5	Confident	33 Å²	33	75.7 Å²	75.7	23%	0.231	43%	0.429	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.1	153.9	171.6	56.1	0	0	0	0	109.5	Y18 L33 N35	Y18-S29 CarbonylContact O-C 3.58Å; Y18-S29 VanDerWaalsContact O-CA 3.26Å; Y18-S29 WeakPolarHBondContact O-CA 3.03Å; S29-L33 WeakPolarHBondContact CB-O 3.16Å; S29-N35 PolarHBondContact OG-N 3.42Å
30	S	80.2	Confident	78.4	Confident	32 Å²	32	74.2 Å²	74.2	22%	0.224	42%	0.421	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-162.9	156.4	-179.7	-167.9	0	0	0	0	111.4	G17 Y18	G17-S30 CarbonylContact C-O 3.48Å; G17-S30 WeakPolarHBondContact CA-O 3.26Å; Y18-S30 PolarHBondContact N-O 2.91Å; Y18-S30 PolarHBondContact O-N 2.97Å
31	G	78.6	Confident	78.5	Confident	40 Å²	40	75.8 Å²	75.8	41%	0.412	43%	0.434	S	S	.	.	E	Extended strand (participates in β ladder)	trans	76	-141.5	179	0	0	0	0	0	111.9	L16 L33 E34	L16-G31 WeakPolarHBondContact O-CA 3.49Å; G31-L33 PolarHBondContact O-N 3.14Å; G31-L33 VanDerWaalsContact O-N 3.14Å; G31-E34 WeakPolarHBondContact O-CB 3.34Å; G31-E34 PolarHBondContact O-N 2.88Å
32	D	72	Confident	78.6	Confident	128 Å²	128	75.7 Å²	75.7	68%	0.684	44%	0.441	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.1	-15.3	179.2	-160.8	-113.4	0	0	0	113.5	L16	L16-D32 PolarHBondContact O-N 2.74Å; L16-D32 VanDerWaalsContact O-N 3.16Å
33	L	70.3	Confident	78.8	Confident	57 Å²	57	76.6 Å²	76.6	30%	0.298	44%	0.44	S	S	.	.	T	Hydrogen-bonded Turn	trans	-98.8	7.1	176.7	-62.9	172.4	0	0	0	112.8	L19 S29 G31 N35 A39	L19-L33 HydrophobicContact CB-CB 4.45Å; L19-L33 HydrophobicContact CB-CD1 4.22Å; L19-L33 HydrophobicContact CD1-CB 4.37Å; S29-L33 WeakPolarHBondContact CB-O 3.16Å; G31-L33 PolarHBondContact O-N 3.14Å; G31-L33 VanDerWaalsContact O-N 3.14Å; L33-N35 PolarHBondContact O-N 3.14Å; L33-A39 HydrophobicContact CD2-CB 4.35Å
34	E	73.1	Confident	79	Confident	127 Å²	127	68.9 Å²	68.9	59%	0.593	41%	0.409	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.6	127.7	177.7	-170.9	174.1	102.9	0	0	110.3	G31 D36	G31-E34 WeakPolarHBondContact O-CB 3.34Å; G31-E34 PolarHBondContact O-N 2.88Å; E34-D36 PolarHBondContact O-N 3.06Å; E34-D36 VanDerWaalsContact O-N 3.14Å
35	N	68.2	Low	79.8	Confident	130 Å²	130	72.6 Å²	72.6	70%	0.695	41%	0.414	S	S	*	.	T	Hydrogen-bonded Turn	trans	61.3	14.8	179.6	-162.1	56.1	0	0	0	116.3	S29 L33 E37	S29-N35 PolarHBondContact OG-N 3.42Å; L33-N35 PolarHBondContact O-N 3.14Å; N35-E37 PolarHBondContact O-N 3.1Å; N35-E37 VanDerWaalsContact O-N 3.1Å
36	D	76.6	Confident	80.2	Confident	73 Å²	73	74.9 Å²	74.9	39%	0.39	42%	0.418	S	S	.	.			trans	-88.8	75.3	-179.8	-134.5	-70.5	0	0	0	111.6	E34 Q38 A39 A40	E34-D36 PolarHBondContact O-N 3.06Å; E34-D36 VanDerWaalsContact O-N 3.14Å; D36-Q38 PolarHBondContact O-N 3.5Å; D36-A39 HydrophobicContact CB-CB 4.03Å; D36-A39 PolarHBondContact O-N 3.41Å; D36-A39 PolarHBondContact OD1-N 3.08Å; D36-A40 PolarHBondContact O-N 3.27Å; D36-A40 VanDerWaalsContact O-N 3.08Å
37	E	80.8	Confident	80.3	Confident	147 Å²	147	75 Å²	75	69%	0.687	42%	0.419	S	S	*	.	H	α-helix	trans	-59.9	-31	179.3	-62.9	-176.3	98.1	0	0	112.2	N35 A40 S41	N35-E37 PolarHBondContact O-N 3.1Å; N35-E37 VanDerWaalsContact O-N 3.1Å; E37-A40 WeakPolarHBondContact O-CB 3.41Å; E37-A40 PolarHBondContact O-N 3.21Å; E37-S41 PolarHBondContact O-N 3.18Å
38	Q	82.6	Confident	80.3	Confident	163 Å²	163	74.6 Å²	74.6	76%	0.762	42%	0.424	S	S	*	.	H	α-helix	trans	-65.1	-47.2	176.8	-70.3	-101.2	101.8	0	0	111	D36 A40 S41 A42	D36-Q38 PolarHBondContact O-N 3.5Å; Q38-A40 VanDerWaalsContact C-N 3.34Å; Q38-A40 PolarHBondContact O-N 3.45Å; Q38-S41 PolarHBondContact O-N 3.08Å; Q38-A42 WeakPolarHBondContact O-CB 3.36Å; Q38-A42 PolarHBondContact O-N 3.2Å
39	A	80.8	Confident	80.5	Confident	25 Å²	25	77.9 Å²	77.9	21%	0.207	44%	0.442	C	S	.	.	H	α-helix	trans	-62.1	-42.4	174.9	0	0	0	0	0	111.6	L33 D36 S41 A42 I43	L33-A39 HydrophobicContact CD2-CB 4.35Å; D36-A39 HydrophobicContact CB-CB 4.03Å; D36-A39 PolarHBondContact O-N 3.41Å; D36-A39 PolarHBondContact OD1-N 3.08Å; A39-S41 PolarHBondContact O-N 3.41Å; A39-A42 PolarHBondContact O-N 2.83Å; A39-I43 WeakPolarHBondContact O-CB 3.43Å; A39-I43 WeakPolarHBondContact O-CG1 3.47Å; A39-I43 PolarHBondContact O-N 3.42Å
40	A	83.9	Confident	80.5	Confident	3 Å²	3	77.6 Å²	77.6	3%	0.025	44%	0.442	C	S	.	.	H	α-helix	trans	-56.4	-47.7	174.4	0	0	0	0	0	112.7	L19 L21 V26 D36 E37 Q38 S44	L19-A40 HydrophobicContact CD1-CB 4.26Å; L19-A40 HydrophobicContact CD2-CB 4.1Å; L21-A40 HydrophobicContact CD2-CB 3.68Å; V26-A40 HydrophobicContact CG2-CB 3.43Å; V26-A40 VanDerWaalsContact CG2-CB 3.43Å; D36-A40 PolarHBondContact O-N 3.27Å; D36-A40 VanDerWaalsContact O-N 3.08Å; E37-A40 WeakPolarHBondContact O-CB 3.41Å; E37-A40 PolarHBondContact O-N 3.21Å; Q38-A40 VanDerWaalsContact C-N 3.34Å; Q38-A40 PolarHBondContact O-N 3.45Å; A40-S44 WeakPolarHBondContact O-CB 3.17Å; A40-S44 PolarHBondContact O-N 3.19Å
41	S	85	Confident	80.2	Confident	61 Å²	61	78.4 Å²	78.4	43%	0.427	45%	0.447	S	S	.	.	H	α-helix	trans	-63.7	-48.8	177.6	-168.5	0	0	0	0	111.3	E37 Q38 A39 I43 S44 E45	E37-S41 PolarHBondContact O-N 3.18Å; Q38-S41 PolarHBondContact O-N 3.08Å; A39-S41 PolarHBondContact O-N 3.41Å; S41-I43 VanDerWaalsContact C-N 3.33Å; S41-I43 PolarHBondContact O-N 3.35Å; S41-S44 WeakPolarHBondContact O-CB 3.46Å; S41-S44 PolarHBondContact O-N 2.91Å; S41-S44 VanDerWaalsContact O-N 3.15Å; S41-E45 PolarHBondContact O-N 2.85Å
42	A	85.8	Confident	79.8	Confident	51 Å²	51	79.5 Å²	79.5	42%	0.421	46%	0.458	S	S	.	.	H	α-helix	trans	-60.2	-41.3	179.8	0	0	0	0	0	112.2	Q38 A39 L46	Q38-A42 WeakPolarHBondContact O-CB 3.36Å; Q38-A42 PolarHBondContact O-N 3.2Å; A39-A42 PolarHBondContact O-N 2.83Å; A42-L46 VanDerWaalsContact O-CB 3.3Å; A42-L46 WeakPolarHBondContact O-CB 3.39Å; A42-L46 PolarHBondContact O-N 3.15Å
43	I	85.5	Confident	79.6	Confident	69 Å²	69	80 Å²	80	35%	0.354	46%	0.455	S	S	.	.	H	α-helix	trans	-65.3	-45.2	175.3	-68.8	167.2	0	0	0	110.5	L19 L21 A39 S41 E45 L46 V47	L19-I43 HydrophobicContact CD2-CD1 4.26Å; L21-I43 HydrophobicContact CD1-CB 4.35Å; L21-I43 HydrophobicContact CD1-CG2 4.03Å; A39-I43 WeakPolarHBondContact O-CB 3.43Å; A39-I43 WeakPolarHBondContact O-CG1 3.47Å; A39-I43 PolarHBondContact O-N 3.42Å; S41-I43 VanDerWaalsContact C-N 3.33Å; S41-I43 PolarHBondContact O-N 3.35Å; I43-E45 PolarHBondContact O-N 2.85Å; I43-L46 WeakPolarHBondContact O-CB 3.31Å; I43-L46 PolarHBondContact O-N 3.25Å; I43-V47 HydrophobicContact CG2-CG2 4.27Å; I43-V47 WeakPolarHBondContact O-CB 3.48Å; I43-V47 VanDerWaalsContact O-CG2 3.31Å; I43-V47 WeakPolarHBondContact O-CG2 3.34Å; I43-V47 PolarHBondContact O-N 3.49Å
44	S	84.6	Confident	79.2	Confident	41 Å²	41	83.5 Å²	83.5	29%	0.287	46%	0.464	S	S	.	.	H	α-helix	trans	-60.7	-45	178.5	-167.4	0	0	0	0	111.6	A40 S41 V47 S48	A40-S44 WeakPolarHBondContact O-CB 3.17Å; A40-S44 PolarHBondContact O-N 3.19Å; S41-S44 WeakPolarHBondContact O-CB 3.46Å; S41-S44 PolarHBondContact O-N 2.91Å; S41-S44 VanDerWaalsContact O-N 3.15Å; S44-V47 PolarHBondContact O-N 3.09Å; S44-S48 WeakPolarHBondContact O-CB 3.19Å; S44-S48 PolarHBondContact O-N 3.16Å
45	E	87	Confident	78.4	Confident	124 Å²	124	84.2 Å²	84.2	58%	0.579	47%	0.471	S	S	*	.	H	α-helix	trans	-63.8	-41.7	174.4	-74.5	-170.3	88.5	0	0	112.1	S41 I43 S48 T49	S41-E45 PolarHBondContact O-N 2.85Å; I43-E45 PolarHBondContact O-N 2.85Å; E45-S48 PolarHBondContact O-N 3.36Å; E45-T49 WeakPolarHBondContact O-CB 3.42Å; E45-T49 PolarHBondContact O-N 2.89Å; E45-T49 PolarHBondContact O-OG1 2.94Å
46	L	85.8	Confident	77.6	Confident	104 Å²	104	85.9 Å²	85.9	55%	0.545	47%	0.474	S	S	.	.	H	α-helix	trans	-60.3	-48.4	175	-106.4	162.7	0	0	0	111.8	A42 I43 T49 A50	A42-L46 VanDerWaalsContact O-CB 3.3Å; A42-L46 WeakPolarHBondContact O-CB 3.39Å; A42-L46 PolarHBondContact O-N 3.15Å; I43-L46 WeakPolarHBondContact O-CB 3.31Å; I43-L46 PolarHBondContact O-N 3.25Å; L46-T49 PolarHBondContact O-N 3.37Å; L46-A50 VanDerWaalsContact O-CB 3.23Å; L46-A50 WeakPolarHBondContact O-CB 3.24Å; L46-A50 PolarHBondContact O-N 3.46Å
47	V	82.7	Confident	76.6	Confident	60 Å²	60	94.8 Å²	94.8	36%	0.364	50%	0.502	S	S	.	.	H	α-helix	trans	-66.4	-42.4	179.3	172.1	0	0	0	0	110.6	I43 S44 A50 C51	I43-V47 HydrophobicContact CG2-CG2 4.27Å; I43-V47 WeakPolarHBondContact O-CB 3.48Å; I43-V47 VanDerWaalsContact O-CG2 3.31Å; I43-V47 WeakPolarHBondContact O-CG2 3.34Å; I43-V47 PolarHBondContact O-N 3.49Å; S44-V47 PolarHBondContact O-N 3.09Å; V47-A50 PolarHBondContact O-N 2.95Å; V47-C51 WeakPolarHBondContact O-CB 3.43Å; V47-C51 PolarHBondContact O-N 2.92Å
48	S	82.2	Confident	75.4	Confident	82 Å²	82	89.5 Å²	89.5	57%	0.573	49%	0.487	S	S	*	.	H	α-helix	trans	-61	-45.8	175.9	-175	0	0	0	0	111.1	S44 E45 C51 G52	S44-S48 WeakPolarHBondContact O-CB 3.19Å; S44-S48 PolarHBondContact O-N 3.16Å; E45-S48 PolarHBondContact O-N 3.36Å; S48-C51 PolarHBondContact O-N 2.97Å; S48-G52 PolarHBondContact O-N 2.75Å
49	T	84.5	Confident	74.2	Confident	85 Å²	85	90.9 Å²	90.9	52%	0.521	50%	0.496	S	S	.	.	H	α-helix	trans	-64.5	-47	176.7	-59.3	0	0	0	0	111.1	E45 L46 C51 G52 F53	E45-T49 WeakPolarHBondContact O-CB 3.42Å; E45-T49 PolarHBondContact O-N 2.89Å; E45-T49 PolarHBondContact O-OG1 2.94Å; L46-T49 PolarHBondContact O-N 3.37Å; T49-C51 VanDerWaalsContact C-N 3.35Å; T49-C51 PolarHBondContact O-N 2.84Å; T49-G52 CarbonylContact O-C 3.57Å; T49-G52 PolarHBondContact O-N 3.28Å; T49-F53 WeakPolarHBondContact O-CB 3.23Å; T49-F53 PolarHBondContact O-N 2.78Å
50	A	80.1	Confident	73.2	Confident	27 Å²	27	96.2 Å²	96.2	22%	0.223	52%	0.521	C	S	.	.	H	α-helix	trans	-62.4	-41.4	178	0	0	0	0	0	111.7	L46 V47 F53 F63 L66	L46-A50 VanDerWaalsContact O-CB 3.23Å; L46-A50 WeakPolarHBondContact O-CB 3.24Å; L46-A50 PolarHBondContact O-N 3.46Å; V47-A50 PolarHBondContact O-N 2.95Å; A50-F53 PolarHBondContact O-N 3.33Å; A50-F63 VanDerWaalsContact C-CE1 3.47Å; A50-F63 HydrophobicContact CB-CE1 3.72Å; A50-F63 HydrophobicContact CB-CZ 3.75Å; A50-F63 WeakPolarHBondContact O-CE1 3.14Å; A50-L66 HydrophobicContact CB-CD1 3.84Å
51	C	73.3	Confident	72.3	Confident	49 Å²	49	100.6 Å²	100.6	33%	0.331	55%	0.547	S	S	.	.	H	α-helix	trans	-69.7	-37.4	177.2	-171.7	0	0	0	0	111.6	V47 S48 T49 F53 R54 F63	V47-C51 WeakPolarHBondContact O-CB 3.43Å; V47-C51 PolarHBondContact O-N 2.92Å; S48-C51 PolarHBondContact O-N 2.97Å; T49-C51 VanDerWaalsContact C-N 3.35Å; T49-C51 PolarHBondContact O-N 2.84Å; C51-F53 VanDerWaalsContact C-N 3.31Å; C51-R54 VanDerWaalsContact O-CG 3.24Å; C51-R54 WeakPolarHBondContact O-CG 3.44Å; C51-F63 HydrophobicContact CB-CZ 3.94Å
52	G	71.1	Confident	71.3	Confident	63 Å²	63	101.2 Å²	101.2	65%	0.649	55%	0.55	S	S	*	.	H	α-helix	trans	-68	-28.9	173.6	0	0	0	0	0	113	S48 T49 R54	S48-G52 PolarHBondContact O-N 2.75Å; T49-G52 CarbonylContact O-C 3.57Å; T49-G52 PolarHBondContact O-N 3.28Å; G52-R54 PolarHBondContact O-N 3.45Å
53	F	67.5	Low	70.6	Confident	140 Å²	140	101.5 Å²	101.5	61%	0.614	54%	0.542	S	S	*	.			trans	-71.8	50.2	170.2	-119	-92.4	0	0	0	111.5	T49 A50 C51 L55	T49-F53 WeakPolarHBondContact O-CB 3.23Å; T49-F53 PolarHBondContact O-N 2.78Å; A50-F53 PolarHBondContact O-N 3.33Å; C51-F53 VanDerWaalsContact C-N 3.31Å; F53-L55 HydrophobicContact CD1-CD1 4Å; F53-L55 HydrophobicContact CD1-CG 4.07Å; F53-L55 HydrophobicContact CE1-CD1 4.32Å; F53-L55 HydrophobicContact CE1-CG 4.45Å; F53-L55 PolarHBondContact O-N 3.42Å
54	R	61.5	Low	70.2	Confident	129 Å²	129	108.8 Å²	108.8	49%	0.487	57%	0.571	S	S	.	*			trans	-70	78.8	167.1	-67.4	-150.8	-140.9	-167	6.5	109.5	C51 G52 H56 G58	C51-R54 VanDerWaalsContact O-CG 3.24Å; C51-R54 WeakPolarHBondContact O-CG 3.44Å; G52-R54 PolarHBondContact O-N 3.45Å; R54-H56 PolarHBondContact O-N 2.81Å; R54-G58 PolarHBondContact NH1-O 3.13Å
55	L	56.4	Low	70	Confident	143 Å²	143	117.4 Å²	117.4	75%	0.749	60%	0.597	S	S	*	*	S	Bend	trans	-57.4	-23.5	165.9	-85.7	160	0	0	0	111.7	F53	F53-L55 HydrophobicContact CD1-CD1 4Å; F53-L55 HydrophobicContact CD1-CG 4.07Å; F53-L55 HydrophobicContact CE1-CD1 4.32Å; F53-L55 HydrophobicContact CE1-CG 4.45Å; F53-L55 PolarHBondContact O-N 3.42Å
56	H	52.3	Low	69.7	Low	165 Å²	165	115.5 Å²	115.5	76%	0.764	59%	0.59	S	S	*	*	S	Bend	trans	-113.9	115.3	171.3	-69.8	82.9	0	0	0	109.8	R54 G58	R54-H56 PolarHBondContact O-N 2.81Å; H56-G58 PolarHBondContact O-N 3.35Å
57	R	55	Low	69.5	Low	260 Å²	260	115.4 Å²	115.4	98%	0.981	60%	0.598	S	S	*	*			trans	-68.1	48.9	179.5	-157.5	-180	-168.1	-179.4	3.4	112.1
58	G	55.6	Low	69.3	Low	36 Å²	36	116.1 Å²	116.1	37%	0.371	62%	0.618	S	S	.	*	S	Bend	trans	-115.5	145.5	-178.4	0	0	0	0	0	111.2	R54 H56 N60	R54-G58 PolarHBondContact NH1-O 3.13Å; H56-G58 PolarHBondContact O-N 3.35Å; G58-N60 PolarHBondContact O-N 3.41Å
59	M	58	Low	68.9	Low	192 Å²	192	118.4 Å²	118.4	95%	0.946	63%	0.628	S	S	*	*	S	Bend	trans	-66.6	5.2	-177.1	-70.6	160.7	59.7	0	0	114.8
60	N	60.4	Low	68.1	Low	137 Å²	137	117.6 Å²	117.6	73%	0.733	63%	0.626	S	S	*	*	S	Bend	trans	-102	145.3	-176.2	-148.4	-101.6	0	0	0	111.6	G58	G58-N60 PolarHBondContact O-N 3.41Å
61	V	63.5	Low	67.3	Low	94 Å²	94	122.9 Å²	122.9	57%	0.57	65%	0.65	S	S	*	*			trans	-64.4	123.8	176.1	-177.5	0	0	0	0	108.1	F63	V61-F63 WeakPolarHBondContact CG1-O 3.22Å; V61-F63 PolarHBondContact O-N 2.93Å
62	P	65.6	Low	66.7	Low	74 Å²	74	127.1 Å²	127.1	48%	0.481	67%	0.668	S	S	.	*	S	Bend	trans	-68.9	-16.3	-170.9	20.2	-26.7	0	0	0	114.1
63	F	70.9	Confident	66.4	Low	58 Å²	58	128.7 Å²	128.7	25%	0.254	66%	0.659	S	S	.	*			trans	-140.4	141.5	-178	42	-93.9	0	0	0	112.5	A50 C51 V61	A50-F63 VanDerWaalsContact C-CE1 3.47Å; A50-F63 HydrophobicContact CB-CE1 3.72Å; A50-F63 HydrophobicContact CB-CZ 3.75Å; A50-F63 WeakPolarHBondContact O-CE1 3.14Å; C51-F63 HydrophobicContact CB-CZ 3.94Å; V61-F63 WeakPolarHBondContact CG1-O 3.22Å; V61-F63 PolarHBondContact O-N 2.93Å
64	K	76.8	Confident	66.2	Low	221 Å²	221	129.8 Å²	129.8	96%	0.961	66%	0.659	S	S	*	*	S	Bend	trans	-91.7	-22.7	172.4	-66.5	-177.2	178	179.2	0	113
65	R	80.8	Confident	66.4	Low	222 Å²	222	126.5 Å²	126.5	84%	0.838	66%	0.656	S	S	*	*			trans	-151.2	137.6	179.1	-178.5	179	-83.3	-155.2	-5	108.9
66	L	80.8	Confident	66.8	Low	84 Å²	84	124.5 Å²	124.5	44%	0.44	65%	0.645	S	S	.	*			trans	-118.5	125.4	171.3	-175.8	146.5	0	0	0	107.4	A50	A50-L66 HydrophobicContact CB-CD1 3.84Å
67	S	80.6	Confident	67.2	Low	102 Å²	102	123 Å²	123	71%	0.713	64%	0.639	S	S	*	*			trans	-117.6	120.8	179	53.2	0	0	0	0	109.3
68	G	79.6	Confident	67.6	Low	75 Å²	75	114.8 Å²	114.8	77%	0.773	61%	0.614	S	S	*	*			trans	-100.1	119.8	171	0	0	0	0	0	109.8
69	V	73.6	Confident	67.7	Low	130 Å²	130	117.2 Å²	117.2	79%	0.788	62%	0.622	S	S	*	*			trans	-97.9	116	169.1	-77.6	0	0	0	0	108.2	L71	V69-L71 PolarHBondContact O-N 3.35Å; V69-L71 VanDerWaalsContact O-N 3.13Å
70	S	67.5	Low	67.6	Low	69 Å²	69	115.5 Å²	115.5	48%	0.483	61%	0.611	S	S	.	*			trans	-73.9	104.1	173.9	-174.1	0	0	0	0	108.6	L72 Q73 W74	S70-L72 PolarHBondContact O-N 2.89Å; S70-Q73 PolarHBondContact O-N 3.07Å; S70-Q73 VanDerWaalsContact O-N 3.14Å; S70-W74 PolarHBondContact O-N 3.29Å
71	L	63.6	Low	67.2	Low	138 Å²	138	113.9 Å²	113.9	72%	0.723	61%	0.61	S	S	*	*	H	α-helix	trans	-59.2	-31.4	-178.5	-156.4	86.3	0	0	0	111.8	V69 S75	V69-L71 PolarHBondContact O-N 3.35Å; V69-L71 VanDerWaalsContact O-N 3.13Å; L71-S75 VanDerWaalsContact O-CB 3.22Å; L71-S75 WeakPolarHBondContact O-CB 3.22Å; L71-S75 PolarHBondContact O-N 2.81Å
72	L	60	Low	66.3	Low	137 Å²	137	123.8 Å²	123.8	72%	0.717	64%	0.637	S	S	*	*	H	α-helix	trans	-66.9	-45.1	175.9	-94.2	145.3	0	0	0	112.2	S70 S75 L76	S70-L72 PolarHBondContact O-N 2.89Å; L72-S75 PolarHBondContact O-N 2.75Å; L72-L76 WeakPolarHBondContact O-CG 3.3Å; L72-L76 PolarHBondContact O-N 3.42Å
73	Q	63.9	Low	66.4	Low	97 Å²	97	126.3 Å²	126.3	45%	0.453	64%	0.644	S	S	.	*	H	α-helix	trans	-69.9	-42.4	177.9	-171.9	163.6	-25.6	0	0	111.3	S70 S75 L76 E77	S70-Q73 PolarHBondContact O-N 3.07Å; S70-Q73 VanDerWaalsContact O-N 3.14Å; Q73-S75 VanDerWaalsContact C-N 3.27Å; Q73-S75 PolarHBondContact O-N 3.44Å; Q73-L76 PolarHBondContact O-N 2.81Å; Q73-E77 WeakPolarHBondContact O-CB 3.26Å; Q73-E77 PolarHBondContact O-N 3.41Å
74	W	64.7	Low	66.1	Low	163 Å²	163	129.8 Å²	129.8	62%	0.617	67%	0.665	S	S	*	*	H	α-helix	trans	-59.6	-39.4	174.3	-174.3	85	0	0	0	112.2	S70 N78	S70-W74 PolarHBondContact O-N 3.29Å; W74-N78 VanDerWaalsContact CE2-ND2 3.3Å; W74-N78 WeakPolarHBondContact O-CB 3.38Å; W74-N78 PolarHBondContact O-N 3.14Å; W74-N78 VanDerWaalsContact O-N 3.08Å; W74-N78 PolarHBondContact O-ND2 2.57Å
75	S	65.2	Low	65.5	Low	59 Å²	59	124.8 Å²	124.8	41%	0.413	65%	0.649	S	S	.	*	H	α-helix	trans	-66.4	-45.6	174.9	-171.1	0	0	0	0	111.4	L71 L72 Q73 N78 T79	L71-S75 VanDerWaalsContact O-CB 3.22Å; L71-S75 WeakPolarHBondContact O-CB 3.22Å; L71-S75 PolarHBondContact O-N 2.81Å; L72-S75 PolarHBondContact O-N 2.75Å; Q73-S75 VanDerWaalsContact C-N 3.27Å; Q73-S75 PolarHBondContact O-N 3.44Å; S75-N78 PolarHBondContact O-N 3.22Å; S75-T79 VanDerWaalsContact O-CB 3.26Å; S75-T79 WeakPolarHBondContact O-CB 3.44Å; S75-T79 PolarHBondContact O-N 3.19Å; S75-T79 PolarHBondContact O-OG1 2.8Å
76	L	64.3	Low	64.6	Low	101 Å²	101	119.1 Å²	119.1	53%	0.529	64%	0.637	S	S	.	*	H	α-helix	trans	-59.6	-48.8	177.4	-79.3	161.3	0	0	0	111.1	L72 Q73 N78 T79 H80	L72-L76 WeakPolarHBondContact O-CG 3.3Å; L72-L76 PolarHBondContact O-N 3.42Å; Q73-L76 PolarHBondContact O-N 2.81Å; L76-N78 VanDerWaalsContact C-N 3.32Å; L76-N78 PolarHBondContact O-N 2.94Å; L76-T79 PolarHBondContact O-N 2.8Å; L76-T79 VanDerWaalsContact O-N 3.07Å; L76-H80 PolarHBondContact O-CD2 2.95Å; L76-H80 PolarHBondContact O-N 2.9Å; L76-H80 VanDerWaalsContact O-N 3.16Å
77	E	61.8	Low	63.6	Low	134 Å²	134	121.3 Å²	121.3	63%	0.626	65%	0.65	S	S	*	*	H	α-helix	trans	-64.4	-33.4	-178.2	-143.6	159.2	79.3	0	0	112.7	Q73	Q73-E77 WeakPolarHBondContact O-CB 3.26Å; Q73-E77 PolarHBondContact O-N 3.41Å
78	N	62.2	Low	62.5	Low	87 Å²	87	122.5 Å²	122.5	47%	0.465	65%	0.646	S	S	.	*	H	α-helix	trans	-81.4	-21.4	172.4	-90.8	-80.5	0	0	0	114.5	W74 S75 L76	W74-N78 VanDerWaalsContact CE2-ND2 3.3Å; W74-N78 WeakPolarHBondContact O-CB 3.38Å; W74-N78 PolarHBondContact O-N 3.14Å; W74-N78 VanDerWaalsContact O-N 3.08Å; W74-N78 PolarHBondContact O-ND2 2.57Å; S75-N78 PolarHBondContact O-N 3.22Å; L76-N78 VanDerWaalsContact C-N 3.32Å; L76-N78 PolarHBondContact O-N 2.94Å
79	T	58.8	Low	61.3	Low	87 Å²	87	125.9 Å²	125.9	53%	0.534	64%	0.636	S	S	.	*	H	α-helix	trans	-87.6	-16.3	-178.3	-48.9	0	0	0	0	112.3	S75 L76 C81	S75-T79 VanDerWaalsContact O-CB 3.26Å; S75-T79 WeakPolarHBondContact O-CB 3.44Å; S75-T79 PolarHBondContact O-N 3.19Å; S75-T79 PolarHBondContact O-OG1 2.8Å; L76-T79 PolarHBondContact O-N 2.8Å; L76-T79 VanDerWaalsContact O-N 3.07Å; T79-C81 PolarHBondContact O-N 2.81Å
80	H	54.9	Low	60.3	Low	157 Å²	157	125.6 Å²	125.6	73%	0.727	63%	0.625	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.9	2.6	172.7	-82.1	-73.5	0	0	0	114.5	L76	L76-H80 PolarHBondContact O-CD2 2.95Å; L76-H80 PolarHBondContact O-N 2.9Å; L76-H80 VanDerWaalsContact O-N 3.16Å
81	C	52.9	Low	59.7	Low	103 Å²	103	130.3 Å²	130.3	70%	0.696	64%	0.637	S	S	*	*			trans	-104.6	62.8	169.7	-68.2	0	0	0	0	111.6	T79	T79-C81 PolarHBondContact O-N 2.81Å
82	W	44.6	Very low	59.4	Low	301 Å²	301	129.6 Å²	129.6	100%	1.14	63%	0.629	S	S	*	*			trans	-143.4	0	159.1	-71.2	99.4	0	0	0	110.6

Retrieved 82 of 82 residues in 88.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).